(data stored in ACNUC22857 zone)

EMBL: AK304126

ID   AK304126; SV 1; linear; mRNA; STD; HUM; 2621 BP.
XX
AC   AK304126;
XX
DT   24-JUL-2008 (Rel. 96, Created)
DT   24-JUL-2008 (Rel. 96, Last updated, Version 1)
XX
DE   Homo sapiens cDNA FLJ55646 complete cds, highly similar to
DE   Adapter-relatedprotein complex 2 beta-1 subunit.
XX
KW   FLI_CDNA; oligo capping.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-2621
RA   Isogai T., Yamamoto J.;
RT   ;
RL   Submitted (09-OCT-2007) to the INSDC.
RL   Contact:Takao Isogai Reverse Proteomics Research Institute; 1-9-11
RL   Kaji-cho, Chiyoda-ku, Tokyo 101-0044, Japan E-mail :flj-cdna@nifty.com
XX
RN   [2]
RA   Wakamatsu A., Yamamoto J., Kimura K., Ishii S., Watanabe K., Sugiyama A.,
RA   Murakawa K., Kaida T., Tsuchiya K., Fukuzumi Y., Kumagai A., Oishi Y.,
RA   Yamamoto S., Ono Y., Komori Y., Yamazaki M., Kisu Y., Nishikawa T.,
RA   Sugano S., Nomura N., Isogai T.;
RT   "NEDO human cDNA sequencing project focused on splicing variants";
RL   Unpublished.
XX
DR   MD5; e2c44a8f6dcd9e6bb73b52185f60654d.
XX
CC   Human cDNA sequencing project focused on splicing variants of mRNA
CC   in NEDO functional analysis of protein and research application
CC   project supported by Ministry of Economy, Trade and Industry,
CC   Japan; cDNA selection for complete cds sequencing: Reverse
CC   Proteomics Research Institute (REPRORI), Hitachi, Ltd., Japan
CC   (Hitachi) and Japan Biological Informatics Consortium, Japan
CC   (JBIC); cDNA complete cds sequencing: JBIC; cDNA library
CC   construction: Helix Research Institute supported by Japan Key
CC   Technology Center, Japan (HRI); cDNA 5'- & 3'-end sequencing:
CC   Research Association for Biotechnology, Japan, Biotechnology
CC   Center, National Institute of Technology and Evaluation, Japan and
CC   HRI; cDNA mapping to human genome: Central Research Laboratory,
CC   Hitachi; evaluation and annotation: REPRORI.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2621
FT                   /organism="Homo sapiens"
FT                   /mol_type="mRNA"
FT                   /clone_lib="TRACH3"
FT                   /clone="TRACH3010616"
FT                   /tissue_type="trachea"
FT                   /note="cloning vector: pME18SFL3"
FT                   /db_xref="taxon:9606"
FT   CDS_pept        334..2400
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="highly similar to Adapter-relatedprotein complex 2
FT                   beta-1 subunit"
FT                   /db_xref="GOA:B4E261"
FT                   /db_xref="H-InvDB:HIT000498750.4"
FT                   /db_xref="InterPro:IPR002553"
FT                   /db_xref="InterPro:IPR008152"
FT                   /db_xref="InterPro:IPR009028"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR012295"
FT                   /db_xref="InterPro:IPR013037"
FT                   /db_xref="InterPro:IPR013041"
FT                   /db_xref="InterPro:IPR015151"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR016342"
FT                   /db_xref="InterPro:IPR026739"
FT                   /db_xref="UniProtKB/TrEMBL:B4E261"
FT                   /protein_id="BAG65023.1"
FT                   /translation="MKFLELLPKDSDYYNMLLKKLAPPLVTLLSGEPEVQYVALRNINL
FT                   IVQKRPEILKQEIKVFFVKYNDPIYVKLEKLDIMIRLASQANIAQVLAELKEYATEVDV
FT                   DFVRKAVRAIGRCAIKVEQSAERCVSTLLDLIQTKVNYVVQEAIVVIRDIFRKYPNKYE
FT                   SIIATLCENLDSLDEPDARAAMIWIVGEYAERIDNADELLESFLEGFHDESTQVQLTLL
FT                   TAIVKLFLKKPPETQELVQQVLSLATQDSDNPDLRDRGYIYWRLLSTDPVTAKEVVLSE
FT                   KPLISEETDLIEPTLLDELICHIGSLASVYHKPPNAFVEGSHGIHRKHLPIHHGSTDAG
FT                   DSPVGTTTATNLEQPQVIPSQGDLLGDLLNLDLGPPVNVPQVSSMQMGAVDLLGGGLDS
FT                   LLGSDLGGGIGGSPAVGQSFIPSSVPATFAPSPTPAVVSSGLNDLFELSTGIGMAPGGY
FT                   VAPKAVWLPAVKAKGLEISGTFTHRQGHIYMEMNFTNKALQHMTDFAIQFNKNSFGVIP
FT                   STPLAIHTPLMPNQSIDVSLPLNTLGPVMKMEPLNNLQVAVKNNIDVFYFSCLIPLNVL
FT                   FVEDGKMERQVFLATWKDIPNENELQFQIKECHLNADTVSSKLQNNNVYTIAKRNVEGQ
FT                   DMLYQSLKLTNGIWILAELRIQPGNPNYTLSLKCRAPEVSQYIYQVYDSILKN"
XX
SQ   Sequence 2621 BP; 718 A; 619 C; 606 G; 678 T; 0 other;
     attttaagtt ttcattgaag agtgagagaa actcggctta cggaccagga aaactgagag        60
     tgctgcctgg tggtggctaa tgccgtagcg gcattatctg aaatcagtga gtctcaccca       120
     aacagcaact tacttgatct gaacccacag aacattaata agctgctgac agccctgaat       180
     gaatgcactg aatggggcca gattttcatc ctggactgcc tgtctaatta caaccctaaa       240
     gatgatcggg aggctcagag catctgtgag cgggtaactc cccggctatc ccatgccaac       300
     tcagcagtgg tgctttcagc ggtaaaagtc ctaatgaagt ttctagaatt gttacctaag       360
     gattctgact actacaatat gctgctgaag aagttagccc ctccacttgt cactttgctg       420
     tctggggagc cagaagtgca gtatgtcgcc ctgaggaaca tcaacttaat tgtccagaaa       480
     aggcctgaaa tcttgaagca ggaaatcaaa gtcttctttg tgaagtacaa tgatcccatc       540
     tatgttaaac tagagaagtt ggacatcatg attcgtttgg catctcaagc caacattgct       600
     caggttctgg cagaactgaa agaatatgct acagaggtgg atgttgactt tgttcgaaaa       660
     gctgtgcggg ccattggacg gtgtgccatc aaggtggagc aatctgcaga gcgctgtgta       720
     agcacattgc ttgatctaat ccagaccaaa gtgaattatg tggtccaaga agcaattgtt       780
     gtcatcaggg acatcttccg caaatacccc aacaagtatg aaagtatcat cgccactctg       840
     tgtgagaact tagactcgct ggatgagcca gatgctcgag cagctatgat ttggattgtg       900
     ggagaatatg ctgaaagaat tgacaatgca gatgagttac tagaaagctt cctggagggt       960
     tttcacgatg aaagcaccca ggtgcagctc actctgctta ctgccatagt gaagctgttt      1020
     ctcaagaaac caccagaaac acaggagcta gtccagcagg tcttgagttt ggcaacacag      1080
     gattctgata atcctgacct tcgagaccgg ggttatattt attggcgcct tctctcaact      1140
     gaccctgtta cagctaaaga agtagtcttg tctgagaagc cactgatctc tgaggagacg      1200
     gaccttattg agccaactct gctggatgag ctaatctgcc acattggttc tttggcctct      1260
     gtgtatcata agcctcccaa tgcttttgtg gaaggaagtc atggaattca tcgtaaacac      1320
     ttgccaattc atcatgggag cactgatgca ggtgacagcc ctgttggcac taccactgca      1380
     acgaacctgg aacagcctca ggttatcccc tctcaaggtg atcttctagg ggatctttta      1440
     aaccttgacc tcggtccccc agtcaatgtg ccacaggtgt cctccatgca gatgggagca      1500
     gtggatctcc taggaggagg actagatagt ctgcttggca gtgaccttgg cgggggcatt      1560
     ggaggaagtc cggcagtggg acaatccttc atcccatcat cggtgcctgc aacctttgct      1620
     ccttcaccta cacctgctgt ggtcagcagt ggactgaatg acctgtttga actctccaca      1680
     gggataggca tggcacctgg tggatatgtg gctcctaagg ctgtctggct acctgcagta      1740
     aaggctaaag gcttggagat ttccggaaca tttactcacc gccaagggca catctatatg      1800
     gaaatgaact tcaccaataa agctctgcag cacatgacag attttgcaat ccagtttaac      1860
     aaaaatagct ttggtgtcat ccccagcact cctctggcca tccatacacc actgatgcca      1920
     aaccagagca ttgatgtctc cctgcctctc aataccttgg gcccagtcat gaagatggaa      1980
     cctctgaata acctccaggt ggctgtgaaa aacaatatcg atgtcttcta cttcagctgc      2040
     ctcatcccac tcaatgtgct ttttgtagaa gatggcaaaa tggagcgcca ggtcttcctt      2100
     gcaacatgga aggatattcc caatgaaaat gaacttcagt ttcagattaa ggaatgtcat      2160
     ttaaatgctg acactgtttc cagcaagttg caaaacaaca atgtttatac tattgccaag      2220
     aggaatgtgg aagggcagga catgctgtac caatccctga agctcactaa tggcatttgg      2280
     attttggccg aactacgtat ccagccagga aaccccaatt acacgctgtc actgaagtgt      2340
     agagctcctg aagtctctca atacatctat caggtctacg acagcatttt gaaaaactaa      2400
     caagactggt ccagtaccct tcaaccatgc tgtgatcggt gcaagtcaag aactcttaac      2460
     tggaagaaat tgtattgctg cgtagaatct gaacacactg aggccaccta gcaaggtagt      2520
     aactagtcta acctgtgcta acattagggc acaacctgtt ggatagtttt agcttcctgt      2580
     gaacatttgt aaccactgct tcagtcacct cccacttctt g                          2621
//

If you have problems or comments...

PBIL Back to PBIL home page