(data stored in ACNUC22857 zone)

EMBL: AK292531

ID   AK292531; SV 1; linear; mRNA; STD; HUM; 2989 BP.
XX
AC   AK292531;
XX
DT   15-OCT-2007 (Rel. 93, Created)
DT   07-OCT-2008 (Rel. 97, Last updated, Version 3)
XX
DE   Homo sapiens cDNA FLJ78481 complete cds, highly similar to Homo sapiens
DE   adaptor-related protein complex 2, beta 1 subunit, mRNA.
XX
KW   FLI_CDNA; oligo capping.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-2989
RA   Isogai T., Yamamoto J.;
RT   ;
RL   Submitted (09-OCT-2007) to the INSDC.
RL   Contact:Takao Isogai Reverse Proteomics Research Institute; 1-9-11
RL   Kaji-cho, Chiyoda-ku, Tokyo 101-0044, Japan E-mail :flj-cdna@nifty.com
XX
RN   [2]
RA   Wakamatsu A., Yamamoto J., Kimura K., Ishii S., Watanabe K., Sugiyama A.,
RA   Murakawa K., Kaida T., Tsuchiya K., Fukuzumi Y., Kumagai A., Oishi Y.,
RA   Yamamoto S., Ono Y., Komori Y., Yamazaki M., Kisu Y., Nishikawa T.,
RA   Sugano S., Nomura N., Isogai T.;
RT   "NEDO human cDNA sequencing project";
RL   Unpublished.
XX
DR   MD5; 0a2ceb0e4f695b60fdabf2f4d71a6f20.
XX
CC   Human cDNA sequencing project focused on splicing variants of mRNA
CC   in NEDO functional analysis of protein and research application
CC   project supported by Ministry of Economy, Trade and Industry,
CC   Japan; cDNA selection for complete cds sequencing: Reverse
CC   Proteomics Research Institute (REPRORI), Hitachi, Ltd., Japan
CC   (Hitachi) and Japan Biological Informatics Consortium, Japan
CC   (JBIC); cDNA complete cds sequencing: JBIC; cDNA library
CC   construction: Helix Research Institute supported by Japan Key
CC   Technology Center, Japan (HRI); cDNA 5'- & 3'-end sequencing:
CC   Research Association for Biotechnology, Japan, Biotechnology
CC   Center, National Institute of Technology and Evaluation, Japan and
CC   HRI; cDNA mapping to human genome: Central Research Laboratory,
CC   Hitachi; evaluation and annotation: REPRORI.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2989
FT                   /organism="Homo sapiens"
FT                   /mol_type="mRNA"
FT                   /clone_lib="TESTI4"
FT                   /clone="TESTI4030267"
FT                   /tissue_type="testis"
FT                   /note="cloning vector: pME18SFL3"
FT                   /db_xref="taxon:9606"
FT   CDS_pept        68..2923
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="highly similar to Homo sapiens adaptor-related
FT                   protein complex 2, beta 1 subunit, mRNA"
FT                   /db_xref="GOA:A8K916"
FT                   /db_xref="H-InvDB:HIT000425328.6"
FT                   /db_xref="InterPro:IPR000225"
FT                   /db_xref="InterPro:IPR002553"
FT                   /db_xref="InterPro:IPR008152"
FT                   /db_xref="InterPro:IPR009028"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR012295"
FT                   /db_xref="InterPro:IPR013037"
FT                   /db_xref="InterPro:IPR013041"
FT                   /db_xref="InterPro:IPR015151"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR016342"
FT                   /db_xref="InterPro:IPR026739"
FT                   /db_xref="UniProtKB/TrEMBL:A8K916"
FT                   /protein_id="BAF85220.1"
FT                   /translation="MTDSKYFTTNKKGEIFELKAELNNEKKEKRKEAVKKVIAAMTVGK
FT                   DVSSLFPDVVNCMQTDNLELKKLVYLYLMNYAKSQPDMAIMAVNSFVKDCEDPNPLIRA
FT                   LAVRTMGCIRVDKITEYLCEPLRKCLKDEDPYVRKTAAVCVAKLHDINAQMVEDQGFLD
FT                   SLRDLIADSNPMVVANAVAALSEISESHPNSNLLDLNPQNINKLLTALNECTEWGQIFI
FT                   LDCLSNYNPKDDREAQSICERVTPRLSHANSAVVLSAVKVLMKFLELLPKDSDYYNMLL
FT                   KKLAPPLVTLLSGEPEVQYVALRNINLIVQKRPEILKQEIKVFFVKYNDPIYVKLEKLD
FT                   IMIRLASQANIAQVLAELKEYATEVDVDFVRKAVRAIGRCAIKVEQSAERCVSTLLDLI
FT                   QTKVNYVVQEAIVVIRDIFRKYPNKYESIIATLCENLDSLDEPDARAAMIWIVGEYAER
FT                   IDNADELLESFLEGFHDESTQVQLTLLTAIVKLFLKKPSETQELVQQVLSLATQDSDNP
FT                   DLRDRGYIYWRLLSTDPVTAKEVVLSEKPLISEETDLIEPTLLDELICHIGSLASVYHK
FT                   PPNAFVEGSHGIHRKHLPIYHGSTDAGDSPVGTTTATNLEQPQVIPSQGDLLGDLLNLD
FT                   LGPPVNVPQVSSMQMGAVDLLGGGLDSLLGSDLGGGIGGSPAVGQSFIPSSVPATFAPS
FT                   PTPAVVSSGLNDLFEPSTGIGMAPGGYVAPKAVWLPAVKAKGLEISGTFTHRQGHIYME
FT                   MNFTNKALQHMTDFAIQFNKNSFGVIPSTPLAIHTPLMPNQSIDVSLPLNTLGPVMKME
FT                   PLNNLQVAVKNNIDVFYFSCLIPLNVLFVEDGKMERQVFLATWKDIPNENELQFQIKEC
FT                   HLNADTVSSKLQNNNVYTIAKRNVEGQDMLYQSLKLTNGIWILAELRIQPGNPNYTLSL
FT                   KCRAPEVSQYIYQVYDSILKN"
XX
SQ   Sequence 2989 BP; 849 A; 684 C; 705 G; 751 T; 0 other;
     gatgatgcag ggaaccgtcg ggtgtgacca ttgagaggga aaaggtgcac attaaagatc        60
     caaagtcatg actgactcca agtatttcac aaccaataaa aaaggagaaa tatttgaact       120
     aaaagctgaa ctcaacaatg aaaagaaaga aaagagaaag gaggctgtga agaaagtgat       180
     tgctgctatg accgtgggga aggatgttag ttctctcttt ccagacgtag tgaactgtat       240
     gcagactgac aatctggaac taaagaagct tgtgtatctc tacttgatga actacgccaa       300
     gagtcagcca gacatggcca tcatggctgt aaacagcttt gtgaaggact gtgaagatcc       360
     taatcctttg attcgagcct tggcagtcag aaccatgggg tgcatccggg tagacaaaat       420
     tacagaatat ctctgtgagc cgctccgcaa gtgcttgaag gatgaggatc cctatgttcg       480
     gaaaacagca gcagtctgcg tggcaaaact ccatgatatc aatgcccaaa tggtggaaga       540
     tcagggattt ctggattctc tacgggatct catagcagat tcaaatccaa tggtggtggc       600
     taatgccgta gcggcattat ctgaaatcag tgagtctcac ccaaacagca acttacttga       660
     tctgaaccca cagaacatta ataagctgct gacagccctg aatgaatgca ctgaatgggg       720
     ccagattttc atcctggact gcctgtctaa ttacaaccct aaagatgatc gggaggctca       780
     gagcatctgt gagcgggtaa ctccccggct atcccatgcc aactcagcag tggtgctttc       840
     agcggtaaaa gtcctaatga agtttctaga attgttacct aaggattctg actactacaa       900
     tatgctgctg aagaagttag cccctccact tgtcactttg ctgtctgggg agccagaagt       960
     gcagtatgtc gccctgagga acatcaactt aattgtccag aaaaggcctg aaatcttgaa      1020
     gcaggaaatc aaagtcttct ttgtgaagta caatgatccc atctatgtta aactagagaa      1080
     gttggacatc atgattcgtt tggcatctca agccaacatt gctcaggttc tggcagaact      1140
     gaaagaatat gctacagagg tggatgttga ctttgttcga aaagctgtgc gggccattgg      1200
     acggtgtgcc atcaaggtgg agcaatctgc agagcgctgt gtaagcacat tgcttgatct      1260
     aatccagacc aaagtgaatt atgtggtcca agaagcaatt gttgtcatca gggacatctt      1320
     ccgcaaatac cccaacaagt atgaaagtat catcgccact ctgtgtgaga acttagactc      1380
     gctggatgag ccagatgctc gagcagctat gatttggatt gtgggagaat atgctgaaag      1440
     aattgacaat gcagatgagt tactagaaag cttcctggag ggttttcacg atgaaagcac      1500
     ccaggtgcag ctcactctgc ttactgccat agtgaagctg tttctcaaga aaccatcaga      1560
     aacacaggag ctagtccagc aggtcttgag tttggcaaca caggattctg ataatcctga      1620
     ccttcgagac cggggctata tttattggcg ccttctctca actgaccctg ttacagctaa      1680
     agaagtagtc ttgtctgaga agccactgat ctctgaggag acggacctta ttgagccaac      1740
     tctgctggat gagctaatct gccacattgg ttctttggcc tctgtgtatc ataagcctcc      1800
     caatgctttt gtggaaggaa gtcatggaat tcatcgtaaa cacttgccaa tttatcatgg      1860
     gagcactgat gcaggtgaca gccctgttgg cactaccact gcaacgaacc tggaacagcc      1920
     tcaggttatc ccctctcaag gtgatcttct aggggatctt ttaaaccttg acctcggtcc      1980
     cccagtcaat gtgccacagg tgtcctccat gcagatggga gcagtggatc tcctaggagg      2040
     aggactagat agtctgcttg gcagtgacct tggcgggggc attggaggaa gtccggcagt      2100
     gggacaatcc ttcatcccat catcggtccc tgcaaccttt gctccttcac ctacacctgc      2160
     tgtggtcagc agtggactga atgacctgtt tgaaccctcc acagggatag gcatggcacc      2220
     tggtggatat gtggctccta aggctgtctg gctacctgca gtaaaggcta aaggcttgga      2280
     gatttccgga acatttactc accgccaagg gcacatctat atggaaatga acttcaccaa      2340
     taaagctctg cagcacatga cagattttgc aatccagttt aacaaaaata gctttggtgt      2400
     catccccagc actcctctgg ccatccatac accactgatg ccaaaccaga gcattgatgt      2460
     ctccctgcct ctcaatacct tgggcccagt catgaagatg gaacctctga ataacctcca      2520
     ggtggctgtg aaaaacaata tcgatgtctt ctacttcagc tgcctcatcc cactcaatgt      2580
     gctttttgta gaagatggca aaatggagcg ccaggtcttc cttgcaacat ggaaggatat      2640
     tcccaatgaa aatgaacttc agtttcagat taaggaatgt catttaaatg ctgacactgt      2700
     ttccagcaag ttgcaaaaca acaatgttta tactattgcc aagaggaatg tggaagggca      2760
     ggacatgctg taccaatccc tgaagctcac taatggcatt tggattttgg ccgaactacg      2820
     tatccagcca ggaaacccca attacacgct gtcactgaag tgtagagctc ctgaagtctc      2880
     tcaatacatc tatcaggtct acgacagcat tttgaaaaac taacaagact ggtccagtac      2940
     ccttcaacca tgctgtgatc ggtgcaagtc aagaactctt aactggaag                  2989
//

If you have problems or comments...

PBIL Back to PBIL home page