(data stored in ACNUC8465 zone)

EMBL: AK297495

ID   AK297495; SV 1; linear; mRNA; STD; HUM; 992 BP.
XX
AC   AK297495;
XX
DT   24-JUL-2008 (Rel. 96, Created)
DT   24-JUL-2008 (Rel. 96, Last updated, Version 1)
XX
DE   Homo sapiens cDNA FLJ52116 complete cds, highly similar to Rho-related
DE   GTP-binding protein RhoB precursor.
XX
KW   FLI_CDNA; oligo capping.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-992
RA   Isogai T., Yamamoto J.;
RT   ;
RL   Submitted (09-OCT-2007) to the INSDC.
RL   Contact:Takao Isogai Reverse Proteomics Research Institute; 1-9-11
RL   Kaji-cho, Chiyoda-ku, Tokyo 101-0044, Japan E-mail :flj-cdna@nifty.com
XX
RN   [2]
RA   Wakamatsu A., Yamamoto J., Kimura K., Ishii S., Watanabe K., Sugiyama A.,
RA   Murakawa K., Kaida T., Tsuchiya K., Fukuzumi Y., Kumagai A., Oishi Y.,
RA   Yamamoto S., Ono Y., Komori Y., Yamazaki M., Kisu Y., Nishikawa T.,
RA   Sugano S., Nomura N., Isogai T.;
RT   "NEDO human cDNA sequencing project focused on splicing variants";
RL   Unpublished.
XX
DR   MD5; a41569d7a0ea918acdc50f10683bffa1.
XX
CC   Human cDNA sequencing project focused on splicing variants of mRNA
CC   in NEDO functional analysis of protein and research application
CC   project supported by Ministry of Economy, Trade and Industry,
CC   Japan; cDNA selection for complete cds sequencing: Reverse
CC   Proteomics Research Institute (REPRORI), Hitachi, Ltd., Japan
CC   (Hitachi) and Japan Biological Informatics Consortium, Japan
CC   (JBIC); cDNA complete cds sequencing: JBIC; cDNA library
CC   construction: Helix Research Institute supported by Japan Key
CC   Technology Center, Japan (HRI); cDNA 5'- & 3'-end sequencing:
CC   Research Association for Biotechnology, Japan, Biotechnology
CC   Center, National Institute of Technology and Evaluation, Japan and
CC   HRI; cDNA mapping to human genome: Central Research Laboratory,
CC   Hitachi; evaluation and annotation: REPRORI.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..992
FT                   /organism="Homo sapiens"
FT                   /mol_type="mRNA"
FT                   /dev_stage="fetal"
FT                   /clone_lib="FCBBF5"
FT                   /clone="FCBBF5000543"
FT                   /tissue_type="brain"
FT                   /note="cloning vector: pME18SFL3"
FT                   /db_xref="taxon:9606"
FT   CDS_pept        297..644
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="highly similar to Rho-related GTP-binding protein
FT                   RhoB precursor"
FT                   /db_xref="GOA:B4DMJ8"
FT                   /db_xref="H-InvDB:HIT000492119.4"
FT                   /db_xref="InterPro:IPR001806"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B4DMJ8"
FT                   /protein_id="BAG59910.1"
FT                   /translation="MCFSVDSPDSLENIPEKWVPEVKHFCPNVPIILVANKKDLRSDEH
FT                   VRTELARMKQEPVRTDDGRAMAVRIQAYDYLECSAKTKEGVREVFETATRAALQKRYGS
FT                   QNGCINCCKVL"
XX
SQ   Sequence 992 BP; 170 A; 348 C; 309 G; 165 T; 0 other;
     atctgccacc gcagtctggt tggagctgtt gtcttgtatg ctcagcgagg cccggagaga        60
     cccgggagag agctaggccg agtccaccgc ccgagtctgc tgcccgagcc cgcgttacgc       120
     acaaagccgc cgatccccgg cctggggtga gcagagcgac caccgtcttc gagaactatg       180
     tggccgacat tgaggtggac ggcaagcagg tggagctggc gctgtgggac acggcgggcc       240
     aggaggacta cgaccgcctg cggccgctct cctacccgga caccgacgtc attctcatgt       300
     gcttctcggt ggacagcccg gactcgctgg agaacatccc cgagaagtgg gtccccgagg       360
     tgaagcactt ctgtcccaat gtgcccatca tcctggtggc caacaaaaaa gacctgcgca       420
     gcgacgagca tgtccgcaca gagctggccc gcatgaagca ggaacccgtg cgcacggatg       480
     acggccgcgc catggccgtg cgcatccaag cctacgacta cctcgagtgc tctgccaaga       540
     ccaaggaagg cgtgcgcgag gtcttcgaga cggccacgcg cgccgcgctg cagaagcgct       600
     acggctccca gaacggctgc atcaactgct gcaaggtgct atgagggccg cgcccgtcgc       660
     gcctgcccct gccggcacgg ctccccctcc tggaccagtc ccccgcgagc ccggagaagg       720
     ggagacccgt gtcccacaag gaccccaccg gcctgcctgg catctgtctg ctgacgcctc       780
     tggcttgcgc caggacttgg cgtgggcacc gggcgccccc atcccagtgt ctgtgtgcgt       840
     ccagctgtgt tgcacaggcc tgggctcccc actgagtgcc aagggtcccc tgagcatgct       900
     tttctgaaga gccgggcctc agagtgtgtg gctgtgtgtc tgttcgactc ccctcgcccc       960
     attttcaccc cacccccgcc tctgatcccc gg                                     992
//

If you have problems or comments...

PBIL Back to PBIL home page