(data stored in ACNUC31108 zone)

EMBL: AK301328

ID   AK301328; SV 1; linear; mRNA; STD; HUM; 1333 BP.
XX
AC   AK301328;
XX
DT   24-JUL-2008 (Rel. 96, Created)
DT   24-JUL-2008 (Rel. 96, Last updated, Version 1)
XX
DE   Homo sapiens cDNA FLJ58471 complete cds, highly similar to Leukocyte
DE   antigen CD37.
XX
KW   FLI_CDNA; oligo capping.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1333
RA   Isogai T., Yamamoto J.;
RT   ;
RL   Submitted (09-OCT-2007) to the INSDC.
RL   Contact:Takao Isogai Reverse Proteomics Research Institute; 1-9-11
RL   Kaji-cho, Chiyoda-ku, Tokyo 101-0044, Japan E-mail :flj-cdna@nifty.com
XX
RN   [2]
RA   Wakamatsu A., Yamamoto J., Kimura K., Ishii S., Watanabe K., Sugiyama A.,
RA   Murakawa K., Kaida T., Tsuchiya K., Fukuzumi Y., Kumagai A., Oishi Y.,
RA   Yamamoto S., Ono Y., Komori Y., Yamazaki M., Kisu Y., Nishikawa T.,
RA   Sugano S., Nomura N., Isogai T.;
RT   "NEDO human cDNA sequencing project focused on splicing variants";
RL   Unpublished.
XX
DR   MD5; 104049947d39ea7114606c855f031c9a.
XX
CC   Human cDNA sequencing project focused on splicing variants of mRNA
CC   in NEDO functional analysis of protein and research application
CC   project supported by Ministry of Economy, Trade and Industry,
CC   Japan; cDNA selection for complete cds sequencing: Reverse
CC   Proteomics Research Institute (REPRORI), Hitachi, Ltd., Japan
CC   (Hitachi) and Japan Biological Informatics Consortium, Japan
CC   (JBIC); cDNA complete cds sequencing: JBIC; cDNA library
CC   construction: Helix Research Institute supported by Japan Key
CC   Technology Center, Japan (HRI); cDNA 5'- & 3'-end sequencing:
CC   Research Association for Biotechnology, Japan, Biotechnology
CC   Center, National Institute of Technology and Evaluation, Japan and
CC   HRI; cDNA mapping to human genome: Central Research Laboratory,
CC   Hitachi; evaluation and annotation: REPRORI.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1333
FT                   /organism="Homo sapiens"
FT                   /mol_type="mRNA"
FT                   /clone_lib="SYNOV2"
FT                   /clone="SYNOV2000289"
FT                   /tissue_type="synovial membrane tissue from rheumatoid
FT                   arthritis"
FT                   /note="cloning vector: pME18SFL3"
FT                   /db_xref="taxon:9606"
FT   CDS_pept        115..927
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="highly similar to Leukocyte antigen CD37"
FT                   /db_xref="GOA:B4DW15"
FT                   /db_xref="H-InvDB:HIT000495952.4"
FT                   /db_xref="InterPro:IPR000301"
FT                   /db_xref="InterPro:IPR008952"
FT                   /db_xref="InterPro:IPR018499"
FT                   /db_xref="InterPro:IPR018503"
FT                   /db_xref="UniProtKB/TrEMBL:B4DW15"
FT                   /protein_id="BAG62877.1"
FT                   /translation="MSAQESCLSLIKYFLFVFNLFFFVLGSLIFCFGIWILIDKTSFVS
FT                   FVGLAFVPLQIWSKVLAISGIFTMGIALLGCVGALKELRCLLGLYFGMLLLLFATQITL
FT                   GILISTQRAQLERSLRDVVEKTIQKYGTNPEETAAEESWDYVQFQLRCCGWHYPQGWFQ
FT                   VLILRGNGSEAHRVPCSCYNLSATNDSTILDKVILPQLSRLGHLARSRHSAGICAVPAE
FT                   SHIYREGCAQGLQKWLHNNLISIVGICLGVGLLEVIWPRPHPRSALNP"
XX
SQ   Sequence 1333 BP; 219 A; 449 C; 385 G; 280 T; 0 other;
     ctctctcagc tctccgtctc tctttctctc tcagcctctt tctttctccc tgtctccccc        60
     actgtcagca cctcttctgt gtggtgagtg gaccgcttac cccactaggt gaagatgtca       120
     gcccaggaga gctgcctcag cctcatcaag tacttcctct tcgttttcaa cctcttcttc       180
     ttcgtcctcg gcagcctgat cttctgcttc ggcatctgga tcctcatcga caagaccagc       240
     ttcgtgtcct ttgtgggctt ggccttcgtg cctctgcaga tctggtccaa agtcctggcc       300
     atctcaggaa tcttcaccat gggcatcgcc ctcctgggtt gtgtgggggc cctcaaggag       360
     ctccgctgcc tcctgggcct gtattttggg atgctgctgc tcctgtttgc cacacagatc       420
     accctgggaa tcctcatctc cactcagcgg gcccagctgg agcgaagctt gcgggacgtc       480
     gtagagaaaa ccatccaaaa gtacggcacc aaccccgagg agaccgcggc cgaggagagc       540
     tgggactatg tgcagttcca gctgcgctgc tgcggctggc actacccgca gggctggttc       600
     caagtcctca tcctgagagg taacgggtcg gaggcgcacc gcgtgccctg ctcctgctac       660
     aacttgtcgg cgaccaacga ctccacaatc ctagataagg tgatcttgcc ccagctcagc       720
     aggcttggac acctggcgcg gtccagacac agtgcaggca tctgcgctgt ccctgcagag       780
     agccacatct accgcgaggg ctgcgcgcag ggcctccaga agtggctgca caacaacctt       840
     atttccatag tgggcatttg cctgggcgtc ggcctactcg aggtgatctg gccccgcccc       900
     cacccgcgat cggccctaaa tccctagatg gccctgccct tcatttcgcg tccttcagtt       960
     gcctgggaag gacgagctca gggcggagcg cagcccaccc cggccctccc gccgctccac      1020
     ccagcaccgg agggtggggg cggcccagct tcagggagcc ctgattgggt gtacgcaggg      1080
     aaagcctcct gctattggct gcgatctccc tcccctttct ccgcagatga ctgtcatggt      1140
     gctgagcgta cagctacagc gcagggcact ccgccggaaa tgcgagccgc acgtgccggg      1200
     cgctggggat tcgagccccg ggcccagcct gatcgctgac ggcggcggcg ggcacagcgg      1260
     cagtctgtgg ggtggctggg gcatggcggg tgcctgcccc aactggggag acaaggcacc      1320
     gcagggcaag ctg                                                         1333
//

If you have problems or comments...

PBIL Back to PBIL home page