(data stored in ACNUC31108 zone)

EMBL: AK311893

ID   AK311893; SV 1; linear; mRNA; HTC; HUM; 785 BP.
XX
AC   AK311893;
XX
DT   12-JAN-2008 (Rel. 94, Created)
DT   24-MAY-2008 (Rel. 95, Last updated, Version 2)
XX
DE   Homo sapiens cDNA, FLJ92159, Homo sapiens CD63 antigen (melanoma 1 antigen)
DE   (CD63), mRNA.
XX
KW   HTC; HTC_FLI; oligo capping.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-785
RA   Isogai T., Yamamoto J.;
RT   ;
RL   Submitted (11-JAN-2008) to the INSDC.
RL   Contact:Takao Isogai Reverse Proteomics Research Institute; 1-9-11
RL   Kaji-cho, Chiyoda-ku, Tokyo 101-0044, Japan E-mail :flj-cdna@nifty.com
XX
RN   [2]
RA   Wakamatsu A., Yamamoto J., Kimura K., Kaida T., Tsuchiya K., Iida Y.,
RA   Takayama Y., Murakawa K., Kanehori K., Andoh T., Kagawa N., Sato R.,
RA   Kawamura Y., Tanaka S., Kisu Y., Sugano S., Goshima N., Nomura N.,
RA   Isogai T.;
RT   "NEDO functional analysis of protein and research application project";
RL   Unpublished.
XX
DR   MD5; 69e4847903304e624c638226bc51aa9e.
DR   Ensembl-Gn; ENSG00000135404; homo_sapiens.
DR   Ensembl-Tr; ENST00000257857; homo_sapiens.
DR   Ensembl-Tr; ENST00000420846; homo_sapiens.
DR   Ensembl-Tr; ENST00000546939; homo_sapiens.
DR   Ensembl-Tr; ENST00000549117; homo_sapiens.
DR   Ensembl-Tr; ENST00000550776; homo_sapiens.
DR   Ensembl-Tr; ENST00000552692; homo_sapiens.
DR   Ensembl-Tr; ENST00000552754; homo_sapiens.
XX
CC   Human cDNA sequencing project focused on splicing variants of mRNA
CC   in NEDO functional analysis of protein and research application
CC   project supported by Ministry of Economy, Trade and Industry,
CC   Japan; cDNA selection for complete cds sequencing: Reverse
CC   Proteomics Research Institute (REPRORI), Hitachi, Ltd., Japan
CC   (Hitachi) and Japan Biological Informatics Consortium, Japan
CC   (JBIC); cDNA complete cds sequencing: JBIC and Biological
CC   Information Research Center (BIRC), AIST; cDNA library
CC   construction: Helix Research Institute supported by Japan Key
CC   Technology Center, Japan (HRI); cDNA 5'- & 3'-end sequencing:
CC   Research Association for Biotechnology, Japan, Biotechnology
CC   Center, National Institute of Technology and Evaluation, Japan and
CC   HRI; cDNA mapping to human genome: Central Research Laboratory,
CC   Hitachi; evaluation and annotation: REPRORI.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..785
FT                   /organism="Homo sapiens"
FT                   /mol_type="mRNA"
FT                   /clone_lib="SKMUS2"
FT                   /clone="SKMUS2006894"
FT                   /tissue_type="skeletal muscle"
FT                   /note="cloning vector: pME18SFL3"
FT                   /db_xref="taxon:9606"
FT   CDS_pept        69..785
FT                   /note="Homo sapiens CD63 antigen (melanoma 1 antigen)
FT                   (CD63), mRNA"
FT                   /db_xref="GOA:P08962"
FT                   /db_xref="H-InvDB:HIT000430759.6"
FT                   /db_xref="HGNC:HGNC:1692"
FT                   /db_xref="InterPro:IPR000301"
FT                   /db_xref="InterPro:IPR008952"
FT                   /db_xref="InterPro:IPR018499"
FT                   /db_xref="InterPro:IPR018503"
FT                   /db_xref="InterPro:IPR042028"
FT                   /db_xref="UniProtKB/Swiss-Prot:P08962"
FT                   /protein_id="BAG34834.1"
FT                   /translation="MAVEGGMKCVKFLLYVLLLAFCACAVGLIAVGVGAQLVLSQTIIQ
FT                   GATPGSLLPVVIIAVGVFLFLVAFVGCCGACKENYCLMITFAIFLSLIMLVEVAAAIAG
FT                   YVFRDKVMSEFNNNFRQQMENYPKNNHTASILDRMQADFKCCGAANYTDWEKIPSMSKN
FT                   RVPDSCCINVTVGCGINFNEKAIHKEGCVEKIGGWLRKNVLVVAAAALGIAFVEVLGIV
FT                   FACCLVKSIRSGYEVM"
XX
SQ   Sequence 785 BP; 162 A; 173 C; 249 G; 201 T; 0 other;
     agagagcccc ggagccgcgg cgggagagga acgcgcagcc agccttggga agcccaggcc        60
     cggcagccat ggcggtggaa ggaggaatga aatgtgtgaa gttcttgctc tacgtcctcc       120
     tgctggcctt ttgcgcctgt gcagtgggac tgattgccgt gggtgtcggg gcacagcttg       180
     tcctgagtca gaccataatc cagggggcta cccctggctc tctgttgcca gtggtcatca       240
     tcgcagtggg tgtcttcctc ttcctggtgg cttttgtggg ctgctgcggg gcctgcaagg       300
     agaactattg tcttatgatc acgtttgcca tctttctgtc tcttatcatg ttggtggagg       360
     tggccgcagc cattgctggc tatgtgttta gagataaggt gatgtcagag tttaataaca       420
     acttccggca gcagatggag aattacccga aaaacaacca cactgcttcg atcctggaca       480
     ggatgcaggc agattttaag tgctgtgggg ctgctaacta cacagattgg gagaaaatcc       540
     cttccatgtc gaagaaccga gtccccgact cctgctgcat taatgttact gtgggctgtg       600
     ggattaattt caacgagaag gcgatccata aggagggctg tgtggagaag attgggggct       660
     ggctgaggaa aaatgtgctg gtggtagctg cagcagccct tggaattgct tttgtcgagg       720
     ttttgggaat tgtctttgcc tgctgcctcg tgaagagtat cagaagtggc tacgaggtga       780
     tgtag                                                                   785
//

If you have problems or comments...

PBIL Back to PBIL home page