(data stored in ACNUC9306 zone)

EMBL: AK312903

ID   AK312903; SV 1; linear; mRNA; HTC; HUM; 1964 BP.
XX
AC   AK312903;
XX
DT   12-JAN-2008 (Rel. 94, Created)
DT   24-MAY-2008 (Rel. 95, Last updated, Version 2)
XX
DE   Homo sapiens cDNA, FLJ93349, Homo sapiens radixin (RDX), mRNA.
XX
KW   HTC; HTC_FLI; oligo capping.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1964
RA   Isogai T., Yamamoto J.;
RT   ;
RL   Submitted (11-JAN-2008) to the INSDC.
RL   Contact:Takao Isogai Reverse Proteomics Research Institute; 1-9-11
RL   Kaji-cho, Chiyoda-ku, Tokyo 101-0044, Japan E-mail :flj-cdna@nifty.com
XX
RN   [2]
RA   Wakamatsu A., Yamamoto J., Kimura K., Kaida T., Tsuchiya K., Iida Y.,
RA   Takayama Y., Murakawa K., Kanehori K., Andoh T., Kagawa N., Sato R.,
RA   Kawamura Y., Tanaka S., Kisu Y., Sugano S., Goshima N., Nomura N.,
RA   Isogai T.;
RT   "NEDO functional analysis of protein and research application project";
RL   Unpublished.
XX
DR   MD5; f42e6f4fafc2ec6dbefc5e8f3628fb54.
DR   Ensembl-Gn; ENSG00000137710; homo_sapiens.
DR   Ensembl-Tr; ENST00000645495; homo_sapiens.
XX
CC   Human cDNA sequencing project focused on splicing variants of mRNA
CC   in NEDO functional analysis of protein and research application
CC   project supported by Ministry of Economy, Trade and Industry,
CC   Japan; cDNA selection for complete cds sequencing: Reverse
CC   Proteomics Research Institute (REPRORI), Hitachi, Ltd., Japan
CC   (Hitachi) and Japan Biological Informatics Consortium, Japan
CC   (JBIC); cDNA complete cds sequencing: JBIC and Biological
CC   Information Research Center (BIRC), AIST; cDNA library
CC   construction: Helix Research Institute supported by Japan Key
CC   Technology Center, Japan (HRI); cDNA 5'- & 3'-end sequencing:
CC   Research Association for Biotechnology, Japan, Biotechnology
CC   Center, National Institute of Technology and Evaluation, Japan and
CC   HRI; cDNA mapping to human genome: Central Research Laboratory,
CC   Hitachi; evaluation and annotation: REPRORI.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1964
FT                   /organism="Homo sapiens"
FT                   /mol_type="mRNA"
FT                   /clone_lib="BRHIP3"
FT                   /clone="BRHIP3001664"
FT                   /tissue_type="hippocampus"
FT                   /note="cloning vector: pME18SFL3"
FT                   /db_xref="taxon:9606"
FT   CDS_pept        213..1964
FT                   /note="Homo sapiens radixin (RDX), mRNA"
FT                   /db_xref="GOA:B0YJ88"
FT                   /db_xref="H-InvDB:HIT000431769.6"
FT                   /db_xref="InterPro:IPR000299"
FT                   /db_xref="InterPro:IPR000798"
FT                   /db_xref="InterPro:IPR008954"
FT                   /db_xref="InterPro:IPR011174"
FT                   /db_xref="InterPro:IPR011259"
FT                   /db_xref="InterPro:IPR011993"
FT                   /db_xref="InterPro:IPR014352"
FT                   /db_xref="InterPro:IPR018979"
FT                   /db_xref="InterPro:IPR018980"
FT                   /db_xref="InterPro:IPR019747"
FT                   /db_xref="InterPro:IPR019748"
FT                   /db_xref="InterPro:IPR019749"
FT                   /db_xref="InterPro:IPR029071"
FT                   /db_xref="InterPro:IPR035963"
FT                   /db_xref="InterPro:IPR041789"
FT                   /db_xref="UniProtKB/TrEMBL:B0YJ88"
FT                   /protein_id="BAG35749.1"
FT                   /translation="MPKPINVRVTTMDAELEFAIQPNTTGKQLFDQVVKTVGLREVWFF
FT                   GLQYVDSKGYSTWLKLNKKVTQQDVKKENPLQFKFRAKFFPEDVSEELIQEITQRLFFL
FT                   QVKEAILNDEIYCPPETAVLLASYAVQAKYGDYNKEIHKPGYLANDRLLPQRVLEQHKL
FT                   TKEQWEERIQNWHEEHRGMLREDSMMEYLKIAQDLEMYGVNYFEIKNKKGTELWLGVDA
FT                   LGLNIYEHDDKLTPKIGFPWSEIRNISFNDKKFVIKPIDKKAPDFVFYAPRLRINKRIL
FT                   ALCMGNHELYMRRRKPDTIEVQQMKAQAREEKHQKQLERAQLENEKKKREIAEKEKERI
FT                   EREKEELMERLKQIEEQTIKAQKELEEQTRKALELDQERKRAKEEAERLEKERRAAEEA
FT                   KSAIAKQAADQMKNQEQLAAELAEFTAKIALLEEAKKKKEEEATEWQHKAFAAQEDLEK
FT                   TKEELKTVMSAPPPPPPPPVIPPTENEHDEHDENNAEASAELSNEGVMNHRSEEERVTE
FT                   TQKNERVKKQLQALSSELAQARDETKKTQNDVLHAENVKAGRDKYKTLRQIRQGNTKQR
FT                   IDEFEAM"
XX
SQ   Sequence 1964 BP; 722 A; 374 C; 461 G; 407 T; 0 other;
     atattgcgga gctgtctgcg gtggcggcgg cgcctctcgt ctcccgcggc ccagcgctcg        60
     caccaccgct tctccctccc tgtcgcagcc gcgccgccgc gcagcgcccc agccacacgc       120
     cggcgggcag aagccgcccg ctctccggaa agtgataaca gaattcattg aagtggagaa       180
     tttttaaaga aggtaacaaa aagagaaaga aaatgccgaa accaatcaac gtaagagtaa       240
     ctacaatgga tgctgagctg gaatttgcca ttcagcccaa tacaactggc aaacaacttt       300
     ttgaccaggt ggtgaaaaca gttggtttgc gtgaggtctg gttttttggg ctgcagtatg       360
     tagacagcaa aggttattct acatggctta aactaaataa aaaggtaaca cagcaggatg       420
     ttaaaaaaga gaatccttta cagttcaagt ttagagctaa attctttcct gaagatgttt       480
     ctgaggaatt aattcaagaa ataacccaga gactcttctt cttgcaagtt aaagaagcca       540
     tcttaaatga tgagatatat tgcccgccag aaactgcagt tcttttggct tcctatgctg       600
     tccaagccaa gtatggagat tacaataaag agattcataa gccaggctac ctggctaatg       660
     atagactcct accccagcgt gtattggaac aacacaaact aacaaaagaa cagtgggaag       720
     aaagaataca gaactggcat gaagaacata gaggaatgtt aagggaggat tctatgatgg       780
     aatacctgaa gattgcacaa gatctagaaa tgtatggagt caactatttt gaaataaaaa       840
     ataaaaaagg aactgaattg tggctaggtg ttgatgcttt gggtctgaat atttatgagc       900
     atgacgacaa gttaacacct aaaattggtt ttccctggag tgaaatcaga aatatttcat       960
     ttaatgacaa aaaatttgtt ataaagccaa tcgacaaaaa ggcacctgat tttgtgtttt      1020
     atgcacctcg tctgagaatc aataagcgga ttttggcctt atgtatggga aaccatgaac      1080
     tatacatgcg aagaaggaag cctgatacta ttgaagtaca acagatgaag gctcaggcta      1140
     gggaggagaa acatcagaag cagttggaaa gggcacaatt agagaatgaa aagaagaaaa      1200
     gagaaatagc agaaaaggaa aaggaaagaa tagaacgtga aaaggaagag ctaatggaac      1260
     gtctaaaaca aattgaagag cagacaatta aagctcagaa agaactagaa gaacagactc      1320
     gaaaagctct agaactggat caagaacgaa aacgagcaaa agaagaagca gaacgacttg      1380
     aaaaggagcg tcgagctgct gaagaggcaa agtctgccat agcaaaacaa gctgccgacc      1440
     agatgaagaa tcaggagcag ctagcagcag aacttgctga attcactgcc aagattgcac      1500
     ttctagagga agccaagaag aaaaaggaag aggaagctac tgagtggcaa cacaaagctt      1560
     ttgcagccca ggaagacttg gaaaagacca aagaagagtt aaaaactgtg atgtctgccc      1620
     cccctccacc tccaccacca ccagtcattc ctccaacaga aaacgaacat gatgaacacg      1680
     atgagaataa tgctgaagct agtgctgaat tatcaaatga aggggtaatg aaccatagaa      1740
     gcgaggaaga acgtgtaacc gaaacacaga aaaatgagcg tgttaagaag caacttcagg      1800
     cattaagttc agaattagcc caagccagag atgaaaccaa gaaaacacaa aatgatgttc      1860
     ttcatgctga gaatgttaaa gcaggccgtg ataagtacaa gactctgcga cagattcgac      1920
     aaggcaatac aaagcagcgt atcgatgagt ttgaagcaat gtga                       1964
//

If you have problems or comments...

PBIL Back to PBIL home page