(data stored in ACNUC1829 zone)

EMBL: AK293073

ID   AK293073; SV 1; linear; mRNA; STD; HUM; 916 BP.
XX
AC   AK293073;
XX
DT   15-OCT-2007 (Rel. 93, Created)
DT   15-OCT-2008 (Rel. 97, Last updated, Version 3)
XX
DE   Homo sapiens cDNA FLJ77401 complete cds, highly similar to Homo sapiens
DE   CD151 antigen (CD151), transcript variant 1, mRNA.
XX
KW   FLI_CDNA; oligo capping.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-916
RA   Isogai T., Yamamoto J.;
RT   ;
RL   Submitted (09-OCT-2007) to the INSDC.
RL   Contact:Takao Isogai Reverse Proteomics Research Institute; 1-9-11
RL   Kaji-cho, Chiyoda-ku, Tokyo 101-0044, Japan E-mail :flj-cdna@nifty.com
XX
RN   [2]
RA   Wakamatsu A., Yamamoto J., Kimura K., Ishii S., Watanabe K., Sugiyama A.,
RA   Murakawa K., Kaida T., Tsuchiya K., Fukuzumi Y., Kumagai A., Oishi Y.,
RA   Yamamoto S., Ono Y., Komori Y., Yamazaki M., Kisu Y., Nishikawa T.,
RA   Sugano S., Nomura N., Isogai T.;
RT   "NEDO human cDNA sequencing project";
RL   Unpublished.
XX
DR   MD5; 0dee6752d27ee8ce953ff3798b331e46.
DR   Ensembl-Gn; ENSG00000177697; homo_sapiens.
DR   Ensembl-Tr; ENST00000322008; homo_sapiens.
DR   Ensembl-Tr; ENST00000397420; homo_sapiens.
DR   Ensembl-Tr; ENST00000397421; homo_sapiens.
DR   Ensembl-Tr; ENST00000530726; homo_sapiens.
XX
CC   Human cDNA sequencing project focused on splicing variants of mRNA
CC   in NEDO functional analysis of protein and research application
CC   project supported by Ministry of Economy, Trade and Industry,
CC   Japan; cDNA selection for complete cds sequencing: Reverse
CC   Proteomics Research Institute (REPRORI), Hitachi, Ltd., Japan
CC   (Hitachi) and Japan Biological Informatics Consortium, Japan
CC   (JBIC); cDNA complete cds sequencing: JBIC; cDNA library
CC   construction: Helix Research Institute supported by Japan Key
CC   Technology Center, Japan (HRI); cDNA 5'- & 3'-end sequencing:
CC   Research Association for Biotechnology, Japan, Biotechnology
CC   Center, National Institute of Technology and Evaluation, Japan and
CC   HRI; cDNA mapping to human genome: Central Research Laboratory,
CC   Hitachi; evaluation and annotation: REPRORI.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..916
FT                   /organism="Homo sapiens"
FT                   /mol_type="mRNA"
FT                   /clone_lib="UTERU3"
FT                   /clone="UTERU3004916"
FT                   /tissue_type="uterus"
FT                   /note="cloning vector: pME18SFL3"
FT                   /db_xref="taxon:9606"
FT   CDS_pept        112..873
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="highly similar to Homo sapiens CD151 antigen
FT                   (CD151), transcript variant 1, mRNA"
FT                   /db_xref="GOA:P48509"
FT                   /db_xref="H-InvDB:HIT000425870.6"
FT                   /db_xref="HGNC:HGNC:1630"
FT                   /db_xref="InterPro:IPR000301"
FT                   /db_xref="InterPro:IPR008952"
FT                   /db_xref="InterPro:IPR018499"
FT                   /db_xref="InterPro:IPR018503"
FT                   /db_xref="UniProtKB/Swiss-Prot:P48509"
FT                   /protein_id="BAF85762.1"
FT                   /translation="MGEFNEKKTTCGTVCLKYLLFTYNCCFWLAGLAVMAVGIWTLALK
FT                   SDYISLLASGTYLATAYILVVAGTVVMVTGVLGCCATFKERRNLLRLYFILLLIIFLLE
FT                   IIAGILAYAYYQQLNTELKENLKDTMTKRYHQPGHEAVTSAVDQLQQEFHCCGSNNSQD
FT                   WRDSEWIRSQEAGGRVVPDSCCKTVVALCGQRDHASNIYKVEGGCITKLETFIQEHLRV
FT                   IGAVGIGIACVQVFGMIFTCCLYRSLKLEHY"
XX
SQ   Sequence 916 BP; 171 A; 274 C; 278 G; 193 T; 0 other;
     agctgccgcc gccgccaggg cccggactcg gacgcgtggt agcctagagt cctggggagc        60
     ttctgtccac ctgtcctgca gaggagtcgt ttccagcccg gctgccccag gatgggtgag       120
     ttcaacgaga agaagacaac atgtggcacc gtttgcctca agtacctgct gtttacctac       180
     aattgctgct tctggctggc tggcctggct gtcatggcag tgggcatctg gacgctggcc       240
     ctcaagagtg actacatcag cctgctggcc tcaggcacct acctggccac agcctacatc       300
     ctggtggtgg cgggcactgt cgtcatggtg actggggtct tgggctgctg cgccaccttc       360
     aaggagcgtc ggaacctgct gcgcctgtac ttcatcctgc tcctcatcat ctttctgctg       420
     gagatcatcg ctggtatcct cgcctacgcc tactaccagc agctgaacac ggagctcaag       480
     gagaacctga aggacaccat gaccaagcgc taccaccagc cgggccatga ggctgtgacc       540
     agcgctgtgg accagctgca gcaggagttc cactgctgtg gcagcaacaa ctcacaggac       600
     tggcgagaca gtgagtggat ccgctcacag gaggccggtg gccgtgtggt cccagacagc       660
     tgctgcaaga cggtggtggc tctttgtgga cagcgagacc atgcctccaa catctacaag       720
     gtggagggcg gctgcatcac caagttggag accttcatcc aggagcacct gagggtcatt       780
     ggggctgtgg ggatcggcat tgcctgtgtg caggtctttg gcatgatctt cacgtgctgc       840
     ctgtacagga gtctcaagct ggagcactac tgaccctgcc ttgggccttg ctgctgctgc       900
     acccaactac tgagct                                                       916
//

If you have problems or comments...

PBIL Back to PBIL home page