(data stored in ACNUC26070 zone)

EMBL: AK311876

ID   AK311876; SV 1; linear; mRNA; HTC; HUM; 551 BP.
XX
AC   AK311876;
XX
DT   12-JAN-2008 (Rel. 94, Created)
DT   24-MAY-2008 (Rel. 95, Last updated, Version 2)
XX
DE   Homo sapiens cDNA, FLJ92142, Homo sapiens potassium voltage-gated channel,
DE   Isk-related family,member 3 (KCNE3), mRNA.
XX
KW   HTC; HTC_FLI; oligo capping.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-551
RA   Isogai T., Yamamoto J.;
RT   ;
RL   Submitted (11-JAN-2008) to the INSDC.
RL   Contact:Takao Isogai Reverse Proteomics Research Institute; 1-9-11
RL   Kaji-cho, Chiyoda-ku, Tokyo 101-0044, Japan E-mail :flj-cdna@nifty.com
XX
RN   [2]
RA   Wakamatsu A., Yamamoto J., Kimura K., Kaida T., Tsuchiya K., Iida Y.,
RA   Takayama Y., Murakawa K., Kanehori K., Andoh T., Kagawa N., Sato R.,
RA   Kawamura Y., Tanaka S., Kisu Y., Sugano S., Goshima N., Nomura N.,
RA   Isogai T.;
RT   "NEDO functional analysis of protein and research application project";
RL   Unpublished.
XX
DR   MD5; ad11e45651bea5cb72fe9d92a7c56654.
DR   Ensembl-Gn; ENSG00000175538; homo_sapiens.
DR   Ensembl-Tr; ENST00000310128; homo_sapiens.
DR   Ensembl-Tr; ENST00000525550; homo_sapiens.
XX
CC   Human cDNA sequencing project focused on splicing variants of mRNA
CC   in NEDO functional analysis of protein and research application
CC   project supported by Ministry of Economy, Trade and Industry,
CC   Japan; cDNA selection for complete cds sequencing: Reverse
CC   Proteomics Research Institute (REPRORI), Hitachi, Ltd., Japan
CC   (Hitachi) and Japan Biological Informatics Consortium, Japan
CC   (JBIC); cDNA complete cds sequencing: JBIC and Biological
CC   Information Research Center (BIRC), AIST; cDNA library
CC   construction: Helix Research Institute supported by Japan Key
CC   Technology Center, Japan (HRI); cDNA 5'- & 3'-end sequencing:
CC   Research Association for Biotechnology, Japan, Biotechnology
CC   Center, National Institute of Technology and Evaluation, Japan and
CC   HRI; cDNA mapping to human genome: Central Research Laboratory,
CC   Hitachi; evaluation and annotation: REPRORI.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..551
FT                   /organism="Homo sapiens"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NETRP2"
FT                   /clone="NETRP2000331"
FT                   /cell_type="neutrophils"
FT                   /note="cloning vector: pME18SFL3"
FT                   /note="primary culture, neutrophils"
FT                   /db_xref="taxon:9606"
FT   CDS_pept        240..551
FT                   /note="Homo sapiens potassium voltage-gated channel,
FT                   Isk-related family,member 3 (KCNE3), mRNA"
FT                   /db_xref="GOA:Q6IAE6"
FT                   /db_xref="H-InvDB:HIT000430742.6"
FT                   /db_xref="InterPro:IPR000369"
FT                   /db_xref="InterPro:IPR005426"
FT                   /db_xref="UniProtKB/TrEMBL:Q6IAE6"
FT                   /protein_id="BAG34817.1"
FT                   /translation="METTNGTETWYESLHAVLKALNATLHSNLLCRPGPGLGPDNQTEE
FT                   RRASLPGRDDNSYMYILFVMFLFAVTVGSLILGYTRSRKVDKRSDPYHVYIKNRVSMI"
XX
SQ   Sequence 551 BP; 117 A; 153 C; 140 G; 141 T; 0 other;
     gtgctttgtg tctggttcct tccttttctg ccttctctcc tgctttctag ctctgggctt        60
     tcccagctcc gaagtcaata ctgagatccc agatgtgtcc agagacatcc tgaagaggct       120
     cgggggtgga ggagccttag tgtgtccaca aagggactcc tgaaactgac tgagagccag       180
     tggatttgcc agcagtctga gcttctaccg agtcttcccc cacctcaatc cctgttgcta       240
     tggagactac caatggaacg gagacctggt atgagagcct gcatgccgtg ctgaaggctc       300
     taaatgccac tcttcacagc aatttgctct gccggccagg gccagggctg gggccagaca       360
     accagactga agagaggcgg gccagcctac ctggccgtga tgacaactcc tacatgtaca       420
     ttctctttgt catgtttcta tttgctgtaa ctgtgggcag cctcatcctg ggatacaccc       480
     gctcccgcaa agtggacaag cgtagtgacc cctatcatgt gtatatcaag aaccgtgtgt       540
     ctatgatcta a                                                            551
//

If you have problems or comments...

PBIL Back to PBIL home page