(data stored in ACNUC9306 zone)

EMBL: AK295075

ID   AK295075; SV 1; linear; mRNA; STD; HUM; 1724 BP.
XX
AC   AK295075;
XX
DT   23-JAN-2009 (Rel. 99, Created)
DT   23-JAN-2009 (Rel. 99, Last updated, Version 1)
XX
DE   Homo sapiens cDNA FLJ58499 complete cds, highly similar to Radixin.
XX
KW   FLI_CDNA; oligo capping.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1724
RA   Isogai T., Yamamoto J.;
RT   ;
RL   Submitted (09-OCT-2007) to the INSDC.
RL   Contact:Takao Isogai Reverse Proteomics Research Institute; 1-9-11
RL   Kaji-cho, Chiyoda-ku, Tokyo 101-0044, Japan E-mail :flj-cdna@nifty.com
XX
RN   [2]
RA   Wakamatsu A., Yamamoto J., Kimura K., Ishii S., Watanabe K., Sugiyama A.,
RA   Murakawa K., Kaida T., Tsuchiya K., Fukuzumi Y., Kumagai A., Oishi Y.,
RA   Yamamoto S., Ono Y., Komori Y., Yamazaki M., Kisu Y., Nishikawa T.,
RA   Sugano S., Nomura N., Isogai T.;
RT   "NEDO human cDNA sequencing project focused on splicing variants";
RL   Unpublished.
XX
DR   MD5; 1824f93d9e0c0b6b127af9566278b5d9.
XX
CC   Human cDNA sequencing project focused on splicing variants of mRNA
CC   in NEDO functional analysis of protein and research application
CC   project supported by Ministry of Economy, Trade and Industry,
CC   Japan; cDNA selection for complete cds sequencing: Reverse
CC   Proteomics Research Institute (REPRORI), Hitachi, Ltd., Japan
CC   (Hitachi) and Japan Biological Informatics Consortium, Japan
CC   (JBIC); cDNA complete cds sequencing: JBIC; cDNA library
CC   construction: Helix Research Institute supported by Japan Key
CC   Technology Center, Japan (HRI); cDNA 5'- & 3'-end sequencing:
CC   Research Association for Biotechnology, Japan, Biotechnology
CC   Center, National Institute of Technology and Evaluation, Japan and
CC   HRI; cDNA mapping to human genome: Central Research Laboratory,
CC   Hitachi; evaluation and annotation: REPRORI.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1724
FT                   /organism="Homo sapiens"
FT                   /mol_type="mRNA"
FT                   /clone_lib="BRAWH3"
FT                   /clone="BRAWH3038542"
FT                   /tissue_type="brain"
FT                   /note="cloning vector: pME18SFL3"
FT                   /db_xref="taxon:9606"
FT   CDS_pept        64..1407
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="highly similar to Radixin"
FT                   /db_xref="GOA:B7Z2S7"
FT                   /db_xref="H-InvDB:HIT000489699.4"
FT                   /db_xref="InterPro:IPR000299"
FT                   /db_xref="InterPro:IPR000798"
FT                   /db_xref="InterPro:IPR008954"
FT                   /db_xref="InterPro:IPR011259"
FT                   /db_xref="InterPro:IPR011993"
FT                   /db_xref="InterPro:IPR014352"
FT                   /db_xref="InterPro:IPR018980"
FT                   /db_xref="InterPro:IPR019747"
FT                   /db_xref="InterPro:IPR019748"
FT                   /db_xref="InterPro:IPR035963"
FT                   /db_xref="InterPro:IPR041789"
FT                   /db_xref="UniProtKB/TrEMBL:B7Z2S7"
FT                   /protein_id="BAH11963.1"
FT                   /translation="MLSWNLPFSPIQLANNFLTSVLEQHKLTKEQWEERIQNWHEEHKG
FT                   MLREDSMMEYLKIAQDLEMYGVNYFEIKNKKGTELWLGVDALGLNIYEHDDKLTPKIGF
FT                   PWSEIRNISFNDKKFVIKPIDKKAPDFVFYAPRLRINKRILALCMGNHELYMRRRKPDT
FT                   IEVQQMKAQAREEKHQKQLERAQLENEKKKREIAEKEKERIEREKEELMERLKQIEEQT
FT                   IKAQKELEEQTRKALELDQERKRAKEEAERLEKERRAAEEAKSAIAKQAADQMKNQEQL
FT                   AAELAEFTAKIALLEEAKKKKEEEATEWQHKAFAAQEDLEKTKEELKTVMSAPPPPPPP
FT                   PVIPPTENEHDEHDENNAEASAELSNEGVMNHRSEEERVTETQKNERVKKQLQALSSEL
FT                   AQARDETKKTQNDVLHAENVKAGRDKYKTLRQIRQGNTKQRIDEFEAM"
XX
SQ   Sequence 1724 BP; 655 A; 295 C; 389 G; 385 T; 0 other;
     aagaaggtaa caaaaagaga aagaaaatgc cgaaaccaat caacgtaaga gtaactacaa        60
     tggatgctga gctggaattt gccattcagc ccaatacaac tggcaaacaa ctttttgacc       120
     agtgtattgg aacaacacaa actaacaaaa gaacagtggg aagaaagaat acagaactgg       180
     catgaagaac ataaaggaat gttaagggag gattctatga tggaatacct gaagattgca       240
     caagatctag aaatgtatgg agtcaactat tttgaaataa aaaataaaaa aggaactgaa       300
     ttgtggctag gtgttgatgc tttgggtctg aatatttatg agcatgacga caagttaaca       360
     cctaaaattg gttttccctg gagtgaaatc agaaatattt catttaatga caaaaaattt       420
     gttataaagc caatcgacaa aaaggcacct gattttgtgt tttatgcacc tcgtctgaga       480
     atcaataagc ggattttggc cttatgtatg ggaaaccatg aactatacat gcgaagaagg       540
     aagcctgata ctattgaagt acaacagatg aaggctcagg ctagggagga gaaacatcag       600
     aagcagttgg aaagggcaca attagagaat gaaaagaaga aaagagaaat agcagaaaag       660
     gaaaaggaaa gaatagaacg tgaaaaggaa gagctaatgg aacgtctaaa acaaattgaa       720
     gagcagacaa ttaaagctca gaaagaacta gaagaacaga ctcgaaaagc tctagaactg       780
     gatcaagaac gaaaacgagc aaaagaagaa gcagaacgac ttgaaaagga gcgtcgagct       840
     gctgaagagg caaagtctgc catagcaaaa caagctgccg accagatgaa gaatcaggag       900
     cagctagcag cagaacttgc tgaattcact gccaagattg cacttctaga ggaagccaag       960
     aagaaaaagg aagaggaagc tactgagtgg caacacaaag cttttgcagc ccaggaagac      1020
     ttggaaaaga ccaaggaaga gttaaaaact gtgatgtctg ccccccctcc acctccacca      1080
     ccaccagtca ttcctccaac agaaaacgaa catgatgaac acgatgagaa taatgctgaa      1140
     gctagtgctg aattatcaaa tgaaggggta atgaaccata gaagcgagga agaacgtgta      1200
     accgaaacac agaaaaatga gcgtgttaag aagcaacttc aggcattaag ttcagaatta      1260
     gcccaagcca gagatgaaac caagaaaaca caaaatgatg ttcttcatgc tgagaatgtt      1320
     aaagcaggcc gtgataagta caagactctg cgacagattc gacaaggcaa tacaaagcag      1380
     cgtatcgatg agtttgaagc aatgtgagag ctgttatttt gcatatatgt tcttcataag      1440
     ctgaaccacc aacagagaaa agcaggcctt tgcagatatg atggaatgca tcccaccttg      1500
     ccaaagcact tacaccagtt tgactgtgct agctaaaaga caaatttaag gggagctctt      1560
     caacattaag gcagtatgat atcatgcttg gttttctttt ttcttttggt ccagggaatg      1620
     gagaatggtg ttccattgcc tcttttcaca ttttttttct ttttcttttt ttttctgttg      1680
     aagattaaca ctaattatca cgtctgacaa atgtgtatgt gtgg                       1724
//

If you have problems or comments...

PBIL Back to PBIL home page