(data stored in ACNUC8465 zone)

EMBL: AK313053

ID   AK313053; SV 1; linear; mRNA; HTC; HUM; 1222 BP.
XX
AC   AK313053;
XX
DT   12-JAN-2008 (Rel. 94, Created)
DT   24-MAY-2008 (Rel. 95, Last updated, Version 2)
XX
DE   Homo sapiens cDNA, FLJ93529, highly similar to Homo sapiens
DE   mitogen-activated protein kinase kinase 4 (MAP2K4), mRNA.
XX
KW   HTC; HTC_FLI; oligo capping.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1222
RA   Isogai T., Yamamoto J.;
RT   ;
RL   Submitted (11-JAN-2008) to the INSDC.
RL   Contact:Takao Isogai Reverse Proteomics Research Institute; 1-9-11
RL   Kaji-cho, Chiyoda-ku, Tokyo 101-0044, Japan E-mail :flj-cdna@nifty.com
XX
RN   [2]
RA   Wakamatsu A., Yamamoto J., Kimura K., Kaida T., Tsuchiya K., Iida Y.,
RA   Takayama Y., Murakawa K., Kanehori K., Andoh T., Kagawa N., Sato R.,
RA   Kawamura Y., Tanaka S., Kisu Y., Sugano S., Goshima N., Nomura N.,
RA   Isogai T.;
RT   "NEDO functional analysis of protein and research application project";
RL   Unpublished.
XX
DR   MD5; 79bf59dcebeeda37d493c33d260f0017.
DR   Ensembl-Gn; ENSG00000065559; homo_sapiens.
DR   Ensembl-Tr; ENST00000353533; homo_sapiens.
DR   Ensembl-Tr; ENST00000415385; homo_sapiens.
XX
CC   Human cDNA sequencing project focused on splicing variants of mRNA
CC   in NEDO functional analysis of protein and research application
CC   project supported by Ministry of Economy, Trade and Industry,
CC   Japan; cDNA selection for complete cds sequencing: Reverse
CC   Proteomics Research Institute (REPRORI), Hitachi, Ltd., Japan
CC   (Hitachi) and Japan Biological Informatics Consortium, Japan
CC   (JBIC); cDNA complete cds sequencing: JBIC and Biological
CC   Information Research Center (BIRC), AIST; cDNA library
CC   construction: Helix Research Institute supported by Japan Key
CC   Technology Center, Japan (HRI); cDNA 5'- & 3'-end sequencing:
CC   Research Association for Biotechnology, Japan, Biotechnology
CC   Center, National Institute of Technology and Evaluation, Japan and
CC   HRI; cDNA mapping to human genome: Central Research Laboratory,
CC   Hitachi; evaluation and annotation: REPRORI.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1222
FT                   /organism="Homo sapiens"
FT                   /mol_type="mRNA"
FT                   /clone_lib="BRAWH3"
FT                   /clone="BRAWH3028659"
FT                   /tissue_type="brain"
FT                   /note="cloning vector: pME18SFL3"
FT                   /db_xref="taxon:9606"
FT   CDS_pept        23..1222
FT                   /note="highly similar to Homo sapiens mitogen-activated
FT                   protein kinase kinase 4 (MAP2K4), mRNA"
FT                   /db_xref="GOA:P45985"
FT                   /db_xref="H-InvDB:HIT000431919.6"
FT                   /db_xref="HGNC:HGNC:6844"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="PDB:3ALN"
FT                   /db_xref="PDB:3ALO"
FT                   /db_xref="PDB:3VUT"
FT                   /db_xref="UniProtKB/Swiss-Prot:P45985"
FT                   /protein_id="BAG35884.1"
FT                   /translation="MAAPSPSGGGGSGGGSGSGTPGPVGSPAPGHPAVSSMQGKRKALK
FT                   LNFANPPFKSTARFTLNPNPTGVQNPHIERLRTHSIESSGKLKISPEQHWDFTAEDLKD
FT                   LGEIGRGAYGSVNKMVHKPSGQIMAVKRIRSTVDEKEQKQLLMDLDVVMRSSDCPYIVQ
FT                   FYGALFREGDCWICMGLMSTSFDKFYKYVYSVLDDVIPEEILGKITLATVKALNHLKEN
FT                   LKIIHRDIKPSNILLDRSGNIKLCDFGISGQLVDSIAKTRDAGCRPYMAPERIDPSASR
FT                   QGYDVRSDVWSLGITLYELATGRFPYPKWNSVFDQLTQVVKGDPPQLSNSEEREFSPSF
FT                   INFVNLCLTKDESKRPKYKELLKHPFILMYEERAVEVACYVCKILDQMPATPSSPMYVD
FT                   "
XX
SQ   Sequence 1222 BP; 366 A; 269 C; 287 G; 300 T; 0 other;
     gctcggctct tcactcccaa caatggcggc tccgagcccg agcggcggcg gcggctccgg        60
     gggcggcagc ggcagcggca cccccggccc cgtagggtcc ccggcgccag gccacccggc       120
     cgtcagcagc atgcagggta aacgcaaagc actgaagttg aattttgcaa atccaccttt       180
     caaatctaca gcaaggttta ctctgaatcc caatcctaca ggagttcaaa acccacacat       240
     agagagactg agaacacaca gcattgagtc atcaggaaaa ctgaagatct cccctgaaca       300
     acactgggat ttcactgcag aggacttgaa agaccttgga gaaattggac gaggagctta       360
     tggttctgtc aacaaaatgg tccacaaacc aagtgggcaa ataatggcag ttaaaagaat       420
     tcggtcaaca gtggatgaaa aagaacaaaa acaacttctt atggatttgg atgtagtaat       480
     gcggagtagt gattgcccat acattgttca gttttatggt gcactcttca gagagggtga       540
     ctgttggatc tgtatgggac tcatgtctac ctcgtttgat aagttttaca aatatgtata       600
     tagtgtatta gatgatgtta ttccagaaga aattttaggc aaaatcactt tagcaactgt       660
     gaaagcacta aaccacttaa aagaaaactt gaaaattatt cacagagata tcaaaccttc       720
     caatattctt ctggacagaa gtggaaatat taagctctgt gacttcggca tcagtggaca       780
     gcttgtggac tctattgcca agacaagaga tgctggctgt aggccataca tggcacctga       840
     aagaatagac ccaagcgcat cacgacaagg atatgatgtc cgctctgatg tctggagttt       900
     ggggatcaca ttgtatgagt tggccacagg ccgatttcct tatccaaagt ggaatagtgt       960
     atttgatcaa ctaacacaag tcgtgaaagg agatcctccg cagctgagta attctgagga      1020
     aagggaattc tccccgagtt tcatcaactt tgtcaacttg tgccttacga aggatgaatc      1080
     caaaaggcca aagtataaag agcttctgaa acatcccttt attttgatgt atgaagaacg      1140
     tgccgttgag gtcgcatgct atgtttgtaa aatcctggat caaatgccag ctactcccag      1200
     ctctcccatg tatgtcgatt ga                                               1222
//

If you have problems or comments...

PBIL Back to PBIL home page