(data stored in ACNUC22857 zone)

EMBL: AK294406

ID   AK294406; SV 1; linear; mRNA; STD; HUM; 2561 BP.
XX
AC   AK294406;
XX
DT   24-JUL-2008 (Rel. 96, Created)
DT   24-JUL-2008 (Rel. 96, Last updated, Version 1)
XX
DE   Homo sapiens cDNA FLJ56967 complete cds, highly similar to
DE   Adapter-relatedprotein complex 1 beta-1 subunit.
XX
KW   FLI_CDNA; oligo capping.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-2561
RA   Isogai T., Yamamoto J.;
RT   ;
RL   Submitted (09-OCT-2007) to the INSDC.
RL   Contact:Takao Isogai Reverse Proteomics Research Institute; 1-9-11
RL   Kaji-cho, Chiyoda-ku, Tokyo 101-0044, Japan E-mail :flj-cdna@nifty.com
XX
RN   [2]
RA   Wakamatsu A., Yamamoto J., Kimura K., Ishii S., Watanabe K., Sugiyama A.,
RA   Murakawa K., Kaida T., Tsuchiya K., Fukuzumi Y., Kumagai A., Oishi Y.,
RA   Yamamoto S., Ono Y., Komori Y., Yamazaki M., Kisu Y., Nishikawa T.,
RA   Sugano S., Nomura N., Isogai T.;
RT   "NEDO human cDNA sequencing project focused on splicing variants";
RL   Unpublished.
XX
DR   MD5; 77c1531ce126a92928cbd8752b1cee35.
XX
CC   Human cDNA sequencing project focused on splicing variants of mRNA
CC   in NEDO functional analysis of protein and research application
CC   project supported by Ministry of Economy, Trade and Industry,
CC   Japan; cDNA selection for complete cds sequencing: Reverse
CC   Proteomics Research Institute (REPRORI), Hitachi, Ltd., Japan
CC   (Hitachi) and Japan Biological Informatics Consortium, Japan
CC   (JBIC); cDNA complete cds sequencing: JBIC; cDNA library
CC   construction: Helix Research Institute supported by Japan Key
CC   Technology Center, Japan (HRI); cDNA 5'- & 3'-end sequencing:
CC   Research Association for Biotechnology, Japan, Biotechnology
CC   Center, National Institute of Technology and Evaluation, Japan and
CC   HRI; cDNA mapping to human genome: Central Research Laboratory,
CC   Hitachi; evaluation and annotation: REPRORI.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2561
FT                   /organism="Homo sapiens"
FT                   /mol_type="mRNA"
FT                   /clone_lib="BRAMY2"
FT                   /clone="BRAMY2046483"
FT                   /tissue_type="amygdala"
FT                   /note="cloning vector: pME18SFL3"
FT                   /db_xref="taxon:9606"
FT   CDS_pept        93..1601
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="highly similar to Adapter-relatedprotein complex 1
FT                   beta-1 subunit"
FT                   /db_xref="GOA:B4DG47"
FT                   /db_xref="H-InvDB:HIT000489030.4"
FT                   /db_xref="InterPro:IPR002553"
FT                   /db_xref="InterPro:IPR008152"
FT                   /db_xref="InterPro:IPR009028"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR012295"
FT                   /db_xref="InterPro:IPR013037"
FT                   /db_xref="InterPro:IPR013041"
FT                   /db_xref="InterPro:IPR015151"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR026739"
FT                   /db_xref="UniProtKB/TrEMBL:B4DG47"
FT                   /protein_id="BAG57658.1"
FT                   /translation="MIWIVGEYAERIDNADELLESFLEGFHDESTQVQLQLLTAIVKLF
FT                   LKKPTETQELVQQVLSLATQDSDNPDLRDRGYIYWRLLSTDPVAAKEVVLAEKPLISEE
FT                   TDLIEPTLLDELICYIGTLASVYHKPPSAFVEGGRGVVHKSLPPRTASSESAESPETAP
FT                   TGAPPGEQPDVIPAQGDLLGDLLNLDLGPPVSGPPLATSSVQMGAVDLLGGGLDSLMGD
FT                   EPEGIGGTNFVAPPTAAVPANLGAPIGSGLSDLFDLTSGVGTLSGSYVAPKAVWLPAMK
FT                   AKGLEISGTFTRQVGSISMDLQLTNKALQVMTDFAIQFNRNSFGLAPAAPLQVHAPLSP
FT                   NQTVEISLPLSTVGSVMKMEPLNNLQVAVKNNIDVFYFSTLYPLHILFVEDGKMDRQMF
FT                   LATWKDIPNENEAQFQIRDCPPNAEAASSKLQSSNIFTVAKRNVEGQDMLYQSLKLTNG
FT                   IWVLAELRIQPGNPSCTDLELSLKCRAPEVSQHVYQAYETILKN"
XX
SQ   Sequence 2561 BP; 507 A; 820 C; 756 G; 478 T; 0 other;
     tcttccgcaa gtaccccaac aagtatgaga gtgtgattgc cacactgtgt gagaatctgg        60
     actccctgga tgagcctgag gcccgggctg ccatgatctg gattgtgggc gagtacgcgg       120
     aacggatcga caacgcagat gagctgctgg agagcttcct cgagggcttc catgacgaga       180
     gcacacaggt ccagctgcag ctgctgacag ccattgtgaa actctttcta aagaagccaa       240
     cagagaccca ggagctggtg cagcaggtcc tcagtttggc cactcaggac tcagataacc       300
     cagacctgcg ggaccgtggc tacatctact ggcgcctgct gtccacggac ccggtggcag       360
     ccaaggaggt ggtgttggct gagaagccac tcatctctga agagacggac ctcatcgagc       420
     ccacactgtt agacgagctt atctgctaca tcggcacgct ggcttccgtc taccataagc       480
     ctcccagtgc ctttgtggag gggggccggg gcgtcgtgca caagagcctg ccacctcgca       540
     cggcctcgag tgagagcgca gagagccctg agacagcccc tactggagca cctcctgggg       600
     agcagccaga tgtcatcccc gcccagggcg acctgctggg tgacctcctc aacctggacc       660
     tcggcccccc agtgagcggc ccacccctgg ccacctcctc ggtgcagatg ggagctgtgg       720
     accttcttgg cggtggcctt gacagcctga tgggggatga gcctgaaggg attgggggca       780
     ccaacttcgt ggcacctcca acagcagcag taccagccaa tcttggagca cccatcggca       840
     gtggcctgag tgacctcttt gacctgacca gtggcgtggg caccctgtca ggatcatatg       900
     tggcccccaa agcagtctgg ctcccagcca tgaaggctaa ggggctggag atctcaggca       960
     ccttcacccg ccaggtgggc tccatctcca tggacctgca gctgaccaac aaggccttgc      1020
     aggtcatgac cgactttgcc atccagttca accgcaacag ctttggcctg gcccccgccg      1080
     cccccctcca ggtccacgca ccactcagcc ccaaccagac agtggagatc tccctgcctc      1140
     tcagcacggt gggctcggtc atgaagatgg agcctctgaa caacctccag gtggccgtga      1200
     agaacaacat cgatgtcttc tacttcagca ccttgtaccc actgcacatc ctctttgtgg      1260
     aggacgggaa gatggaccgg cagatgttcc tggccacatg gaaggatatt cccaatgaga      1320
     atgaggccca gttccagatc agagactgcc cccccaatgc agaggctgcg agcagcaagc      1380
     tgcagagcag caacatcttc actgtcgcca agaggaacgt ggagggccag gacatgctct      1440
     accagtccct gaagctgacc aacggcatct gggtgctggc ggagctgcgg atccagccgg      1500
     gcaaccccag ctgcacggac ttagagctgt ccctgaagtg tcgagcacca gaggtgtccc      1560
     agcacgtgta ccaggcctac gagaccatcc tcaagaactg agaccccggc cagcgcccac      1620
     cccagccttc tgcccgcccc atcgaggagg cccctcgggg gcagcacatc ttcctcctcg      1680
     caggagggac caggcggggc tccaggccac tcagtgggct ccctggtcct gatggcagaa      1740
     cccacccgat ccctggggta gggcaccacc ccctcctggg gtgagagcgc agtgcactcc      1800
     cgtgctctgg gacacccctg ctcctgtggc tgtgatgtgg ggttaagtga ggtggggacc      1860
     aaaggaaaca gagccagagc agccacagaa gctgtgcctg aagggtgagt gtggagcttg      1920
     cccctccggc tcacagcccc ggcagcccct ggctccttgg tctctccggt tggtgttaaa      1980
     gggccctcca ctgccacctc tcatgggatg gaccctgcca acctggcctg ggtgtgcagg      2040
     gaggggttcc ccttggtacc aggagagctg ctcacttagg gcctggggct caaggagctg      2100
     taggtgccgg cagaggggca gagctaggct gggaggagcc cagggcctgc accacccact      2160
     tgcaaccacc aggctggtgc cctgcagctg tgccagttgg gccacagcct cccgagtgct      2220
     gacccacatg gtcaagacca ggcagaagct cccagagccc ctgtctcggg ctccccaccg      2280
     actggcagct gcactatccc caactcccca cttctgcccc aagggtggtc actgcctgtg      2340
     atacattcct cagtgtcgcc tctgagccca ggcctcctgc cacaaagact gggccgagag      2400
     atggggctgg gtaagcgggt gcgcctcctg tttgggtttc ttcggggttt ctctgtagtg      2460
     tctgctgccc tcctcctggc ctcccaggtt tcagttgtgt ctgacagagc attaggtttt      2520
     cctgttactg ctgtgtaaca ataaagaaag attcggcttt t                          2561
//

If you have problems or comments...

PBIL Back to PBIL home page