(data stored in ACNUC1829 zone)

EMBL: AK296332

ID   AK296332; SV 1; linear; mRNA; STD; HUM; 983 BP.
XX
AC   AK296332;
XX
DT   24-JUL-2008 (Rel. 96, Created)
DT   24-JUL-2008 (Rel. 96, Last updated, Version 1)
XX
DE   Homo sapiens cDNA FLJ56697 complete cds, highly similar to CD9 antigen.
XX
KW   FLI_CDNA; oligo capping.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-983
RA   Isogai T., Yamamoto J.;
RT   ;
RL   Submitted (09-OCT-2007) to the INSDC.
RL   Contact:Takao Isogai Reverse Proteomics Research Institute; 1-9-11
RL   Kaji-cho, Chiyoda-ku, Tokyo 101-0044, Japan E-mail :flj-cdna@nifty.com
XX
RN   [2]
RA   Wakamatsu A., Yamamoto J., Kimura K., Ishii S., Watanabe K., Sugiyama A.,
RA   Murakawa K., Kaida T., Tsuchiya K., Fukuzumi Y., Kumagai A., Oishi Y.,
RA   Yamamoto S., Ono Y., Komori Y., Yamazaki M., Kisu Y., Nishikawa T.,
RA   Sugano S., Nomura N., Isogai T.;
RT   "NEDO human cDNA sequencing project focused on splicing variants";
RL   Unpublished.
XX
DR   MD5; 23c2e108cbeaf66748099a3c3d4a5893.
XX
CC   Human cDNA sequencing project focused on splicing variants of mRNA
CC   in NEDO functional analysis of protein and research application
CC   project supported by Ministry of Economy, Trade and Industry,
CC   Japan; cDNA selection for complete cds sequencing: Reverse
CC   Proteomics Research Institute (REPRORI), Hitachi, Ltd., Japan
CC   (Hitachi) and Japan Biological Informatics Consortium, Japan
CC   (JBIC); cDNA complete cds sequencing: JBIC; cDNA library
CC   construction: Helix Research Institute supported by Japan Key
CC   Technology Center, Japan (HRI); cDNA 5'- & 3'-end sequencing:
CC   Research Association for Biotechnology, Japan, Biotechnology
CC   Center, National Institute of Technology and Evaluation, Japan and
CC   HRI; cDNA mapping to human genome: Central Research Laboratory,
CC   Hitachi; evaluation and annotation: REPRORI.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..983
FT                   /organism="Homo sapiens"
FT                   /mol_type="mRNA"
FT                   /clone_lib="BRTHA3"
FT                   /clone="BRTHA3003107"
FT                   /tissue_type="thalamus"
FT                   /note="cloning vector: pME18SFL3"
FT                   /db_xref="taxon:9606"
FT   CDS_pept        128..877
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="highly similar to CD9 antigen"
FT                   /db_xref="GOA:B4DK09"
FT                   /db_xref="H-InvDB:HIT000490956.4"
FT                   /db_xref="InterPro:IPR000301"
FT                   /db_xref="InterPro:IPR008952"
FT                   /db_xref="InterPro:IPR018499"
FT                   /db_xref="InterPro:IPR018503"
FT                   /db_xref="UniProtKB/TrEMBL:B4DK09"
FT                   /protein_id="BAG59021.1"
FT                   /translation="MPVKGGTKCIKYLLFGFNFIFWLAGIAVLAIGLWLRFDSQTKSIF
FT                   EQETNNNNSSFYTGVYILIGAGALMMLVGFLGCCGAVQESQCMLGLFFGFLLVIFAIEI
FT                   AAAIWGYSHKDEVIKEVQEFYKDTYNKLKTKDEPQRETLKAIHYAVCRLGKDTLLRFLR
FT                   IVSAHRVLTAPDQCKHSNRLLTICFSHPHPCLLAVVELLWFGWGRGTVYLRHLPQEGRT
FT                   RNLHREGKLRPGSWCPCPHCSGQTLQA"
XX
SQ   Sequence 983 BP; 217 A; 294 C; 239 G; 233 T; 0 other;
     taaaagtgca gccggagacc agcctacagc cgcctgcatc tgtatccagc gccaggtccc        60
     gccagtccca gctgcgcgcg ccccccagtc ccgcacccgt tcggcccagg ctaagttagc       120
     cctcaccatg ccggtcaaag gaggcaccaa gtgcatcaaa tacctgctgt tcggatttaa       180
     cttcatcttc tggcttgccg ggattgctgt ccttgccatt ggactatggc tccgattcga       240
     ctctcagacc aagagcatct tcgagcaaga aactaataat aataattcca gcttctacac       300
     aggagtctat attctgatcg gagccggcgc cctcatgatg ctggtgggct tcctgggctg       360
     ctgcggggct gtgcaggagt cccagtgcat gctgggactg ttcttcggct tcctcttggt       420
     gatattcgcc attgaaatag ctgcggccat ctggggatat tcccacaagg atgaggtgat       480
     taaggaagtc caggagtttt acaaggacac ctacaacaag ctgaaaacca aggatgagcc       540
     ccagcgggaa acgctgaaag ccatccacta tgcggtatgt cgccttggca aagacaccct       600
     cctgcgcttt ctccggattg tgtctgcaca cagggtgctg actgcaccag accagtgcaa       660
     acattctaat cgtcttctta caatttgttt ctctcatccc catccctgcc ttctcgctgt       720
     agttgaactg ctgtggtttg gctgggggcg tggaacagtt tatctcagac atctgcccca       780
     agaaggacgt actcgaaacc ttcaccgtga aggtaaactc agaccaggat cctggtgtcc       840
     ctgcccccat tgctctggac aaaccctgca agcatgaaag tgacagcagc caagtgctgc       900
     ttcagcaaga cccgttctgc ctgtgaaagg gccccagggc acccatctct ttctctccca       960
     ctttgggccc tctgtttact caa                                               983
//

If you have problems or comments...

PBIL Back to PBIL home page