(data stored in ACNUC26462 zone)

EMBL: AK314917

ID   AK314917; SV 1; linear; mRNA; HTC; HUM; 1252 BP.
XX
AC   AK314917;
XX
DT   12-JAN-2008 (Rel. 94, Created)
DT   24-MAY-2008 (Rel. 95, Last updated, Version 2)
XX
DE   Homo sapiens cDNA, FLJ95825, Homo sapiens calcium/calmodulin-dependent
DE   protein kinase I (CAMK1),mRNA.
XX
KW   HTC; HTC_FLI; oligo capping.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1252
RA   Isogai T., Yamamoto J.;
RT   ;
RL   Submitted (11-JAN-2008) to the INSDC.
RL   Contact:Takao Isogai Reverse Proteomics Research Institute; 1-9-11
RL   Kaji-cho, Chiyoda-ku, Tokyo 101-0044, Japan E-mail :flj-cdna@nifty.com
XX
RN   [2]
RA   Wakamatsu A., Yamamoto J., Kimura K., Kaida T., Tsuchiya K., Iida Y.,
RA   Takayama Y., Murakawa K., Kanehori K., Andoh T., Kagawa N., Sato R.,
RA   Kawamura Y., Tanaka S., Kisu Y., Sugano S., Goshima N., Nomura N.,
RA   Isogai T.;
RT   "NEDO functional analysis of protein and research application project";
RL   Unpublished.
XX
DR   MD5; 3dedae04d71c8860d83093a20770e0d8.
DR   Ensembl-Gn; ENSG00000134072; homo_sapiens.
DR   Ensembl-Tr; ENST00000256460; homo_sapiens.
XX
CC   Human cDNA sequencing project focused on splicing variants of mRNA
CC   in NEDO functional analysis of protein and research application
CC   project supported by Ministry of Economy, Trade and Industry,
CC   Japan; cDNA selection for complete cds sequencing: Reverse
CC   Proteomics Research Institute (REPRORI), Hitachi, Ltd., Japan
CC   (Hitachi) and Japan Biological Informatics Consortium, Japan
CC   (JBIC); cDNA complete cds sequencing: JBIC and Biological
CC   Information Research Center (BIRC), AIST; cDNA library
CC   construction: Helix Research Institute supported by Japan Key
CC   Technology Center, Japan (HRI); cDNA 5'- & 3'-end sequencing:
CC   Research Association for Biotechnology, Japan, Biotechnology
CC   Center, National Institute of Technology and Evaluation, Japan and
CC   HRI; cDNA mapping to human genome: Central Research Laboratory,
CC   Hitachi; evaluation and annotation: REPRORI.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1252
FT                   /organism="Homo sapiens"
FT                   /mol_type="mRNA"
FT                   /clone_lib="BRAWH3"
FT                   /clone="BRAWH3049669"
FT                   /tissue_type="brain"
FT                   /note="cloning vector: pME18SFL3"
FT                   /db_xref="taxon:9606"
FT   CDS_pept        140..1252
FT                   /note="Homo sapiens calcium/calmodulin-dependent protein
FT                   kinase I (CAMK1),mRNA"
FT                   /db_xref="GOA:B0YIY3"
FT                   /db_xref="H-InvDB:HIT000433783.6"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:B0YIY3"
FT                   /protein_id="BAG37428.1"
FT                   /translation="MLGAVEGPRWKQAEDIRDIYDFRDVLGTGAFSEVILAEDKRTQKL
FT                   VAIKCIAKEALEGKEGSMENEIAVLHKIKHPNIVALDDIYESGGHLYLIMQLVSGGELF
FT                   DRIVEKGFYTERDASRLIFQVLDAVKYLHDLGIVHRDLKPENLLYYSLDEDSKIMISDF
FT                   GLSKMEDPGSVLSTACGTPGYVAPEVLAQKPYSKAVDCWSIGVIAYILLCGYPPFYDEN
FT                   DAKLFEQILKAEYEFDSPYWDDISDSAKDFIRHLMEKDPEKRFTCEQALQHPWIAGDTA
FT                   LDKNIHQSVSEQIKKNFAKSKWKQAFNATAVVRHMRKLQLGTSQEGQGQTASHGELLTP
FT                   VAGGPAAGCCCRDCCVEPGTELSPTLPHQL"
XX
SQ   Sequence 1252 BP; 285 A; 341 C; 398 G; 228 T; 0 other;
     aagagcgcgg gcgggtggcc caggcacgca gcggtgagga ccgcggccac agctcggcgc        60
     caaccaccgc gggcctccca gccagccccg cggcggggca gccgcaggag ccctggctgt       120
     ggtcgggggg cagtgggcca tgctgggggc agtggaaggc cccaggtgga agcaggcgga       180
     ggacattaga gacatctacg acttccgaga tgttctgggc acgggggcct tctcggaggt       240
     gatcctggca gaagataaga ggacgcagaa gctggtggcc atcaaatgca ttgccaagga       300
     ggccctggag ggcaaggaag gcagcatgga gaatgagatt gctgtcctgc acaagatcaa       360
     gcaccccaac attgtagccc tggatgacat ctatgagagt gggggccacc tctacctcat       420
     catgcagctg gtgtcgggtg gggagctctt tgaccgtatt gtggaaaaag gcttctacac       480
     ggagcgggac gccagccgcc tcatcttcca ggtgctggat gctgtgaaat acctgcatga       540
     cctgggcatt gtacaccggg atctcaagcc agagaatctg ctgtactaca gcctggatga       600
     agactccaaa atcatgatct ccgactttgg cctctccaag atggaggacc cgggcagtgt       660
     gctctccacc gcctgtggaa ctccgggata cgtggcccct gaagtcctgg cccagaagcc       720
     ctacagcaag gctgtggatt gctggtccat aggtgtcatc gcctacatct tgctctgcgg       780
     ttaccctccc ttctatgacg agaatgatgc caaactcttt gaacagattt tgaaggccga       840
     gtacgagttt gactctcctt actgggacga catctctgac tctgccaaag atttcatccg       900
     gcacttgatg gagaaggacc cagagaaaag attcacctgt gagcaggcct tgcagcaccc       960
     atggattgca ggagatacag ctctagataa gaatatccac cagtcggtga gtgagcagat      1020
     caagaagaac tttgccaaga gcaagtggaa gcaagccttc aatgccacgg ctgtggtgcg      1080
     gcacatgagg aaactgcagc tgggcaccag ccaggagggg caggggcaga cggcgagcca      1140
     tggggagctg ctgacaccag tggctggggg gccggcagct ggctgttgct gtcgagactg      1200
     ctgcgtggag ccgggcacag aactgtcccc cacactgccc caccagctct ag              1252
//

If you have problems or comments...

PBIL Back to PBIL home page