(data stored in ACNUC27125 zone)

EMBL: AK312570

ID   AK312570; SV 1; linear; mRNA; HTC; HUM; 1887 BP.
XX
AC   AK312570;
XX
DT   12-JAN-2008 (Rel. 94, Created)
DT   24-MAY-2008 (Rel. 95, Last updated, Version 2)
XX
DE   Homo sapiens cDNA, FLJ92945, Homo sapiens adenovirus 5 E1A binding protein
DE   (BS69), mRNA.
XX
KW   HTC; HTC_FLI; oligo capping.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1887
RA   Isogai T., Yamamoto J.;
RT   ;
RL   Submitted (11-JAN-2008) to the INSDC.
RL   Contact:Takao Isogai Reverse Proteomics Research Institute; 1-9-11
RL   Kaji-cho, Chiyoda-ku, Tokyo 101-0044, Japan E-mail :flj-cdna@nifty.com
XX
RN   [2]
RA   Wakamatsu A., Yamamoto J., Kimura K., Kaida T., Tsuchiya K., Iida Y.,
RA   Takayama Y., Murakawa K., Kanehori K., Andoh T., Kagawa N., Sato R.,
RA   Kawamura Y., Tanaka S., Kisu Y., Sugano S., Goshima N., Nomura N.,
RA   Isogai T.;
RT   "NEDO functional analysis of protein and research application project";
RL   Unpublished.
XX
DR   MD5; d7bbf7cde5237abcb15fab55eddab988.
DR   Ensembl-Gn; ENSG00000015171; homo_sapiens.
DR   Ensembl-Tr; ENST00000381591; homo_sapiens.
DR   Ensembl-Tr; ENST00000381607; homo_sapiens.
DR   Ensembl-Tr; ENST00000397959; homo_sapiens.
DR   Ensembl-Tr; ENST00000397962; homo_sapiens.
DR   Ensembl-Tr; ENST00000509513; homo_sapiens.
DR   Ensembl-Tr; ENST00000558098; homo_sapiens.
DR   Ensembl-Tr; ENST00000602682; homo_sapiens.
XX
CC   Human cDNA sequencing project focused on splicing variants of mRNA
CC   in NEDO functional analysis of protein and research application
CC   project supported by Ministry of Economy, Trade and Industry,
CC   Japan; cDNA selection for complete cds sequencing: Reverse
CC   Proteomics Research Institute (REPRORI), Hitachi, Ltd., Japan
CC   (Hitachi) and Japan Biological Informatics Consortium, Japan
CC   (JBIC); cDNA complete cds sequencing: JBIC and Biological
CC   Information Research Center (BIRC), AIST; cDNA library
CC   construction: Helix Research Institute supported by Japan Key
CC   Technology Center, Japan (HRI); cDNA 5'- & 3'-end sequencing:
CC   Research Association for Biotechnology, Japan, Biotechnology
CC   Center, National Institute of Technology and Evaluation, Japan and
CC   HRI; cDNA mapping to human genome: Central Research Laboratory,
CC   Hitachi; evaluation and annotation: REPRORI.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1887
FT                   /organism="Homo sapiens"
FT                   /mol_type="mRNA"
FT                   /dev_stage="fetal"
FT                   /clone_lib="FCBBF3"
FT                   /clone="FCBBF3001516"
FT                   /tissue_type="brain"
FT                   /note="cloning vector: pME18SFL3"
FT                   /db_xref="taxon:9606"
FT   CDS_pept        199..1887
FT                   /note="Homo sapiens adenovirus 5 E1A binding protein
FT                   (BS69), mRNA"
FT                   /db_xref="GOA:Q15326"
FT                   /db_xref="H-InvDB:HIT000431436.6"
FT                   /db_xref="HGNC:HGNC:16966"
FT                   /db_xref="InterPro:IPR000313"
FT                   /db_xref="InterPro:IPR001487"
FT                   /db_xref="InterPro:IPR001965"
FT                   /db_xref="InterPro:IPR002893"
FT                   /db_xref="InterPro:IPR011011"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR019786"
FT                   /db_xref="InterPro:IPR019787"
FT                   /db_xref="InterPro:IPR035505"
FT                   /db_xref="InterPro:IPR036427"
FT                   /db_xref="PDB:4NS5"
FT                   /db_xref="PDB:5HDA"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q15326"
FT                   /protein_id="BAG35465.1"
FT                   /translation="MSRVHGMHPKETTRQLSLAVKDGLIVETLTVGCKGSKAGIEQEGY
FT                   WLPGDEIDWETENHDWYCFECHLPGEVLICDLCFRVYHSKCLSDEFRLRDSSSPWQCPV
FT                   CRSIKKKNTNKQEMGTYLRFIVSRMKERAIDLNKKGKDNKHPMYRRLVHSAVDVPTIQE
FT                   KVNEGKYRSYEEFKADAQLLLHNTVIFYGADSEQADIARMLYKDTCHELDELQLCKNCF
FT                   YLSNARPDNWFCYPCIPNHELVWAKMKGFGFWPAKVMQKEDNQVDVRFFGHHHQRAWIP
FT                   SENIQDITVNIHRLHVKRSMGWKKACDELELHQRFLREGRFWKSKNEDRGEEEAESSIS
FT                   STSNEQLKVTQEPRAKKGRRNQSVEPKKEEPEPETEAVSSSQEIPTMPQPIEKVSVSTQ
FT                   TKKLSASSPRMLHRSTQTTNDGVCQSMCHDKYTKIFNDFKDRMKSDHKRETERVVREAL
FT                   EKLRSEMEEEKRQAVNKAVANMQGEMDRKCKQVKEKCKEEFVEEIKKLATQHKQLISQT
FT                   KKKQWCYNCEEEAMYHCCWNTSYCSIKCQQEHWHAEHKRTCRRKR"
XX
SQ   Sequence 1887 BP; 600 A; 409 C; 487 G; 391 T; 0 other;
     gacaatgccc cctcgcgccc cggcctcggc gcccgctccc ggctccagcg cgcctgcacc        60
     taaagaagta aacaggtcat ggcacgttta acaaaaagac gacaggcgga tacaaaagct       120
     atccagcatc tttgggcagc cattgagatt atacggaacc agaagcagat tgccaacatt       180
     gaccgtatta caaagtatat gtctcgagtc cacggtatgc accctaaaga gaccacccgt       240
     cagctgagct tagctgtgaa agatggtctt attgtcgaaa ctctaacagt gggctgcaaa       300
     ggttcaaaag ctggtattga acaagaagga tattggttgc caggagatga gattgactgg       360
     gaaacagaaa atcatgactg gtattgtttt gaatgccatt tgcctggaga ggtgttgata       420
     tgtgacctgt gttttcgtgt gtatcattcc aagtgtttgt ctgatgagtt caggcttaga       480
     gacagcagta gtccctggca gtgcccagtt tgcaggagca ttaagaagaa gaatacaaac       540
     aaacaggaga tgggcacata cctcagattc attgtctccc gcatgaagga gagggctata       600
     gatcttaata aaaaggggaa ggacaataaa cacccgatgt acaggaggct ggtgcactca       660
     gctgtggacg ttcccaccat tcaagagaaa gtgaatgaag ggaaataccg aagttatgaa       720
     gagttcaaag ctgatgccca attgcttctc cacaataccg tgattttcta tggagcagac       780
     agtgagcaag ctgacattgc gaggatgcta tataaagaca catgtcatga gctggatgaa       840
     ctgcagcttt gcaagaattg cttttacttg tcaaatgctc gtcctgacaa ctggttctgt       900
     tatccttgta tacctaatca tgagctggtt tgggctaaaa tgaaaggttt tgggttttgg       960
     ccagccaaag tcatgcagaa agaagacaat caagtcgacg ttcgcttctt tggccaccac      1020
     caccagaggg cctggattcc ttctgaaaac attcaagata tcacagtcaa cattcatcgg      1080
     ctgcacgtga agcgcagtat gggttggaaa aaggcctgtg atgagctgga gctgcatcag      1140
     cgtttcctac gagaagggag attttggaaa tctaagaatg aggaccgagg tgaggaagag      1200
     gcagaatcca gtatctcctc caccagtaat gagcagctaa aggtcactca agaaccaaga      1260
     gcaaagaaag gacgacgtaa tcaaagtgtg gagcccaaaa aggaagaacc agagcctgaa      1320
     acagaagcag taagttctag ccaggaaata cccacgatgc ctcagcccat cgaaaaagtc      1380
     tccgtgtcaa ctcagacaaa gaagttaagt gcctcttcac caagaatgct gcatcggagc      1440
     acccagacca caaacgacgg cgtgtgtcag agcatgtgcc atgacaaata caccaagatc      1500
     ttcaatgact tcaaagaccg gatgaagtcg gaccacaagc gggagacaga gcgtgttgtc      1560
     cgagaagctc tggagaagct gcgttctgaa atggaagaag aaaagagaca agctgtaaat      1620
     aaagctgtag ccaacatgca gggtgagatg gacagaaaat gtaagcaagt aaaggaaaag      1680
     tgtaaggagg aatttgtaga agaaatcaag aagctggcaa cacagcacaa gcaactgatt      1740
     tctcagacca agaagaagca gtggtgctac aactgtgagg aggaggccat gtaccactgc      1800
     tgctggaaca catcctactg ctccatcaag tgccagcagg agcactggca cgcggagcac      1860
     aagcgcacct gccgccggaa aagatga                                          1887
//

If you have problems or comments...

PBIL Back to PBIL home page