(data stored in ACNUC22857 zone)

EMBL: AK299613

ID   AK299613; SV 1; linear; mRNA; STD; HUM; 1888 BP.
XX
AC   AK299613;
XX
DT   24-JUL-2008 (Rel. 96, Created)
DT   24-JUL-2008 (Rel. 96, Last updated, Version 1)
XX
DE   Homo sapiens cDNA FLJ56828 complete cds, highly similar to
DE   Adapter-relatedprotein complex 1 beta-1 subunit.
XX
KW   FLI_CDNA; oligo capping.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1888
RA   Isogai T., Yamamoto J.;
RT   ;
RL   Submitted (09-OCT-2007) to the INSDC.
RL   Contact:Takao Isogai Reverse Proteomics Research Institute; 1-9-11
RL   Kaji-cho, Chiyoda-ku, Tokyo 101-0044, Japan E-mail :flj-cdna@nifty.com
XX
RN   [2]
RA   Wakamatsu A., Yamamoto J., Kimura K., Ishii S., Watanabe K., Sugiyama A.,
RA   Murakawa K., Kaida T., Tsuchiya K., Fukuzumi Y., Kumagai A., Oishi Y.,
RA   Yamamoto S., Ono Y., Komori Y., Yamazaki M., Kisu Y., Nishikawa T.,
RA   Sugano S., Nomura N., Isogai T.;
RT   "NEDO human cDNA sequencing project focused on splicing variants";
RL   Unpublished.
XX
DR   MD5; 1dc488e5d1a996ba6eed7e248ebc95d1.
XX
CC   Human cDNA sequencing project focused on splicing variants of mRNA
CC   in NEDO functional analysis of protein and research application
CC   project supported by Ministry of Economy, Trade and Industry,
CC   Japan; cDNA selection for complete cds sequencing: Reverse
CC   Proteomics Research Institute (REPRORI), Hitachi, Ltd., Japan
CC   (Hitachi) and Japan Biological Informatics Consortium, Japan
CC   (JBIC); cDNA complete cds sequencing: JBIC; cDNA library
CC   construction: Helix Research Institute supported by Japan Key
CC   Technology Center, Japan (HRI); cDNA 5'- & 3'-end sequencing:
CC   Research Association for Biotechnology, Japan, Biotechnology
CC   Center, National Institute of Technology and Evaluation, Japan and
CC   HRI; cDNA mapping to human genome: Central Research Laboratory,
CC   Hitachi; evaluation and annotation: REPRORI.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1888
FT                   /organism="Homo sapiens"
FT                   /mol_type="mRNA"
FT                   /dev_stage="fetal"
FT                   /clone_lib="OCBBF2"
FT                   /clone="OCBBF2017256"
FT                   /tissue_type="brain"
FT                   /note="cloning vector: pME18SFL3"
FT                   /db_xref="taxon:9606"
FT   CDS_pept        94..1593
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="highly similar to Adapter-relatedprotein complex 1
FT                   beta-1 subunit"
FT                   /db_xref="GOA:B4DS79"
FT                   /db_xref="H-InvDB:HIT000494237.4"
FT                   /db_xref="InterPro:IPR002553"
FT                   /db_xref="InterPro:IPR008152"
FT                   /db_xref="InterPro:IPR009028"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR012295"
FT                   /db_xref="InterPro:IPR013037"
FT                   /db_xref="InterPro:IPR013041"
FT                   /db_xref="InterPro:IPR015151"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR026739"
FT                   /db_xref="UniProtKB/TrEMBL:B4DS79"
FT                   /protein_id="BAG61541.1"
FT                   /translation="MIWIVGEYAERIDNADELLESFLEGFHDESTQVQLQLLTAIVKLF
FT                   LKKPTETQELVQQVLSLATQDSDNPDLRDRGYIYWRLLSTDPVAAKEVVLAEKPLISEE
FT                   TDLIEPTLLDELICYIGTLASVYHKPPSAFVEGGRGVVHKSLPPRTASSESAESPETAP
FT                   TGAPPGEQPDVIPAQGDLLGDLLNLDLGPPVSGPPLATSSVQMGAVDLLGGGLDSLMGD
FT                   EPEGIGGTNFVAPPTAAVPANLGAPIGSGLSDLFDLTSGVGTLSGSYVAPKAVWLPAMK
FT                   AKGLEISGTFTRQVGSISMDLQLTNKALQVMTDFAIQFNRNSFGLAPAAPLQVHAPLSP
FT                   NQTVEISLPLSTVGSVMKMEPLNNLQVAVKNNIDVFYFSTLYPLHILFVEDGKMDRQMF
FT                   LATWKDIPNENEAQFQIRDCPLNAEAASSKLQSSNIFTVAKRNVEGQDMLYQSLKLTNG
FT                   IWVLAELRIQPGNPSCTLSLKCRAPEVSQHVYQAYETILKN"
XX
SQ   Sequence 1888 BP; 397 A; 607 C; 554 G; 330 T; 0 other;
     atcttccgca agtaccccaa caagtatgag agtgtgattg ccacactgtg tgagaatctg        60
     gactccctgg atgagcctga ggcccgggct gccatgatct ggattgtggg cgagtacgcg       120
     gaacggatcg acaacgcaga tgagctgctg gagagcttcc tcgagggctt ccatgacgag       180
     agcacacagg tccagctgca gctgctgaca gccattgtga aactctttct aaagaagcca       240
     acagagaccc aggagctggt gcagcaggtc ctcagtttgg ccactcagga ctcagataac       300
     ccagacctgc gggaccgtgg ctacatctac tggcgcctgc tgtccacgga cccggtggca       360
     gccaaggagg tggtgttggc tgagaagcca ctcatctctg aagagacgga cctcatcgag       420
     cccacactgt tagacgagct tatctgctac atcggcacgc tggcttccgt ctaccataag       480
     cctcccagtg cctttgtgga ggggggccgg ggcgtcgtgc acaagagcct gccacctcgc       540
     acggcctcga gtgagagcgc agagagccct gagacagccc ctactggagc acctcctggg       600
     gagcagccag atgtcatccc cgcccagggc gacctgctgg gtgacctcct caacctggac       660
     ctcggccccc cagtgagcgg cccacccctg gccacctcct cggtgcagat gggagctgtg       720
     gaccttcttg gcggtggcct tgacagcctg atgggggatg agcctgaagg gattgggggc       780
     accaacttcg tggcacctcc aacagcagca gtaccagcca atcttggagc acccatcggc       840
     agtggcctga gtgacctctt tgacctgacc agtggcgtgg gcaccctgtc aggatcatat       900
     gtggccccca aagcagtctg gctcccagcc atgaaggcta aggggctgga gatctcaggc       960
     accttcaccc gccaggtggg ctccatctcc atggacctgc agctgaccaa caaggccttg      1020
     caggtcatga ccgactttgc catccagttc aaccgcaaca gctttggcct ggcccccgcc      1080
     gcccccctcc aggtccacgc accactcagc cccaaccaga cagtggagat ctccctgcct      1140
     ctcagcacgg tgggctcggt catgaagatg gagcctctga acaacctcca ggtggccgtg      1200
     aagaacaaca tcgatgtctt ctacttcagc accttgtacc cactgcacat cctctttgtg      1260
     gaggacggga agatggaccg gcagatgttc ctggccacat ggaaggatat tcccaatgag      1320
     aatgaggccc agttccagat cagagactgc cccctcaatg cagaggctgc gagcagcaag      1380
     ctgcagagca gcaacatctt cactgtcgcc aagaggaacg tggagggcca ggacatgctc      1440
     taccagtccc tgaagctgac caacggcatc tgggtgctgg cggagctgcg gatccagccg      1500
     ggcaacccca gctgcacgct gtccctgaag tgtcgagcac cagaggtgtc ccagcacgtg      1560
     taccaggcct acgagaccat cctcaagaac tgagaccccg gccagcgccc accccagcct      1620
     tctgcccgcc ccatcgagga ggcccctcgg gggcagcaca tcttcctcct cgcaggaggg      1680
     accaggcggg gctccaggcc actcagtggg ctccctggtc ctgatggcag aacccacccg      1740
     atccctgggg tagggcacca ccccctcctg gggtgagagc gcagtgcact cccgtgctct      1800
     gggacacccc tgctcctgtg gctgtgatgt ggggttaagt gaggtgggga ccaaaggaaa      1860
     cagagccaga gcagccacag aagctgtg                                         1888
//

If you have problems or comments...

PBIL Back to PBIL home page