(data stored in ACNUC9306 zone)

EMBL: AK316061

ID   AK316061; SV 1; linear; mRNA; STD; HUM; 1709 BP.
XX
AC   AK316061;
XX
DT   23-JAN-2009 (Rel. 99, Created)
DT   23-JAN-2009 (Rel. 99, Last updated, Version 1)
XX
DE   Homo sapiens cDNA, FLJ78960 complete cds, highly similar to Radixin.
XX
KW   FLI_CDNA; oligo capping.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1709
RA   Isogai T., Yamamoto J.;
RT   ;
RL   Submitted (11-JAN-2008) to the INSDC.
RL   Contact:Takao Isogai Reverse Proteomics Research Institute; 1-9-11
RL   Kaji-cho, Chiyoda-ku, Tokyo 101-0044, Japan E-mail :flj-cdna@nifty.com
XX
RN   [2]
RA   Wakamatsu A., Yamamoto J., Kimura K., Ishii S., Watanabe K., Sugiyama A.,
RA   Murakawa K., Kaida T., Tsuchiya K., Fukuzumi Y., Kumagai A., Oishi Y.,
RA   Yamamoto S., Ono Y., Komori Y., Yamazaki M., Kisu Y., Nishikawa T.,
RA   Sugano S., Nomura N., Isogai T.;
RT   "NEDO human cDNA sequencing project";
RL   Unpublished.
XX
DR   MD5; 9d6d3428c5be23aca4d113c3a7736cc7.
DR   Ensembl-Gn; ENSG00000137710; homo_sapiens.
DR   Ensembl-Tr; ENST00000528498; homo_sapiens.
DR   Ensembl-Tr; ENST00000528900; homo_sapiens.
DR   Ensembl-Tr; ENST00000530301; homo_sapiens.
DR   Ensembl-Tr; ENST00000530749; homo_sapiens.
DR   Ensembl-Tr; ENST00000544551; homo_sapiens.
DR   Ensembl-Tr; ENST00000645495; homo_sapiens.
DR   Ensembl-Tr; ENST00000647231; homo_sapiens.
XX
CC   Human cDNA sequencing project focused on splicing variants of mRNA
CC   in NEDO functional analysis of protein and research application
CC   project supported by Ministry of Economy, Trade and Industry,
CC   Japan; cDNA selection for complete cds sequencing: Reverse
CC   Proteomics Research Institute (REPRORI), Hitachi, Ltd., Japan
CC   (Hitachi) and Japan Biological Informatics Consortium, Japan
CC   (JBIC); cDNA complete cds sequencing: JBIC; cDNA library
CC   construction: Helix Research Institute supported by Japan Key
CC   Technology Center, Japan (HRI); cDNA 5'- & 3'-end sequencing:
CC   Research Association for Biotechnology, Japan, Biotechnology
CC   Center, National Institute of Technology and Evaluation, Japan and
CC   HRI; cDNA mapping to human genome: Central Research Laboratory,
CC   Hitachi; evaluation and annotation: REPRORI.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1709
FT                   /organism="Homo sapiens"
FT                   /mol_type="mRNA"
FT                   /clone_lib="BRHIP3"
FT                   /clone="BRHIP3013545"
FT                   /tissue_type="hippocampus"
FT                   /note="cloning vector: pME18SFL3"
FT                   /db_xref="taxon:9606"
FT   CDS_pept        250..1593
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="highly similar to Radixin"
FT                   /db_xref="GOA:P35241"
FT                   /db_xref="H-InvDB:HIT000499674.4"
FT                   /db_xref="HGNC:HGNC:9944"
FT                   /db_xref="InterPro:IPR000299"
FT                   /db_xref="InterPro:IPR000798"
FT                   /db_xref="InterPro:IPR008954"
FT                   /db_xref="InterPro:IPR011174"
FT                   /db_xref="InterPro:IPR011259"
FT                   /db_xref="InterPro:IPR011993"
FT                   /db_xref="InterPro:IPR014352"
FT                   /db_xref="InterPro:IPR018979"
FT                   /db_xref="InterPro:IPR018980"
FT                   /db_xref="InterPro:IPR019747"
FT                   /db_xref="InterPro:IPR019748"
FT                   /db_xref="InterPro:IPR019749"
FT                   /db_xref="InterPro:IPR029071"
FT                   /db_xref="InterPro:IPR035963"
FT                   /db_xref="InterPro:IPR041789"
FT                   /db_xref="UniProtKB/Swiss-Prot:P35241"
FT                   /protein_id="BAH14432.1"
FT                   /translation="MLSWNLPFSPIQLANNFLTSVLEQHKLTKEQWEERIQNWHEEHRG
FT                   MLREDSMMEYLKIAQDLEMYGVNYFEIKNKKGTELWLGVDALGLNIYEHDDKLTPKIGF
FT                   PWSEIRNISFNDKKFVIKPIDKKAPDFVFYAPRLRINKRILALCMGNHELYMRRRKPDT
FT                   IEVQQMKAQAREEKHQKQLERAQLENEKKKREIAEKEKERIEREKEELMERLKQIEEQT
FT                   IKAQKELEEQTRKALELDQERKRAKEEAERLEKERRAAEEAKSAIAKQAADQMKNQEQL
FT                   AAELAEFTAKIALLEEARKKKEEEATEWQHKAFAAQEDLEKTKEELKTVMSAPPPPPPP
FT                   PVIPPTENEHDEHDENNAEASAELSNEGVMNHRSEEERVTETQKNERVKKQLQALSSEL
FT                   AQARDETKKTQNDVLHAENVKAGRDKYKTLRQIRQGNTKQRIDEFEAM"
XX
SQ   Sequence 1709 BP; 638 A; 334 C; 405 G; 332 T; 0 other;
     atattgcgga gctgtctgcg gtggcggcgg cgcctctcgt ctcccgcggc ccagcgctcg        60
     caccaccgct tctccctccc tgtcgcagcc gcgccgccgc gcagcgcccc agccacacgc       120
     cggcgggcag aagccgcccg ctctccggaa agtgataaca gaattcattg aagtggagaa       180
     tttttaaaga aggtaacaaa aagagaaaga aaatgccgaa accaatcaac gtaagagtaa       240
     ctacaatgga tgctgagctg gaatttgcca ttcagcccaa tacaactggc aaacaacttt       300
     ttgaccagtg tattggaaca acacaaacta acaaaagaac agtgggaaga aagaatacag       360
     aactggcatg aagaacatag aggaatgtta agggaggatt ctatgatgga atacctgaag       420
     attgcacaag atctagaaat gtatggagtc aactattttg aaataaaaaa taaaaaagga       480
     actgaattgt ggctaggtgt tgatgctttg ggtctgaata tttatgagca tgacgacaag       540
     ttaacaccta aaattggttt tccctggagt gaaatcagaa atatttcatt taatgacaaa       600
     aaatttgtta taaagccaat cgacaaaaag gcacctgatt ttgtgtttta tgcacctcgt       660
     ctgagaatca ataagcggat tttggcctta tgtatgggaa accatgaact atacatgcga       720
     agaaggaagc ctgatactat tgaagtacaa cagatgaagg ctcaggctag ggaggagaaa       780
     catcagaagc agttggaaag ggcacaatta gagaatgaaa agaagaaaag agaaatagca       840
     gaaaaggaaa aggaaagaat agaacgtgaa aaggaagagc taatggaacg tctaaaacaa       900
     attgaagagc agacaattaa agctcagaaa gaactagaag aacagactcg aaaagctcta       960
     gaactggatc aagaacgaaa acgagcaaaa gaagaagcag aacgacttga aaaggagcgt      1020
     cgagctgctg aagaggcaaa gtctgccata gcaaaacaag ctgccgacca gatgaagaat      1080
     caggagcagc tagcagcaga acttgctgaa ttcactgcca agattgcact tctagaggaa      1140
     gccaggaaga aaaaggaaga ggaagctact gagtggcaac acaaagcttt tgcagcccag      1200
     gaagacttgg aaaagaccaa agaagagtta aaaactgtga tgtctgcccc ccctccacct      1260
     ccaccaccac cagtcattcc tccaacagaa aacgaacatg atgaacacga tgagaataat      1320
     gctgaagcta gtgctgaatt atcaaatgaa ggggtaatga accatagaag cgaggaagaa      1380
     cgtgtaaccg aaacacagaa aaatgagcgt gttaagaagc aacttcaggc attaagttca      1440
     gaattagccc aagccagaga tgaaaccaag aaaacacaaa atgatgttct tcatgctgag      1500
     aatgttaaag caggccgtga taagtacaag actctgcgac agattcgaca aggcaataca      1560
     aagcagcgta tcgatgagtt tgaagcaatg tgagagctgt tattttgcat atatgttctt      1620
     cataagctga accaccaaca gagaaaagca ggcctttgca gatatgatgg aatgcatccc      1680
     accttgccaa agcacttaca ccagtttga                                        1709
//

If you have problems or comments...

PBIL Back to PBIL home page