(data stored in ACNUC1829 zone)

EMBL: AK313112

ID   AK313112; SV 1; linear; mRNA; HTC; HUM; 876 BP.
XX
AC   AK313112;
XX
DT   12-JAN-2008 (Rel. 94, Created)
DT   24-MAY-2008 (Rel. 95, Last updated, Version 2)
XX
DE   Homo sapiens cDNA, FLJ93597, Homo sapiens transmembrane 4 superfamily
DE   member 3 (TM4SF3), mRNA.
XX
KW   HTC; HTC_FLI; oligo capping.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-876
RA   Isogai T., Yamamoto J.;
RT   ;
RL   Submitted (11-JAN-2008) to the INSDC.
RL   Contact:Takao Isogai Reverse Proteomics Research Institute; 1-9-11
RL   Kaji-cho, Chiyoda-ku, Tokyo 101-0044, Japan E-mail :flj-cdna@nifty.com
XX
RN   [2]
RA   Wakamatsu A., Yamamoto J., Kimura K., Kaida T., Tsuchiya K., Iida Y.,
RA   Takayama Y., Murakawa K., Kanehori K., Andoh T., Kagawa N., Sato R.,
RA   Kawamura Y., Tanaka S., Kisu Y., Sugano S., Goshima N., Nomura N.,
RA   Isogai T.;
RT   "NEDO functional analysis of protein and research application project";
RL   Unpublished.
XX
DR   MD5; 6da715c3ba9145ab995b138e4d2b8278.
DR   Ensembl-Gn; ENSG00000127324; homo_sapiens.
DR   Ensembl-Tr; ENST00000247829; homo_sapiens.
DR   Ensembl-Tr; ENST00000393330; homo_sapiens.
DR   Ensembl-Tr; ENST00000546561; homo_sapiens.
XX
CC   Human cDNA sequencing project focused on splicing variants of mRNA
CC   in NEDO functional analysis of protein and research application
CC   project supported by Ministry of Economy, Trade and Industry,
CC   Japan; cDNA selection for complete cds sequencing: Reverse
CC   Proteomics Research Institute (REPRORI), Hitachi, Ltd., Japan
CC   (Hitachi) and Japan Biological Informatics Consortium, Japan
CC   (JBIC); cDNA complete cds sequencing: JBIC and Biological
CC   Information Research Center (BIRC), AIST; cDNA library
CC   construction: Helix Research Institute supported by Japan Key
CC   Technology Center, Japan (HRI); cDNA 5'- & 3'-end sequencing:
CC   Research Association for Biotechnology, Japan, Biotechnology
CC   Center, National Institute of Technology and Evaluation, Japan and
CC   HRI; cDNA mapping to human genome: Central Research Laboratory,
CC   Hitachi; evaluation and annotation: REPRORI.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..876
FT                   /organism="Homo sapiens"
FT                   /mol_type="mRNA"
FT                   /clone_lib="COLON2"
FT                   /clone="COLON2004409"
FT                   /tissue_type="colon"
FT                   /note="cloning vector: pME18SFL3"
FT                   /db_xref="taxon:9606"
FT   CDS_pept        163..876
FT                   /note="Homo sapiens transmembrane 4 superfamily member 3
FT                   (TM4SF3), mRNA"
FT                   /db_xref="GOA:P19075"
FT                   /db_xref="H-InvDB:HIT000431978.6"
FT                   /db_xref="HGNC:HGNC:11855"
FT                   /db_xref="InterPro:IPR000301"
FT                   /db_xref="InterPro:IPR008952"
FT                   /db_xref="InterPro:IPR018499"
FT                   /db_xref="InterPro:IPR018503"
FT                   /db_xref="UniProtKB/Swiss-Prot:P19075"
FT                   /protein_id="BAG35934.1"
FT                   /translation="MAGVSACIKYSMFTFNFLFWLCGILILALAIWVRVSNDSQAIFGS
FT                   EDVGSSSYVAVDILIAVGAIIMILGFLGCCGAIKESRCMLLLFFIGLLLILLLQVATGI
FT                   LGAVFKSKSDRIVNETLYENTKLLSATGESEKQFQEAIIVFQEEFKCCGLVNGAADWGN
FT                   NFQHYPELCACLDKQRPCQSYNGKQVYKETCISFIKDFLAKNLIIVIGISFGLAVIEIL
FT                   GLVFSMVLYCQIGNK"
XX
SQ   Sequence 876 BP; 234 A; 163 C; 194 G; 285 T; 0 other;
     aataactttt tattcctccc tctacttctt tgctttctct ttctgctctg aagccgtgga        60
     tacagaaatc tctgcaggca agttgctcca gagcatattg caggacaagc ctgtaacgaa       120
     tagttaaatt cacggcatct ggattcctaa tccttttccg aaatggcagg tgtgagtgcc       180
     tgtataaaat attctatgtt taccttcaac ttcttgttct ggctatgtgg tatcttgatc       240
     ctagcattag caatatgggt acgagtaagc aatgactctc aagcaatttt tggttctgaa       300
     gatgtaggct ctagctccta cgttgctgtg gacatattga ttgctgtagg tgccatcatc       360
     atgattctgg gcttcctggg atgctgcggt gctataaaag aaagtcgctg catgcttctg       420
     ttgtttttca taggcttgct tctgatcctg ctcctgcagg tggcgacagg tatcctagga       480
     gctgttttca aatctaagtc tgatcgcatt gtgaatgaaa ctctctatga aaacacaaag       540
     cttttgagcg ccacagggga aagtgaaaaa caattccagg aagccataat tgtgtttcaa       600
     gaagagttta aatgctgtgg tttggtcaat ggagctgctg attggggaaa taattttcaa       660
     cactatcctg aattatgtgc ctgtctagat aagcagagac catgccaaag ctataatgga       720
     aaacaagttt acaaagagac ctgtatttct ttcataaaag acttcttggc aaaaaatttg       780
     attatagtta ttggaatatc atttggactg gcagttattg agatactggg tttggtgttt       840
     tctatggtcc tgtattgcca gatcgggaac aaatga                                 876
//

If you have problems or comments...

PBIL Back to PBIL home page