(data stored in ACNUC30630 zone)

EMBL: AK298218

ID   AK298218; SV 1; linear; mRNA; STD; HUM; 1149 BP.
XX
AC   AK298218;
XX
DT   24-JUL-2008 (Rel. 96, Created)
DT   31-JUL-2008 (Rel. 96, Last updated, Version 2)
XX
DE   Homo sapiens cDNA FLJ57412 complete cds, highly similar to tRNA
DE   pseudouridine synthase-like 1 (EC 5.4.99.-).
XX
KW   FLI_CDNA; oligo capping.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1149
RA   Isogai T., Yamamoto J.;
RT   ;
RL   Submitted (09-OCT-2007) to the INSDC.
RL   Contact:Takao Isogai Reverse Proteomics Research Institute; 1-9-11
RL   Kaji-cho, Chiyoda-ku, Tokyo 101-0044, Japan E-mail :flj-cdna@nifty.com
XX
RN   [2]
RA   Wakamatsu A., Yamamoto J., Kimura K., Ishii S., Watanabe K., Sugiyama A.,
RA   Murakawa K., Kaida T., Tsuchiya K., Fukuzumi Y., Kumagai A., Oishi Y.,
RA   Yamamoto S., Ono Y., Komori Y., Yamazaki M., Kisu Y., Nishikawa T.,
RA   Sugano S., Nomura N., Isogai T.;
RT   "NEDO human cDNA sequencing project focused on splicing variants";
RL   Unpublished.
XX
DR   MD5; cebeaebf39c8c8491620e1786335cfb0.
DR   Ensembl-Gn; ENSG00000169972; homo_sapiens.
DR   Ensembl-Tr; ENST00000379031; homo_sapiens.
XX
CC   Human cDNA sequencing project focused on splicing variants of mRNA
CC   in NEDO functional analysis of protein and research application
CC   project supported by Ministry of Economy, Trade and Industry,
CC   Japan; cDNA selection for complete cds sequencing: Reverse
CC   Proteomics Research Institute (REPRORI), Hitachi, Ltd., Japan
CC   (Hitachi) and Japan Biological Informatics Consortium, Japan
CC   (JBIC); cDNA complete cds sequencing: JBIC; cDNA library
CC   construction: Helix Research Institute supported by Japan Key
CC   Technology Center, Japan (HRI); cDNA 5'- & 3'-end sequencing:
CC   Research Association for Biotechnology, Japan, Biotechnology
CC   Center, National Institute of Technology and Evaluation, Japan and
CC   HRI; cDNA mapping to human genome: Central Research Laboratory,
CC   Hitachi; evaluation and annotation: REPRORI.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1149
FT                   /organism="Homo sapiens"
FT                   /mol_type="mRNA"
FT                   /clone_lib="IMR322"
FT                   /clone="IMR322015602"
FT                   /cell_line="IMR32"
FT                   /cell_type="neuroblastoma"
FT                   /note="cloning vector: pME18SFL3"
FT                   /db_xref="taxon:9606"
FT   CDS_pept        424..852
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="highly similar to tRNA pseudouridine synthase-like 1
FT                   (EC 5.4.99.-)"
FT                   /db_xref="GOA:Q8N0Z8"
FT                   /db_xref="H-InvDB:HIT000492842.4"
FT                   /db_xref="HGNC:HGNC:26914"
FT                   /db_xref="InterPro:IPR001406"
FT                   /db_xref="InterPro:IPR020095"
FT                   /db_xref="InterPro:IPR020097"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8N0Z8"
FT                   /protein_id="BAG60488.1"
FT                   /translation="MVAMQEAAQHLLGTHDFSAFQSAGSPVPSPVRTLRRVSVSPGQAS
FT                   PLVTPEESRKLRFWNLEFESQSFLYRQVRRMTAVLVAVGLGALAPAQVKTILESQDPLG
FT                   KHQTRVAPAHGLFLKSVLYGNLGAASCTLQGPQFGSHG"
XX
SQ   Sequence 1149 BP; 208 A; 400 C; 342 G; 199 T; 0 other;
     gagttcggcg ccggcctcag gctccgtgcg cgcgcgctat cttgtgtact tccagtacgt        60
     gggcaccgac tttaagaggc cgccgagcgg ctgaattccg tggagccggt caggttcacc       120
     atctccagcc gcacggacgc cggggtccac gccctgagca acgcggcgca cctggacgtc       180
     cagcgccgct caggccggcc gcccttcccg cccgaggtcc tggccgaggc cctcaacaca       240
     cacctgcggc acccggccat cagggtcctg cgggccttcc gagtgcccag cgacttccac       300
     gctcgtcacg cagccacgtc ccggacctac ctgtaccgcc tggccactgg ctgtcaccgg       360
     cgtgatgagc tgccggtgtt tgaacgcaac ctatgctgga ctctcccggc agactgcctg       420
     gatatggtcg ccatgcagga agccgcccag cacctcctcg gcacacacga cttcagcgcc       480
     ttccagtccg ctggcagccc ggtgccgagc cccgtgcgaa cgctgcgccg ggtctccgtt       540
     tccccaggcc aagccagccc cttggtcacc cccgaggaga gcaggaagct gcggttctgg       600
     aacctggagt ttgagagcca gtctttcctg tatagacagg tacggaggat gacggctgtg       660
     ctggtggccg tggggctggg ggctttggca cctgcccagg tgaagacgat tctggagagc       720
     caagatcccc tgggcaagca ccagacacgt gtagccccag cccacggctt attcctcaag       780
     tcagtgctgt acgggaacct cggtgctgcc tcctgcaccc tgcaggggcc acagttcggg       840
     agccacggat gaccctggac actcaagcca aagttaggcc acaccaggcc caaccctgtg       900
     ctggtcaagc cagggcagtc acagctgctt ggggcccaca gcactgctgc ctggtctcca       960
     cagtagcctc cctgcccggg tcccagcacc ctggatgccc gtctctgtcc caggcgggat      1020
     ggggcacagt gcaggacaca gccatgtaca ccaagaagag agtaccaagt agtcttttgt      1080
     tcagctttta ctggaaactg ctgtctagga ccacctgccc taaccaggaa taaaggcaag      1140
     acagcctgg                                                              1149
//

If you have problems or comments...

PBIL Back to PBIL home page