(data stored in ACNUC8465 zone)

EMBL: AK312487

ID   AK312487; SV 1; linear; mRNA; HTC; HUM; 986 BP.
XX
AC   AK312487;
XX
DT   12-JAN-2008 (Rel. 94, Created)
DT   24-MAY-2008 (Rel. 95, Last updated, Version 2)
XX
DE   Homo sapiens cDNA, FLJ92847, Homo sapiens ras homolog gene family, member B
DE   (ARHB), mRNA.
XX
KW   HTC; HTC_FLI; oligo capping.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-986
RA   Isogai T., Yamamoto J.;
RT   ;
RL   Submitted (11-JAN-2008) to the INSDC.
RL   Contact:Takao Isogai Reverse Proteomics Research Institute; 1-9-11
RL   Kaji-cho, Chiyoda-ku, Tokyo 101-0044, Japan E-mail :flj-cdna@nifty.com
XX
RN   [2]
RA   Wakamatsu A., Yamamoto J., Kimura K., Kaida T., Tsuchiya K., Iida Y.,
RA   Takayama Y., Murakawa K., Kanehori K., Andoh T., Kagawa N., Sato R.,
RA   Kawamura Y., Tanaka S., Kisu Y., Sugano S., Goshima N., Nomura N.,
RA   Isogai T.;
RT   "NEDO functional analysis of protein and research application project";
RL   Unpublished.
XX
DR   MD5; cb47d81523eaf45fb63f53548c34cc42.
DR   Ensembl-Gn; ENSG00000143878; homo_sapiens.
DR   Ensembl-Tr; ENST00000272233; homo_sapiens.
XX
CC   Human cDNA sequencing project focused on splicing variants of mRNA
CC   in NEDO functional analysis of protein and research application
CC   project supported by Ministry of Economy, Trade and Industry,
CC   Japan; cDNA selection for complete cds sequencing: Reverse
CC   Proteomics Research Institute (REPRORI), Hitachi, Ltd., Japan
CC   (Hitachi) and Japan Biological Informatics Consortium, Japan
CC   (JBIC); cDNA complete cds sequencing: JBIC and Biological
CC   Information Research Center (BIRC), AIST; cDNA library
CC   construction: Helix Research Institute supported by Japan Key
CC   Technology Center, Japan (HRI); cDNA 5'- & 3'-end sequencing:
CC   Research Association for Biotechnology, Japan, Biotechnology
CC   Center, National Institute of Technology and Evaluation, Japan and
CC   HRI; cDNA mapping to human genome: Central Research Laboratory,
CC   Hitachi; evaluation and annotation: REPRORI.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..986
FT                   /organism="Homo sapiens"
FT                   /mol_type="mRNA"
FT                   /clone_lib="BRHIP3"
FT                   /clone="BRHIP3039414"
FT                   /tissue_type="hippocampus"
FT                   /note="cloning vector: pME18SFL3"
FT                   /db_xref="taxon:9606"
FT   CDS_pept        396..986
FT                   /note="Homo sapiens ras homolog gene family, member B
FT                   (ARHB), mRNA"
FT                   /db_xref="GOA:P62745"
FT                   /db_xref="H-InvDB:HIT000431353.6"
FT                   /db_xref="HGNC:HGNC:668"
FT                   /db_xref="InterPro:IPR001806"
FT                   /db_xref="InterPro:IPR003578"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="PDB:2FV8"
FT                   /db_xref="UniProtKB/Swiss-Prot:P62745"
FT                   /protein_id="BAG35389.1"
FT                   /translation="MAAIRKKLVVVGDGACGKTCLLIVFSKDEFPEVYVPTVFENYVAD
FT                   IEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSVDSPDSLENIPEKWVPEVK
FT                   HFCPNVPIILVANKKDLRSDEHVRTELARMKQEPVRTDDGRAMAVRIQAYDYLECSAKT
FT                   KEGVREVFETATRAALQKRYGSQNGCINCCKVL"
XX
SQ   Sequence 986 BP; 179 A; 336 C; 334 G; 137 T; 0 other;
     atcatctgcc accgcagtct ggttggagct gttgtcttgt atgctcagcg aggcccggag        60
     agacccggga gagagctagg ccgagtccac cgcccgagtc tgctgcccga gcccgcgtta       120
     cgcacaaagc cgccgatccc cggcctgggg tgagcagagc gaccaccgcc cgggagcagc       180
     gcggcgagac gcacggtgcg ccctatgccc ccgcgccccc accgcccccg ccgcggcagc       240
     cgaagcgcag cgagagaacg cgccaccgcg gggcccgggt gcagctagcg accctctcgc       300
     cacctgcgcg cagcccgagg tgagcagtga gcggcgagcg ggagggcagc gaggcgttcg       360
     cgggccccct cctgctgccc gggcccggcc cgctcatggc ggccatccgc aagaagctgg       420
     tggtggtggg cgacggcgcg tgtggcaaga cgtgcctgct gatcgtgttc agtaaggacg       480
     agttccccga ggtgtacgtg cccaccgtct tcgagaacta tgtggccgac attgaggtgg       540
     acggcaagca ggtggagctg gcgctgtggg acacggcggg ccaggaggac tacgaccgcc       600
     tgcggccgct ctcctacccg gacaccgacg tcattctcat gtgcttctcg gtggacagcc       660
     cggactcgct ggagaacatc cccgagaagt gggtccccga ggtgaagcac ttctgtccca       720
     atgtgcccat catcctggtg gccaacaaaa aagacctgcg cagcgacgag catgtccgca       780
     cagagctggc ccgcatgaag caggaacccg tgcgcacgga tgacggccgc gccatggccg       840
     tgcgcatcca agcctacgac tacctcgagt gctctgccaa gaccaaggaa ggcgtgcgcg       900
     aggtcttcga gacggccacg cgcgccgcgc tgcagaagcg ctacggctcc cagaacggct       960
     gcatcaactg ctgcaaggtg ctatga                                            986
//

If you have problems or comments...

PBIL Back to PBIL home page