(data stored in ACNUC4482 zone)

EMBL: AK304155

ID   AK304155; SV 1; linear; mRNA; STD; HUM; 3478 BP.
XX
AC   AK304155;
XX
DT   24-JUL-2008 (Rel. 96, Created)
DT   24-JUL-2008 (Rel. 96, Last updated, Version 1)
XX
DE   Homo sapiens cDNA FLJ52401 complete cds, highly similar to Integrin
DE   alpha-10.
XX
KW   FLI_CDNA; oligo capping.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-3478
RA   Isogai T., Yamamoto J.;
RT   ;
RL   Submitted (09-OCT-2007) to the INSDC.
RL   Contact:Takao Isogai Reverse Proteomics Research Institute; 1-9-11
RL   Kaji-cho, Chiyoda-ku, Tokyo 101-0044, Japan E-mail :flj-cdna@nifty.com
XX
RN   [2]
RA   Wakamatsu A., Yamamoto J., Kimura K., Ishii S., Watanabe K., Sugiyama A.,
RA   Murakawa K., Kaida T., Tsuchiya K., Fukuzumi Y., Kumagai A., Oishi Y.,
RA   Yamamoto S., Ono Y., Komori Y., Yamazaki M., Kisu Y., Nishikawa T.,
RA   Sugano S., Nomura N., Isogai T.;
RT   "NEDO human cDNA sequencing project focused on splicing variants";
RL   Unpublished.
XX
DR   MD5; 0d37c6af082d9411c42c514737a7fa10.
XX
CC   Human cDNA sequencing project focused on splicing variants of mRNA
CC   in NEDO functional analysis of protein and research application
CC   project supported by Ministry of Economy, Trade and Industry,
CC   Japan; cDNA selection for complete cds sequencing: Reverse
CC   Proteomics Research Institute (REPRORI), Hitachi, Ltd., Japan
CC   (Hitachi) and Japan Biological Informatics Consortium, Japan
CC   (JBIC); cDNA complete cds sequencing: JBIC; cDNA library
CC   construction: Helix Research Institute supported by Japan Key
CC   Technology Center, Japan (HRI); cDNA 5'- & 3'-end sequencing:
CC   Research Association for Biotechnology, Japan, Biotechnology
CC   Center, National Institute of Technology and Evaluation, Japan and
CC   HRI; cDNA mapping to human genome: Central Research Laboratory,
CC   Hitachi; evaluation and annotation: REPRORI.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3478
FT                   /organism="Homo sapiens"
FT                   /mol_type="mRNA"
FT                   /clone_lib="TRACH3"
FT                   /clone="TRACH3012780"
FT                   /tissue_type="trachea"
FT                   /note="cloning vector: pME18SFL3"
FT                   /db_xref="taxon:9606"
FT   CDS_pept        108..3218
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="highly similar to Integrin alpha-10"
FT                   /db_xref="GOA:B4E282"
FT                   /db_xref="H-InvDB:HIT000498779.4"
FT                   /db_xref="InterPro:IPR000413"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR013517"
FT                   /db_xref="InterPro:IPR013519"
FT                   /db_xref="InterPro:IPR013649"
FT                   /db_xref="InterPro:IPR028994"
FT                   /db_xref="InterPro:IPR032695"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:B4E282"
FT                   /protein_id="BAG65044.1"
FT                   /translation="MNITHAYSQGHQKLNLDTVSYNMLGVDSDGCPTYMDVVIVLDGSN
FT                   SIYPWSEVQTFLRRLVGKLFIDPEQIQVGLVQYGESPVHEWSLGDFRTKEEVVRAAKNL
FT                   SRREGRETKTAQAIMVACTEGFSQSHGGRPEAARLLVVVTDGESHDGEELPAALKACEA
FT                   GRVTRYGIAVLGHYLRRQRDPSSFLREIRTIASDPDERFFFNVTDEAALTDIVDALGDR
FT                   IFGLEGSHAENESSFGLEMSQIGFSTHRLKDGILFGMVGAYDWGGSVLWLEGGHRLFPP
FT                   RMALEDEFPPALQNHAAYLGYSVSSMLLRGGRRLFLSGAPRFRHRGKVIAFQLKKDGAV
FT                   RVAQSLQGEQIGSYFGSELCPLDTDRDGTTDVLLVAAPMFLGPQNKETGRVYVYLVGQQ
FT                   SLLTLQGTLQPEPPQDARFGFAMGALPDLNQDGFADVAVGAPLEDGHQGALYLYHGTQS
FT                   GVRPHPAQRIAAASMPHALSYFGRSVDGRLDLDGDDLVDVAVGAQGAAILLSSRPIVHL
FT                   TPSLEVTPQAISVVQRDCRRRGQEAVCLTAALCFQVTSRTPGRWDHQFYMRFTASLDEW
FT                   TAGARAAFDGSGQRLSPRRLRLSVGNVTCEQLHFHVLDTSDYLRPVALTVTFALDNTTK
FT                   PGPVLNEGSPTSIQKLVPFSKDCGPDNECVTDLVLQVNMDIRGSRKAPFVVRGGRRKVL
FT                   VSTTLENRKENAYNTSLSLIFSRNLHLASLTPQRESPIKVECAAPSAHARLCSVGHPVF
FT                   QTGAKVTFLLEFEFSCSSLLSQVFVKLTASSDSLERNGTLQDNTAQTSAYIQYEPHLLF
FT                   SSESTLHRYEVHPYGTLPVGPGPEFKTTLRVQNLGCYVVSGLIISALLPAVAHGGNYFL
FT                   SLSQVITNNASCIVQNLTEPPGPPVHPEELQHTNRLNGSNTQCQVVRCHLGQLAKGTEV
FT                   SVGLLRLVHNEFFRRAKFKSLTVVSTFELGTEEGSVLQLTEASRWSESLLEVVQTRPIL
FT                   ISLWILIGSVLGGLLLLAPLVFCLWKLGFFAHKKIPEEEKREEKLEQ"
XX
SQ   Sequence 3478 BP; 779 A; 929 C; 957 G; 813 T; 0 other;
     acttctcata ctggacagaa accgatcagg catggaactc cccttcgtca ctcacctgtt        60
     cttgcccctg gtgttcctga caggtctctg ctcccccttt aacctggatg aacatcaccc       120
     acgcctattc ccagggccac cagaagctga atttggatac agtgtcttac aacatgttgg       180
     gggtggacag cgatggctgc ccaacataca tggatgttgt cattgtcttg gatggctcca       240
     acagcatcta cccctggtct gaagttcaga ccttcctacg aagactggta gggaaactgt       300
     ttattgaccc agaacagata caggtgggac tggtacagta tggggagagc cctgtacatg       360
     agtggtccct gggagatttc cgaacgaagg aagaagtggt gagagcagca aagaacctca       420
     gtcggcggga gggacgagaa acaaagactg cccaagcaat aatggtggcc tgcacagaag       480
     ggttcagtca gtcccatggg ggccgacccg aggctgccag gctactggtg gttgtcactg       540
     atggagagtc ccatgatgga gaggagcttc ctgcagcact aaaggcctgt gaggctggaa       600
     gagtgacacg ctatgggatt gcagtccttg gtcactacct ccggcggcag cgagatccca       660
     gctctttcct gagagaaatt agaactattg ccagtgatcc agatgagcga ttcttcttca       720
     atgtcacaga tgaggctgct ctgactgaca ttgtggatgc actaggagat cggatttttg       780
     gccttgaagg gtcccatgca gaaaacgaaa gctcctttgg gctggaaatg tctcagattg       840
     gtttctccac tcatcggcta aaggatggga ttctttttgg gatggtgggg gcctatgact       900
     ggggaggctc tgtgctatgg cttgaaggag gccaccgcct tttcccccca agaatggcac       960
     tggaagacga gttcccccct gcactgcaga accatgcagc ctacctgggt tactctgttt      1020
     cttccatgct tttgcggggt ggacgccgcc tgtttctctc tggggctcct cgatttagac      1080
     atcgaggaaa agtcatcgcc ttccagctta agaaagatgg ggctgtgagg gttgcccaga      1140
     gcctccaggg ggagcagatt ggttcatact ttggcagtga gctctgccca ttggatacag      1200
     atagggatgg aacaactgat gtcttacttg tggctgcccc catgttcctg ggaccccaga      1260
     acaaggaaac aggacgtgtt tatgtgtatc tggtaggcca gcagtccttg ctgaccctcc      1320
     aaggaacact tcagccagaa cccccccagg atgctcggtt tggctttgcc atgggagctc      1380
     ttcctgatct gaaccaagat ggttttgctg atgtggctgt gggggcgcct ctggaagatg      1440
     ggcaccaggg agcactgtac ctgtaccatg gaacccagag tggagtcagg ccccatcctg      1500
     cccagaggat tgctgctgcc tccatgccac atgccctcag ctactttggc cgaagtgtgg      1560
     atggtcggct agatctggat ggagatgatc tggtcgatgt ggctgtgggt gcccaggggg      1620
     cagccatcct gctcagctcc cggcccattg tccatctgac cccatcactg gaggtgaccc      1680
     cacaggccat cagtgtggtt cagagggact gtaggcggcg aggccaagag gcagtctgtc      1740
     tgactgcagc cctttgcttc caagtgacct cccgtactcc tggtcgctgg gatcaccaat      1800
     tctacatgag gttcaccgca tcactggatg aatggactgc tggggcacgt gcagcatttg      1860
     atggctctgg ccagaggttg tcccctcgga ggctccggct cagtgtgggg aatgtcactt      1920
     gtgagcagct acacttccat gtgctggata catcagatta cctccggcca gtggccttga      1980
     ctgtgacctt tgccttggac aatactacaa agccagggcc tgtgctgaat gagggctcac      2040
     ccacctctat acaaaagctg gtccccttct caaaggattg tggccctgac aatgaatgtg      2100
     tcacagacct ggtgcttcaa gtgaatatgg acatcagagg ctccaggaag gccccatttg      2160
     tggttcgagg tggccggcgg aaagtgctgg tatctacaac tctggagaac agaaaggaaa      2220
     atgcttacaa tacgagcctg agtctcatct tctctagaaa cctccacctg gccagtctca      2280
     ctcctcagag agagagccca ataaaggtgg aatgtgccgc cccttctgct catgcccggc      2340
     tctgcagtgt ggggcatcct gtcttccaga ctggagccaa ggtgaccttt ctgctagagt      2400
     ttgagtttag ctgctcctct ctcctgagcc aggtcttcgt gaagctgact gccagcagtg      2460
     acagcctgga gagaaatggg acccttcaag ataacacagc ccagacctca gcctacatcc      2520
     aatatgagcc ccacctcctg ttctctagtg agtctaccct gcaccgctat gaggttcacc      2580
     catatgggac cctcccagtg ggtcctggcc cagaattcaa aaccactctc agggttcaga      2640
     acctaggctg ctatgtggtc agtggcctca tcatctcagc cctccttcca gctgtggccc      2700
     atgggggcaa ttacttccta tcactgtctc aagtcatcac taacaatgca agctgcatag      2760
     tgcagaacct gactgaaccc ccaggcccac ctgtgcatcc agaggagctt caacacacaa      2820
     acagactgaa tgggagcaat actcagtgtc aggtggtgag gtgccacctt gggcagctgg      2880
     caaaggggac tgaggtctct gttggactat tgaggctggt tcacaatgaa tttttccgaa      2940
     gagccaagtt caagtccctg acggtggtca gcacctttga gctgggaacc gaagagggca      3000
     gtgtcctaca gctgactgaa gcctcccgtt ggagtgagag cctcttggag gtggttcaga      3060
     cccggcctat cctcatctcc ctgtggatcc tcataggcag tgtcctggga gggttgctcc      3120
     tgcttgctcc ccttgtcttc tgcctgtgga agcttggctt ctttgcccat aagaaaatcc      3180
     ctgaggaaga aaaaagagaa gagaagttgg agcaatgaat gtagaataag ggtctagaaa      3240
     gtcctccctg gcagcttctt caagagactt gcataaaagc agaggtttgg gggctcagat      3300
     gggacaagaa gccgcctctg gactatctcc ccagaccagc agcctgactt gacttttgag      3360
     tcctagggat gctgctggct agagatgagg cttacctcag acaagaagag ctggcaccaa      3420
     aactagccat gctcccaccc tctgcttccc tcctcctcgt gatcctggtt ccatagcc        3478
//

If you have problems or comments...

PBIL Back to PBIL home page