(data stored in ACNUC30567 zone)

EMBL: AK293382

ID   AK293382; SV 1; linear; mRNA; STD; HUM; 1874 BP.
XX
AC   AK293382;
XX
DT   24-JUL-2008 (Rel. 96, Created)
DT   24-JUL-2008 (Rel. 96, Last updated, Version 1)
XX
DE   Homo sapiens cDNA FLJ60418 complete cds, highly similar to ADAM 28
DE   precursor (EC 3.4.24.-) (Adisintegrin and metalloproteinase domain 28).
XX
KW   FLI_CDNA; oligo capping.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1874
RA   Isogai T., Yamamoto J.;
RT   ;
RL   Submitted (09-OCT-2007) to the INSDC.
RL   Contact:Takao Isogai Reverse Proteomics Research Institute; 1-9-11
RL   Kaji-cho, Chiyoda-ku, Tokyo 101-0044, Japan E-mail :flj-cdna@nifty.com
XX
RN   [2]
RA   Wakamatsu A., Yamamoto J., Kimura K., Ishii S., Watanabe K., Sugiyama A.,
RA   Murakawa K., Kaida T., Tsuchiya K., Fukuzumi Y., Kumagai A., Oishi Y.,
RA   Yamamoto S., Ono Y., Komori Y., Yamazaki M., Kisu Y., Nishikawa T.,
RA   Sugano S., Nomura N., Isogai T.;
RT   "NEDO human cDNA sequencing project focused on splicing variants";
RL   Unpublished.
XX
DR   MD5; cf60e18ad93e13bf5e4732e1cd7a8015.
XX
CC   Human cDNA sequencing project focused on splicing variants of mRNA
CC   in NEDO functional analysis of protein and research application
CC   project supported by Ministry of Economy, Trade and Industry,
CC   Japan; cDNA selection for complete cds sequencing: Reverse
CC   Proteomics Research Institute (REPRORI), Hitachi, Ltd., Japan
CC   (Hitachi) and Japan Biological Informatics Consortium, Japan
CC   (JBIC); cDNA complete cds sequencing: JBIC; cDNA library
CC   construction: Helix Research Institute supported by Japan Key
CC   Technology Center, Japan (HRI); cDNA 5'- & 3'-end sequencing:
CC   Research Association for Biotechnology, Japan, Biotechnology
CC   Center, National Institute of Technology and Evaluation, Japan and
CC   HRI; cDNA mapping to human genome: Central Research Laboratory,
CC   Hitachi; evaluation and annotation: REPRORI.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1874
FT                   /organism="Homo sapiens"
FT                   /mol_type="mRNA"
FT                   /clone_lib="BLADE2"
FT                   /clone="BLADE2005874"
FT                   /tissue_type="bladder"
FT                   /note="cloning vector: pME18SFL3"
FT                   /db_xref="taxon:9606"
FT   CDS_pept        589..1512
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="highly similar to ADAM 28 precursor (EC 3.4.24.-)
FT                   (Adisintegrin and metalloproteinase domain 28)"
FT                   /db_xref="GOA:B4DDY3"
FT                   /db_xref="H-InvDB:HIT000488006.4"
FT                   /db_xref="InterPro:IPR001590"
FT                   /db_xref="InterPro:IPR001762"
FT                   /db_xref="InterPro:IPR006586"
FT                   /db_xref="InterPro:IPR018358"
FT                   /db_xref="InterPro:IPR024079"
FT                   /db_xref="InterPro:IPR034027"
FT                   /db_xref="InterPro:IPR036436"
FT                   /db_xref="UniProtKB/TrEMBL:B4DDY3"
FT                   /protein_id="BAG56894.1"
FT                   /translation="MANYVNMLYKKLNTHVALVGMEIWTDKDKIKITPNASFTLENFSK
FT                   WRGSVLSRRKRHDIAQLITATELAGTTVGLAFMSTMCSPYSVGVVQDHSDNLLRVAGTM
FT                   AHEMGHNFGMFHDDYSCKCPSTICVMDKALSFYIPTDFSSCSRLSYDKFFEDKLSNCLF
FT                   NAPLPTDIISTPICGNQLVEMGEDCDCGTSEECTNICCDAKTCKIKATFQCALGECCEK
FT                   CQFKKAGMVCRPAKDECDLPEMCNGKSGNCPDDRFQVNGFPCHHGKGHCLMGTCPTLQE
FT                   QCTELWGPGRRTNPFPCACAKENHFR"
XX
SQ   Sequence 1874 BP; 579 A; 338 C; 429 G; 528 T; 0 other;
     actggagagg aggcagggac agacccagca gcacccacct gagcgagaag agcagacacc        60
     gtgctcctgg aatcacccag catgttgcaa ggtctcctgc cagtcagtct cctcctctct       120
     gttgcagtaa gtgctataaa agaactccct ggggtgaaga agtatgaagt ggtttatcct       180
     ataagacttc atccactgca taaaagagag gccaaagagc cagagcaaca ggaacaattt       240
     gaaactgaat taaagtataa aatgacaatt aatggaaaaa ttgcagtgct ttatttgaaa       300
     aaaaaacaag aacctccttg caccaggcta cacggaaaca tattataatt ctactggaaa       360
     ggagatcacc acaagcccac aaattatgga tgattgttat tatcaaggac atattcttaa       420
     tgaaaaggtt tctgacgcta gcatcagcac atgtaggggt ctaagaaatt gaaagacagg       480
     aaggttcagg aacatgagaa atacatagaa tattatttgg tcctggataa tggtgagttt       540
     aaaaggtaca atgagaatca agatgagatc agaaagaggg tatttgagat ggctaattat       600
     gtcaacatgc tttataaaaa gctcaatact catgtggcct tagttggtat ggaaatctgg       660
     actgacaagg ataagataaa gataacccca aatgcaagct tcaccttgga gaatttttct       720
     aaatggaggg ggagtgttct ctcaagaaga aagcgtcatg atattgctca gttaatcaca       780
     gcaacagaac ttgctggaac gactgtgggt cttgcattta tgtctacaat gtgttctcct       840
     tattctgttg gcgttgttca ggaccacagc gataatcttc ttagagttgc agggacaatg       900
     gcacatgaaa tgggccacaa ctttggaatg tttcatgacg actattcttg caagtgtcct       960
     tctacaatat gtgtgatgga caaagcactg agcttctata tacccacaga cttcagttcc      1020
     tgcagccgtc tcagctatga caagtttttt gaagataaat tatcaaattg cctctttaat      1080
     gctccattgc ctacagatat catatccact ccaatttgtg ggaaccagtt ggtggaaatg      1140
     ggagaggact gtgattgtgg gacatctgag gaatgtacca atatttgctg tgatgctaag      1200
     acatgtaaaa tcaaagcaac ttttcaatgt gcattaggag aatgttgtga aaaatgccaa      1260
     tttaaaaagg ctgggatggt gtgcagacca gcaaaagatg agtgcgacct gcctgaaatg      1320
     tgtaatggta aatctggtaa ttgtcctgat gatagattcc aggtcaatgg cttcccttgc      1380
     catcacggga agggccactg cttgatgggg acatgcccca cactgcagga gcagtgcaca      1440
     gagctgtggg gaccaggtag gaggacaaat cctttcccct gtgcatgtgc gaaggaaaat      1500
     catttcagat gacagtgttt aaccatggtc aaaggaccat tctgtcctat ccttcttaga      1560
     agcttcgaac tcaaaatcat ggaaaggttt taagatttga ggttggtttt agggttgcta      1620
     gatttagcaa gtaaaaataa ggatggcccc gttaaatttt aacttaaaat taacaagttt      1680
     tttgttaatt ttttgttttt tgtctcagca tcagtatatc ccatgcaata tttgaggtgt      1740
     gctcatacta aaattatttg tgtatctgaa attcaaatta aactgggtgt ctttttcttt      1800
     tcatctggca accctactaa gatcataaac ccttggaaat ctgtgtgtgt gcgggtgtgt      1860
     gtgtgtgtgt gtgt                                                        1874
//

If you have problems or comments...

PBIL Back to PBIL home page