(data stored in ACNUC8465 zone)

EMBL: AK294923

ID   AK294923; SV 1; linear; mRNA; STD; HUM; 1401 BP.
XX
AC   AK294923;
XX
DT   24-JUL-2008 (Rel. 96, Created)
DT   24-JUL-2008 (Rel. 96, Last updated, Version 1)
XX
DE   Homo sapiens cDNA FLJ52538 complete cds, highly similar to Dual specificity
DE   mitogen-activated proteinkinase kinase 4 (EC 2.7.12.2).
XX
KW   FLI_CDNA; oligo capping.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1401
RA   Isogai T., Yamamoto J.;
RT   ;
RL   Submitted (09-OCT-2007) to the INSDC.
RL   Contact:Takao Isogai Reverse Proteomics Research Institute; 1-9-11
RL   Kaji-cho, Chiyoda-ku, Tokyo 101-0044, Japan E-mail :flj-cdna@nifty.com
XX
RN   [2]
RA   Wakamatsu A., Yamamoto J., Kimura K., Ishii S., Watanabe K., Sugiyama A.,
RA   Murakawa K., Kaida T., Tsuchiya K., Fukuzumi Y., Kumagai A., Oishi Y.,
RA   Yamamoto S., Ono Y., Komori Y., Yamazaki M., Kisu Y., Nishikawa T.,
RA   Sugano S., Nomura N., Isogai T.;
RT   "NEDO human cDNA sequencing project focused on splicing variants";
RL   Unpublished.
XX
DR   MD5; bd5b9c305504176e43cfffe567432b2c.
XX
CC   Human cDNA sequencing project focused on splicing variants of mRNA
CC   in NEDO functional analysis of protein and research application
CC   project supported by Ministry of Economy, Trade and Industry,
CC   Japan; cDNA selection for complete cds sequencing: Reverse
CC   Proteomics Research Institute (REPRORI), Hitachi, Ltd., Japan
CC   (Hitachi) and Japan Biological Informatics Consortium, Japan
CC   (JBIC); cDNA complete cds sequencing: JBIC; cDNA library
CC   construction: Helix Research Institute supported by Japan Key
CC   Technology Center, Japan (HRI); cDNA 5'- & 3'-end sequencing:
CC   Research Association for Biotechnology, Japan, Biotechnology
CC   Center, National Institute of Technology and Evaluation, Japan and
CC   HRI; cDNA mapping to human genome: Central Research Laboratory,
CC   Hitachi; evaluation and annotation: REPRORI.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1401
FT                   /organism="Homo sapiens"
FT                   /mol_type="mRNA"
FT                   /clone_lib="BRAWH3"
FT                   /clone="BRAWH3024899"
FT                   /tissue_type="brain"
FT                   /note="cloning vector: pME18SFL3"
FT                   /db_xref="taxon:9606"
FT   CDS_pept        15..1145
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="highly similar to Dual specificity mitogen-activated
FT                   proteinkinase kinase 4 (EC 2.7.12.2)"
FT                   /db_xref="GOA:B4DH44"
FT                   /db_xref="H-InvDB:HIT000489547.4"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:B4DH44"
FT                   /protein_id="BAG58005.1"
FT                   /translation="MAAPSPSGTPVSSMQGKRKALKLNFANPPFKSTARFTLNPNPTGV
FT                   QNPHIERLRTHSIESSGKLKISPEQHWDFTAEDLKDLGEIGRGAYGSVNKMVHKPSGQI
FT                   MAVKRIRSTVDEKEQKQLLMDLDVVMRSSDCPYIVQFYGALFREGDCWICMELMSTSFD
FT                   KFYKYVYSVLDDVIPEEILGKITLATVKALNHLKENLKIIHRDIKPSNILLDRSGNIKL
FT                   CDFGISGQLVDSIAKTRDAGCRPYMAPERIDPSASRQGYDVRSDVWSLGITLYELATGR
FT                   FPYPKWNSVFDQLTQVVKGDPPQLSNSEEREFSPSFINFVNLCLTKDESKRPKYKELLK
FT                   HPFILMYEERAVEVACYVCKILDQMPATPSSPMYVD"
XX
SQ   Sequence 1401 BP; 431 A; 293 C; 304 G; 373 T; 0 other;
     cttcactccc aacaatggcg gctccgagcc cgagcggcac ccccgtcagc agcatgcagg        60
     gtaaacgcaa agcactgaag ttgaattttg caaatccacc tttcaaatct acagcaaggt       120
     ttactctgaa tcccaatcct acaggagttc aaaacccaca catagagaga ctgagaacac       180
     acagcattga gtcatcagga aaactgaaga tctcccctga acaacactgg gatttcactg       240
     cagaggactt gaaagacctt ggagaaattg gacgaggagc ttatggttct gtcaacaaaa       300
     tggtccacaa accaagtggg caaataatgg cagttaaaag aattcggtca acagtggatg       360
     aaaaagaaca aaaacaactt cttatggatt tggatgtagt aatgcggagt agtgattgcc       420
     catacattgt tcagttttat ggtgcactct tcagagaggg tgactgttgg atctgtatgg       480
     aactcatgtc tacctcgttt gataagtttt acaaatatgt atatagtgta ttagatgatg       540
     ttattccaga agaaatttta ggcaaaatca ctttagcaac tgtgaaagca ctaaaccact       600
     taaaagaaaa cttgaaaatt attcacagag atatcaaacc ttccaatatt cttctggaca       660
     gaagtggaaa tattaagctc tgtgacttcg gcatcagtgg acagcttgtg gactctattg       720
     ccaagacaag agatgctggc tgtaggccat acatggcacc tgaaagaata gacccaagcg       780
     catcacgaca aggatatgat gtccgctctg atgtctggag tttggggatc acattgtatg       840
     agttggccac aggccgattt ccttatccaa agtggaatag tgtatttgat caactaacac       900
     aagtcgtgaa aggagatcct ccgcagctga gtaattctga ggaaagggaa ttctccccga       960
     gtttcatcaa ctttgtcaac ttgtgcctta cgaaggatga atccaaaagg ccaaagtata      1020
     aagagcttct gaaacatccc tttattttga tgtatgaaga acgtgccgtt gaggtcgcat      1080
     gctatgtttg taaaatcctg gatcaaatgc cagctactcc cagctctccc atgtatgtcg      1140
     attgatatcg ctgctacatc agactctaga aaaaagggct gagaggaagc aagacgtaaa      1200
     gaattttcat cccgtatcac agtgttttta ttgctcgccc agacaccatg tgcaataaga      1260
     ttggtgttcg tttccatcat gtctgtatac tcctgtcacc tagaacgtgc atccttgtaa      1320
     tacctgattg atcacgcagt gttagtgctg gtcagagaga cctcatcctg ctcttttgtg      1380
     atgaacatat tcatgaaatg t                                                1401
//

If you have problems or comments...

PBIL Back to PBIL home page