(data stored in ACNUC8465 zone)

EMBL: AK315505

ID   AK315505; SV 1; linear; mRNA; HTC; HUM; 1254 BP.
XX
AC   AK315505;
XX
DT   12-JAN-2008 (Rel. 94, Created)
DT   24-MAY-2008 (Rel. 95, Last updated, Version 2)
XX
DE   Homo sapiens cDNA, FLJ96569, Homo sapiens mitogen-activated protein kinase
DE   kinase 3 (MAP2K3),transcript variant B, mRNA.
XX
KW   HTC; HTC_FLI; oligo capping.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1254
RA   Isogai T., Yamamoto J.;
RT   ;
RL   Submitted (11-JAN-2008) to the INSDC.
RL   Contact:Takao Isogai Reverse Proteomics Research Institute; 1-9-11
RL   Kaji-cho, Chiyoda-ku, Tokyo 101-0044, Japan E-mail :flj-cdna@nifty.com
XX
RN   [2]
RA   Wakamatsu A., Yamamoto J., Kimura K., Kaida T., Tsuchiya K., Iida Y.,
RA   Takayama Y., Murakawa K., Kanehori K., Andoh T., Kagawa N., Sato R.,
RA   Kawamura Y., Tanaka S., Kisu Y., Sugano S., Goshima N., Nomura N.,
RA   Isogai T.;
RT   "NEDO functional analysis of protein and research application project";
RL   Unpublished.
XX
DR   MD5; 40fd8e4b18228223359b16b4f0000d00.
DR   Ensembl-Gn; ENSG00000034152; homo_sapiens.
DR   Ensembl-Tr; ENST00000342679; homo_sapiens.
XX
CC   Human cDNA sequencing project focused on splicing variants of mRNA
CC   in NEDO functional analysis of protein and research application
CC   project supported by Ministry of Economy, Trade and Industry,
CC   Japan; cDNA selection for complete cds sequencing: Reverse
CC   Proteomics Research Institute (REPRORI), Hitachi, Ltd., Japan
CC   (Hitachi) and Japan Biological Informatics Consortium, Japan
CC   (JBIC); cDNA complete cds sequencing: JBIC and Biological
CC   Information Research Center (BIRC), AIST; cDNA library
CC   construction: Helix Research Institute supported by Japan Key
CC   Technology Center, Japan (HRI); cDNA 5'- & 3'-end sequencing:
CC   Research Association for Biotechnology, Japan, Biotechnology
CC   Center, National Institute of Technology and Evaluation, Japan and
CC   HRI; cDNA mapping to human genome: Central Research Laboratory,
CC   Hitachi; evaluation and annotation: REPRORI.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1254
FT                   /organism="Homo sapiens"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NTONG2"
FT                   /clone="NTONG2003497"
FT                   /tissue_type="tongue"
FT                   /note="cloning vector: pME18SFL3"
FT                   /db_xref="taxon:9606"
FT   CDS_pept        211..1254
FT                   /note="Homo sapiens mitogen-activated protein kinase kinase
FT                   3 (MAP2K3),transcript variant B, mRNA"
FT                   /db_xref="GOA:Q6FI23"
FT                   /db_xref="H-InvDB:HIT000434371.6"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FI23"
FT                   /protein_id="BAG37889.1"
FT                   /translation="MESPASSQPASMPQSKGKSKRKKDLRISCMSKPPAPNPTPPRNLD
FT                   SRTFITIGDRNFEVEADDLVTISELGRGAYGVVEKVRHAQSGTIMAVKRIRATVNSQEQ
FT                   KRLLMDLDINMRTVDCFYTVTFYGALFREGDVWICMELMDTSLDKFYRKVLDKNMTIPE
FT                   DILGEIAVSIVRALEHLHSKLSVIHRDVKPSNVLINKEGHVKMCDFGISGYLVDSVAKT
FT                   MDAGCKPYMAPERINPELNQKGYNVKSDVWSLGITMIEMAILRFPYESWGTPFQQLKQV
FT                   VEEPSPQLPADRFSPEFVDFTAQCLRKNPAERMSYLELMEHPFFTLHKTKKTDIAAFVK
FT                   EILGEDS"
XX
SQ   Sequence 1254 BP; 268 A; 393 C; 361 G; 232 T; 0 other;
     agtctgtctc cggcgccgcc cgtcgcggac tcgtccttgc tgcagtcgcc gccgcagtcc        60
     tcgccgcagt cgccgccgcc gccgccgccg ccgccgctgc tcctccgcct ggcctgggcc       120
     gtctgcccgc agccatgagc gtgctcggcc ccagtggagc ccgcagtcct ctagattagt       180
     ctccaccgcc gtccaggacc cacttgcagc atggagtcgc ccgcctcgag ccagcccgcc       240
     agcatgcccc agtccaaagg aaaatccaag aggaagaagg atctacggat atcctgcatg       300
     tccaagccac ccgcacccaa ccccacaccc ccccggaacc tggactcccg gaccttcatc       360
     accattggag acagaaactt tgaggtggag gctgatgact tggtgaccat ctcagaactg       420
     ggccgtggag cctatggggt ggtagagaag gtgcggcacg cccagagcgg caccatcatg       480
     gccgtgaagc ggatccgggc caccgtgaac tcacaggagc agaagcggct gctcatggac       540
     ctggacatca acatgcgcac ggtcgactgt ttctacactg tcaccttcta cggggcacta       600
     ttcagagagg gagacgtgtg gatctgcatg gagctcatgg acacatcctt ggacaagttc       660
     taccggaagg tgctggataa aaacatgaca attccagagg acatccttgg ggagattgct       720
     gtgtctatcg tgcgggccct ggagcatctg cacagcaagc tgtcggtgat ccacagagat       780
     gtgaagccct ccaatgtcct tatcaacaag gagggccatg tgaagatgtg tgactttggc       840
     atcagtggct acttggtgga ctctgtggcc aagacgatgg atgccggctg caagccctac       900
     atggcccctg agaggatcaa cccagagctg aaccagaagg gctacaatgt caagtccgac       960
     gtctggagcc tgggcatcac catgattgag atggccatcc tgcggttccc ttacgagtcc      1020
     tgggggaccc cgttccagca gctgaagcag gtggtggagg agccgtcccc ccagctccca      1080
     gccgaccgtt tctcccccga gtttgtggac ttcactgctc agtgcctgag gaagaacccc      1140
     gcagagcgta tgagctacct ggagctgatg gagcacccct tcttcacctt gcacaaaacc      1200
     aagaagacgg acattgctgc cttcgtgaag gagatcctgg gagaagactc atag            1254
//

If you have problems or comments...

PBIL Back to PBIL home page