(data stored in ACNUC31108 zone)

EMBL: AK301016

ID   AK301016; SV 1; linear; mRNA; STD; HUM; 1598 BP.
XX
AC   AK301016;
XX
DT   24-JUL-2008 (Rel. 96, Created)
DT   24-JUL-2008 (Rel. 96, Last updated, Version 1)
XX
DE   Homo sapiens cDNA FLJ61172 complete cds, highly similar to Leukocyte
DE   antigen CD37.
XX
KW   FLI_CDNA; oligo capping.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1598
RA   Isogai T., Yamamoto J.;
RT   ;
RL   Submitted (09-OCT-2007) to the INSDC.
RL   Contact:Takao Isogai Reverse Proteomics Research Institute; 1-9-11
RL   Kaji-cho, Chiyoda-ku, Tokyo 101-0044, Japan E-mail :flj-cdna@nifty.com
XX
RN   [2]
RA   Wakamatsu A., Yamamoto J., Kimura K., Ishii S., Watanabe K., Sugiyama A.,
RA   Murakawa K., Kaida T., Tsuchiya K., Fukuzumi Y., Kumagai A., Oishi Y.,
RA   Yamamoto S., Ono Y., Komori Y., Yamazaki M., Kisu Y., Nishikawa T.,
RA   Sugano S., Nomura N., Isogai T.;
RT   "NEDO human cDNA sequencing project focused on splicing variants";
RL   Unpublished.
XX
DR   MD5; a942a7ed80cf2dc1a8628e0eef90e2cc.
DR   Ensembl-Gn; ENSG00000104894; homo_sapiens.
DR   Ensembl-Tr; ENST00000323906; homo_sapiens.
DR   Ensembl-Tr; ENST00000426897; homo_sapiens.
DR   Ensembl-Tr; ENST00000598095; homo_sapiens.
XX
CC   Human cDNA sequencing project focused on splicing variants of mRNA
CC   in NEDO functional analysis of protein and research application
CC   project supported by Ministry of Economy, Trade and Industry,
CC   Japan; cDNA selection for complete cds sequencing: Reverse
CC   Proteomics Research Institute (REPRORI), Hitachi, Ltd., Japan
CC   (Hitachi) and Japan Biological Informatics Consortium, Japan
CC   (JBIC); cDNA complete cds sequencing: JBIC; cDNA library
CC   construction: Helix Research Institute supported by Japan Key
CC   Technology Center, Japan (HRI); cDNA 5'- & 3'-end sequencing:
CC   Research Association for Biotechnology, Japan, Biotechnology
CC   Center, National Institute of Technology and Evaluation, Japan and
CC   HRI; cDNA mapping to human genome: Central Research Laboratory,
CC   Hitachi; evaluation and annotation: REPRORI.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1598
FT                   /organism="Homo sapiens"
FT                   /mol_type="mRNA"
FT                   /clone_lib="SMINT2"
FT                   /clone="SMINT2018590"
FT                   /tissue_type="small intestine"
FT                   /note="cloning vector: pME18SFL3"
FT                   /db_xref="taxon:9606"
FT   CDS_pept        316..924
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="highly similar to Leukocyte antigen CD37"
FT                   /db_xref="GOA:P11049"
FT                   /db_xref="H-InvDB:HIT000495640.4"
FT                   /db_xref="HGNC:HGNC:1666"
FT                   /db_xref="InterPro:IPR000301"
FT                   /db_xref="InterPro:IPR008952"
FT                   /db_xref="InterPro:IPR018499"
FT                   /db_xref="InterPro:IPR018503"
FT                   /db_xref="UniProtKB/Swiss-Prot:P11049"
FT                   /protein_id="BAG62633.1"
FT                   /translation="MGIALLGCVGALKELRCLLGLYFGMLLLLFATQITLGILISTQRA
FT                   QLERSLRDVVEKTIQKYGTNPEETAAEESWDYVQFQLRCCGWHYPQDWFQVLILRGNGS
FT                   EAHRVPCSCYNLSATNDSTILDKVILPQLSRLGHLARSRHSADICAVPAESHIYREGCA
FT                   QGLQKWLHNNLISIVGICLGVGLLEVIWPRPHPRSALNP"
XX
SQ   Sequence 1598 BP; 274 A; 534 C; 458 G; 332 T; 0 other;
     ctggaacttc ctcttttggg gttcttcctt tctctctcag ctctccgtct ctctttctct        60
     ctcagcctct ttctttctcc ctgtctcccc cactgtcagc acctcttctg tgtggtgagt       120
     ggaccgctta ccccactagg tgaagatgtc agcccaggag agctgcctca gcctcatcaa       180
     gtcctcggca gcctgatctt ctgcttcggc atctggatcc tcattgacaa gaccagcttc       240
     gtgtcctttg tgggcttggc cttcgtgcct ctgcagatct ggtccaaagt cctggccatc       300
     tcaggaatct tcaccatggg catcgccctc ctgggttgtg tgggggccct caaggagctc       360
     cgctgcctcc tgggcctgta ttttgggatg ctgctgctcc tgtttgccac acagatcacc       420
     ctgggaatcc tcatctccac tcagcgggcc cagctggagc gaagcttgcg ggacgtcgta       480
     gagaaaacca tccaaaagta cggcaccaac cccgaggaga ccgcggccga ggagagctgg       540
     gactatgtgc agttccagct gcgctgctgc ggctggcact acccgcagga ctggttccaa       600
     gtcctcatcc tgagaggtaa cgggtcggag gcgcaccgcg tgccctgctc ctgctacaac       660
     ttgtcggcga ccaacgactc cacaatccta gataaggtga tcttgcccca gctcagcagg       720
     cttggacacc tggcgcggtc cagacacagt gcagacatct gcgctgtccc tgcagagagc       780
     cacatctacc gcgagggctg cgcgcagggc ctccagaagt ggctgcacaa caaccttatt       840
     tccatagtgg gcatttgcct gggcgtcggc ctactcgagg tgatctggcc ccgcccccac       900
     ccgcgatcgg ccctaaatcc ctagatggcc ctgcccttca tttcgcgtcc ttcggttgcc       960
     tgggaaggac gagctcaggg cggagcgcag cccaccccgg ccctcccgcc gctccaccca      1020
     gcaccggagg gtaggggcgg cccagcttca gggagccctg attgggtgta cgcagggaaa      1080
     gcctcctgct attggctgcg atctccctcc cctttctccg cagatgactg tcatggtgct      1140
     gagcgtacag ctacagcgca gggcactccg ccggaaatgc gagccgcacg tgccgggcgc      1200
     tggggattcg agccccgggc ccagcctgat cgctgacggc ggcggcgggc acagcggcag      1260
     tctgtggggt ggctggggca tggcgggtgc ctgccccaac tggggagaca aggcaccgca      1320
     gggcaagctg cccatggccc tggggctctg gccgctgtgg gttcaagacg aggaccagcc      1380
     tgacactgga agtgcgggcg cagaattaga ggaggcacaa ttagaggctg aggcagaggg      1440
     ggaagacaga tgagcctcca aaataaagga ccctgggctt gctcccgacc ttactccttc      1500
     tcagcctcta cccccacttg tagcagctat tcccgcctca tcagccagcc ctgcggcagt      1560
     tcccgtcgag ccccgccctt ttctacctat ccccttct                              1598
//

If you have problems or comments...

PBIL Back to PBIL home page