(data stored in ACNUC1829 zone)

EMBL: AK313774

ID   AK313774; SV 1; linear; mRNA; HTC; HUM; 1190 BP.
XX
AC   AK313774;
XX
DT   12-JAN-2008 (Rel. 94, Created)
DT   24-MAY-2008 (Rel. 95, Last updated, Version 2)
XX
DE   Homo sapiens cDNA, FLJ94379, Homo sapiens tetraspan 1 (TSPAN-1), mRNA.
XX
KW   HTC; HTC_FLI; oligo capping.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1190
RA   Isogai T., Yamamoto J.;
RT   ;
RL   Submitted (11-JAN-2008) to the INSDC.
RL   Contact:Takao Isogai Reverse Proteomics Research Institute; 1-9-11
RL   Kaji-cho, Chiyoda-ku, Tokyo 101-0044, Japan E-mail :flj-cdna@nifty.com
XX
RN   [2]
RA   Wakamatsu A., Yamamoto J., Kimura K., Kaida T., Tsuchiya K., Iida Y.,
RA   Takayama Y., Murakawa K., Kanehori K., Andoh T., Kagawa N., Sato R.,
RA   Kawamura Y., Tanaka S., Kisu Y., Sugano S., Goshima N., Nomura N.,
RA   Isogai T.;
RT   "NEDO functional analysis of protein and research application project";
RL   Unpublished.
XX
DR   MD5; 42500710f7607b4dd0896f2e817dfbf5.
DR   Ensembl-Gn; ENSG00000117472; homo_sapiens.
DR   Ensembl-Tr; ENST00000372003; homo_sapiens.
XX
CC   Human cDNA sequencing project focused on splicing variants of mRNA
CC   in NEDO functional analysis of protein and research application
CC   project supported by Ministry of Economy, Trade and Industry,
CC   Japan; cDNA selection for complete cds sequencing: Reverse
CC   Proteomics Research Institute (REPRORI), Hitachi, Ltd., Japan
CC   (Hitachi) and Japan Biological Informatics Consortium, Japan
CC   (JBIC); cDNA complete cds sequencing: JBIC and Biological
CC   Information Research Center (BIRC), AIST; cDNA library
CC   construction: Helix Research Institute supported by Japan Key
CC   Technology Center, Japan (HRI); cDNA 5'- & 3'-end sequencing:
CC   Research Association for Biotechnology, Japan, Biotechnology
CC   Center, National Institute of Technology and Evaluation, Japan and
CC   HRI; cDNA mapping to human genome: Central Research Laboratory,
CC   Hitachi; evaluation and annotation: REPRORI.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1190
FT                   /organism="Homo sapiens"
FT                   /mol_type="mRNA"
FT                   /clone_lib="TESTI2"
FT                   /clone="TESTI2044593"
FT                   /tissue_type="testis"
FT                   /note="cloning vector: pME18SFL3"
FT                   /db_xref="taxon:9606"
FT   CDS_pept        465..1190
FT                   /note="Homo sapiens tetraspan 1 (TSPAN-1), mRNA"
FT                   /db_xref="GOA:O60635"
FT                   /db_xref="H-InvDB:HIT000432640.6"
FT                   /db_xref="HGNC:HGNC:20657"
FT                   /db_xref="InterPro:IPR000301"
FT                   /db_xref="InterPro:IPR008952"
FT                   /db_xref="InterPro:IPR018499"
FT                   /db_xref="InterPro:IPR018503"
FT                   /db_xref="UniProtKB/Swiss-Prot:O60635"
FT                   /protein_id="BAG36512.1"
FT                   /translation="MQCFSFIKTMMILFNLLIFLCGAALLAVGIWVSIDGASFLKIFGP
FT                   LSSSAMQFVNVGYFLIAAGVVVFALGFLGCYGAKTESKCALVTFFFILLLIFIAEVAAA
FT                   VVALVYTTMAEHFLTLLVVPAIKKDYGSQEDFTQVWNTTMKGLKCCGFTNYTDFEDSPY
FT                   FKENSAFPPFCCNDNVTNTANETCTKQKAHDQKVEGCFNQLLYDIRTNAVTVGGVAAGI
FT                   GGLELAAMIVSMYLYCNLQ"
XX
SQ   Sequence 1190 BP; 259 A; 336 C; 280 G; 315 T; 0 other;
     agacacacac accagcagct acacctacac gctgaccatc acaggcacac agaggcacat        60
     ccacctcaca tccacctcat acttgtgtac tctcagggtt cagtctttca tcctatccct       120
     ctctgatctg tgcctcccaa taccttccaa gatgtttaca gagacccttc tccctgtgca       180
     gttaggagtg taaggcaaga gagcccctac ttcatggggc agatcaagag ctgagaccaa       240
     agatggtcta tgttgctgac cttgtcctgt cctcctgctg tcttaaacta tgatccctgc       300
     tgcggtcact gaagcctttc cctgtgagca gtggtgtgtg agagccaggc gtccctctgc       360
     ctgcccactc agtggcaaca cccgggagct gttttgtcct ttgtggagcc tcagcagttc       420
     cctctttcag aactcactgc caagagccct gaacaggagc caccatgcag tgcttcagct       480
     tcattaagac catgatgatc ctcttcaatt tgctcatctt tctgtgtggt gcagccctgt       540
     tggcagtggg catctgggtg tcaatcgatg gggcatcctt tctgaagatc ttcgggccac       600
     tgtcgtccag tgccatgcag tttgtcaacg tgggctactt cctcatcgca gccggcgttg       660
     tggtctttgc tcttggtttc ctgggctgct atggtgctaa gactgagagc aagtgtgccc       720
     tcgtgacgtt cttcttcatc ctcctcctca tcttcattgc tgaggttgca gctgctgtgg       780
     tcgccttggt gtacaccaca atggctgagc acttcctgac gttgctggta gtgcctgcca       840
     tcaagaaaga ttatggttcc caggaagact tcactcaagt gtggaacacc accatgaaag       900
     ggctcaagtg ctgtggcttc accaactata cggattttga ggactcaccc tacttcaaag       960
     agaacagtgc ctttccccca ttctgttgca atgacaacgt caccaacaca gccaatgaaa      1020
     cctgcaccaa gcaaaaggct cacgaccaaa aagtagaggg ttgcttcaat cagcttttgt      1080
     atgacatccg aactaatgca gtcaccgtgg gtggtgtggc agctggaatt gggggcctcg      1140
     agctggctgc catgattgtg tccatgtatc tgtactgcaa tctacaataa                 1190
//

If you have problems or comments...

PBIL Back to PBIL home page