(data stored in ACNUC11016 zone)

EMBL: AK313626

ID   AK313626; SV 1; linear; mRNA; HTC; HUM; 1109 BP.
XX
AC   AK313626;
XX
DT   12-JAN-2008 (Rel. 94, Created)
DT   24-MAY-2008 (Rel. 95, Last updated, Version 2)
XX
DE   Homo sapiens cDNA, FLJ94196, highly similar to Homo sapiens annexin A8
DE   (ANXA8), mRNA.
XX
KW   HTC; HTC_FLI; oligo capping.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1109
RA   Isogai T., Yamamoto J.;
RT   ;
RL   Submitted (11-JAN-2008) to the INSDC.
RL   Contact:Takao Isogai Reverse Proteomics Research Institute; 1-9-11
RL   Kaji-cho, Chiyoda-ku, Tokyo 101-0044, Japan E-mail :flj-cdna@nifty.com
XX
RN   [2]
RA   Wakamatsu A., Yamamoto J., Kimura K., Kaida T., Tsuchiya K., Iida Y.,
RA   Takayama Y., Murakawa K., Kanehori K., Andoh T., Kagawa N., Sato R.,
RA   Kawamura Y., Tanaka S., Kisu Y., Sugano S., Goshima N., Nomura N.,
RA   Isogai T.;
RT   "NEDO functional analysis of protein and research application project";
RL   Unpublished.
XX
DR   MD5; 1080ae3ae4d8391edf75eda9afabb323.
DR   Ensembl-Gn; ENSG00000264230; homo_sapiens.
DR   Ensembl-Tr; ENST00000619162; homo_sapiens.
DR   Ensembl-Tr; ENST00000622769; homo_sapiens.
XX
CC   Human cDNA sequencing project focused on splicing variants of mRNA
CC   in NEDO functional analysis of protein and research application
CC   project supported by Ministry of Economy, Trade and Industry,
CC   Japan; cDNA selection for complete cds sequencing: Reverse
CC   Proteomics Research Institute (REPRORI), Hitachi, Ltd., Japan
CC   (Hitachi) and Japan Biological Informatics Consortium, Japan
CC   (JBIC); cDNA complete cds sequencing: JBIC and Biological
CC   Information Research Center (BIRC), AIST; cDNA library
CC   construction: Helix Research Institute supported by Japan Key
CC   Technology Center, Japan (HRI); cDNA 5'- & 3'-end sequencing:
CC   Research Association for Biotechnology, Japan, Biotechnology
CC   Center, National Institute of Technology and Evaluation, Japan and
CC   HRI; cDNA mapping to human genome: Central Research Laboratory,
CC   Hitachi; evaluation and annotation: REPRORI.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1109
FT                   /organism="Homo sapiens"
FT                   /mol_type="mRNA"
FT                   /clone_lib="TRACH2"
FT                   /clone="TRACH2002325"
FT                   /tissue_type="trachea"
FT                   /note="cloning vector: pME18SFL3"
FT                   /db_xref="taxon:9606"
FT   CDS_pept        126..1109
FT                   /note="highly similar to Homo sapiens annexin A8 (ANXA8),
FT                   mRNA"
FT                   /db_xref="GOA:Q5VT79"
FT                   /db_xref="H-InvDB:HIT000432492.6"
FT                   /db_xref="HGNC:HGNC:23334"
FT                   /db_xref="InterPro:IPR001464"
FT                   /db_xref="InterPro:IPR009115"
FT                   /db_xref="InterPro:IPR018252"
FT                   /db_xref="InterPro:IPR018502"
FT                   /db_xref="InterPro:IPR037104"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5VT79"
FT                   /protein_id="BAG36386.1"
FT                   /translation="MAWWKAWIEQEGVTVKSSSHFNPDPDAETLYKAMKGIGTNEQAII
FT                   DVLTKRSNTQRQQIAKSFKAQFGKDLTETLKSELSGKFERLIVALMYPPYRYEAKELHD
FT                   AMKGLGTKEGVIIEILASRTKNQLREIMKVYEEDYGSSLEEDIQADTSGYLERILVCLL
FT                   QGSRDDVSSFVDPALALQDAQDLYAAGEKIRGTDEMKFITILCTRSATHLLRVFEEYEK
FT                   IANKSIEDSIKSETHGSLEEAMLTVVKCTQNLHSYFAERLYYAMKGAGTRDGTLIRNIV
FT                   SRSEIDLNLIKCHFKKMYGKTLSSMIMEDTSGDYKNALLSLVGSDP"
XX
SQ   Sequence 1109 BP; 305 A; 285 C; 320 G; 199 T; 0 other;
     acccccacac ccaagtgagc ggcctgctca ctcctcagct gcaggagcca gacgtgtgga        60
     gtcccagcag aggccaacct gtgtctcttc atctccgtga gaaaggtgcc cccgaagtga       120
     aagagatggc ctggtggaaa gcctggattg aacaggaggg tgtcacagtg aagagcagct       180
     cccacttcaa cccagaccct gatgcagaga ccctctacaa agccatgaag gggatcggga       240
     ccaacgagca ggctatcatc gatgtgctca ccaagagaag caacacgcag cggcagcaga       300
     tcgccaagtc cttcaaggct cagttcggca aggacctcac tgagaccttg aagtctgagc       360
     tcagtggcaa gtttgagagg ctcattgtgg cccttatgta tccgccatac agatacgaag       420
     ccaaggagct gcatgacgcc atgaagggct taggaaccaa ggagggtgtc atcattgaga       480
     tcctggcctc tcggaccaag aaccagctgc gggagataat gaaggtgtat gaggaagact       540
     atgggtccag cctggaggag gacatccaag cagacacaag tggctacctg gagaggatcc       600
     tggtgtgcct cctgcagggc agcagggatg atgtgagcag ctttgtggac ccggcactgg       660
     ccctccaaga cgcacaggat ctgtatgcgg caggcgagaa gattcgtggg actgatgaga       720
     tgaaattcat caccatcctg tgcacgcgca gtgccactca cctgctgaga gtgtttgaag       780
     agtatgagaa aattgccaac aagagcattg aggacagcat caagagtgag acccatggct       840
     cactggagga ggccatgctc actgtggtga aatgcaccca aaacctccac agctactttg       900
     cagagagact ctactatgcc atgaagggag cagggacgcg tgatgggacc ctgataagaa       960
     acatcgtttc aaggagcgag attgacttaa atcttatcaa atgtcacttc aagaagatgt      1020
     acggcaagac cctcagcagc atgatcatgg aagacaccag cggcgactac aagaacgccc      1080
     tgctgagcct ggtgggcagc gacccctga                                        1109
//

If you have problems or comments...

PBIL Back to PBIL home page