(data stored in ACNUC10243 zone)

EMBL: AK304687

ID   AK304687; SV 1; linear; mRNA; STD; HUM; 1435 BP.
XX
AC   AK304687;
XX
DT   24-JUL-2008 (Rel. 96, Created)
DT   24-JUL-2008 (Rel. 96, Last updated, Version 1)
XX
DE   Homo sapiens cDNA FLJ58832 complete cds, highly similar to Heterogeneous
DE   nuclear ribonucleoprotein A3.
XX
KW   FLI_CDNA; oligo capping.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1435
RA   Isogai T., Yamamoto J.;
RT   ;
RL   Submitted (09-OCT-2007) to the INSDC.
RL   Contact:Takao Isogai Reverse Proteomics Research Institute; 1-9-11
RL   Kaji-cho, Chiyoda-ku, Tokyo 101-0044, Japan E-mail :flj-cdna@nifty.com
XX
RN   [2]
RA   Wakamatsu A., Yamamoto J., Kimura K., Ishii S., Watanabe K., Sugiyama A.,
RA   Murakawa K., Kaida T., Tsuchiya K., Fukuzumi Y., Kumagai A., Oishi Y.,
RA   Yamamoto S., Ono Y., Komori Y., Yamazaki M., Kisu Y., Nishikawa T.,
RA   Sugano S., Nomura N., Isogai T.;
RT   "NEDO human cDNA sequencing project focused on splicing variants";
RL   Unpublished.
XX
DR   MD5; f9204cff992530922832a5de199cb884.
XX
CC   Human cDNA sequencing project focused on splicing variants of mRNA
CC   in NEDO functional analysis of protein and research application
CC   project supported by Ministry of Economy, Trade and Industry,
CC   Japan; cDNA selection for complete cds sequencing: Reverse
CC   Proteomics Research Institute (REPRORI), Hitachi, Ltd., Japan
CC   (Hitachi) and Japan Biological Informatics Consortium, Japan
CC   (JBIC); cDNA complete cds sequencing: JBIC; cDNA library
CC   construction: Helix Research Institute supported by Japan Key
CC   Technology Center, Japan (HRI); cDNA 5'- & 3'-end sequencing:
CC   Research Association for Biotechnology, Japan, Biotechnology
CC   Center, National Institute of Technology and Evaluation, Japan and
CC   HRI; cDNA mapping to human genome: Central Research Laboratory,
CC   Hitachi; evaluation and annotation: REPRORI.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1435
FT                   /organism="Homo sapiens"
FT                   /mol_type="mRNA"
FT                   /clone_lib="UTERU2"
FT                   /clone="UTERU2037864"
FT                   /tissue_type="uterus"
FT                   /note="cloning vector: pME18SFL3"
FT                   /db_xref="taxon:9606"
FT   CDS_pept        36..1007
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="highly similar to Heterogeneous nuclear
FT                   ribonucleoprotein A3"
FT                   /db_xref="GOA:B4E3E6"
FT                   /db_xref="H-InvDB:HIT000499311.4"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR021662"
FT                   /db_xref="InterPro:IPR034513"
FT                   /db_xref="InterPro:IPR034516"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="UniProtKB/TrEMBL:B4E3E6"
FT                   /protein_id="BAG65458.1"
FT                   /translation="MEGHDPKEPEQLRKLFIGGLSFETTDDSLREHFEKWGTLTDCVVM
FT                   RDPQTKRSRGFGFATYSCVEEVDAAMCARPHKVDGRVVEPKRAVSREDSVKPGAHLTVK
FT                   KIFVGGIKEDTEEYNLRDYFEKYGKIETIEVMEDRQSGKKRGFAFVTFDDHDTVDKIVV
FT                   QKYHTINGHNCEVKKALSKQEMQSAGSQRGRGGGSGNFMGRGGNFGGGGGNFGRDGGNY
FT                   GGGPGYSSRGGYGGGGPGYGNQGGGYGGGGGYDGYNEGGNFGGGNYGGGGNYNDFGNYS
FT                   GQQQSNYGPMKGGSFGGRSSGSPYGGGYGSGGGSGGYGSRRF"
XX
SQ   Sequence 1435 BP; 428 A; 196 C; 409 G; 402 T; 0 other;
     gaactcgagt tggaagaggc gagtccggtc tcaaaatgga gggccatgat ccaaaggaac        60
     cagagcagtt gagaaaactg tttattggtg gtctgagctt tgaaactaca gatgatagtt       120
     tacgagaaca ttttgagaaa tggggcacac tcacagattg tgtggtaatg agagaccccc       180
     aaacaaaacg ttccaggggc tttggttttg cgacttattc ttgtgttgaa gaggtggatg       240
     cagcaatgtg tgctcgacca cacaaggttg atgggcgtgt agtggaacca aagagagctg       300
     tttctagaga ggattctgta aagcctggtg cccatctaac agtgaagaaa atttttgttg       360
     gtggtattaa agaagataca gaagaatata atttgagaga ctactttgaa aagtatggca       420
     agattgaaac catagaagtt atggaagaca ggcagagtgg aaaaaagaga ggatttgctt       480
     ttgtaacttt tgatgatcat gatacagttg ataaaattgt tgttcagaaa taccacacta       540
     ttaatgggca taattgtgaa gtgaaaaagg ccctttctaa acaagagatg cagtctgctg       600
     gatcacagag aggtcgtgga ggtggatctg gcaattttat gggtcgcgga gggaactttg       660
     gaggtggtgg aggtaatttt ggccgtgatg gtggcaacta tggcggtggt cctggttata       720
     gtagtagagg gggctatggt ggtggtggac caggatatgg aaaccaaggt ggtggatatg       780
     gtggaggtgg aggatatgat ggttacaatg aaggaggaaa ttttggcggt ggtaactatg       840
     gtggtggtgg gaactataat gattttggaa attatagtgg acaacagcaa tcaaattatg       900
     gacccatgaa agggggcagt tttggtggaa gaagctcggg cagtccctat ggtggtggtt       960
     atggatctgg tggtggaagt ggtggatatg gtagcagaag gttctaaaaa cagcagaaaa      1020
     gggctacagt tcttagcagg agagagagcg aggagttgtc aggaaagctg caggttactt      1080
     tgagacagtc gtcccaaatg cattagagga actgtaaaaa tctgccacag aaggaacgat      1140
     gatccatagt cagaaaagtt actgcagctt aaacaggaaa cccttcttgt tcaggactgt      1200
     catagccaca gtttgcaaaa agtgcagcta ttgattaatg caatgtagtg tcaattagat      1260
     gtacattcct gaggtctttt atctgttgta gctttgtctt tttctttttc ttttcattac      1320
     atcaggtata ttgccctgta aattgtggta gtggtaccag gaataaaaaa ttaaggaatt      1380
     tttaactttt caatatttgt gtagttcagt ttttctacat tttagtacag aaact           1435
//

If you have problems or comments...

PBIL Back to PBIL home page