(data stored in ACNUC8465 zone)

EMBL: AK316100

ID   AK316100; SV 1; linear; mRNA; STD; HUM; 1286 BP.
XX
AC   AK316100;
XX
DT   23-JAN-2009 (Rel. 99, Created)
DT   23-JAN-2009 (Rel. 99, Last updated, Version 1)
XX
DE   Homo sapiens cDNA, FLJ78999 complete cds, highly similar to Dual
DE   specificity mitogen-activated protein kinase kinase 4 (EC 2.7.12.2).
XX
KW   FLI_CDNA; oligo capping.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1286
RA   Isogai T., Yamamoto J.;
RT   ;
RL   Submitted (11-JAN-2008) to the INSDC.
RL   Contact:Takao Isogai Reverse Proteomics Research Institute; 1-9-11
RL   Kaji-cho, Chiyoda-ku, Tokyo 101-0044, Japan E-mail :flj-cdna@nifty.com
XX
RN   [2]
RA   Wakamatsu A., Yamamoto J., Kimura K., Ishii S., Watanabe K., Sugiyama A.,
RA   Murakawa K., Kaida T., Tsuchiya K., Fukuzumi Y., Kumagai A., Oishi Y.,
RA   Yamamoto S., Ono Y., Komori Y., Yamazaki M., Kisu Y., Nishikawa T.,
RA   Sugano S., Nomura N., Isogai T.;
RT   "NEDO human cDNA sequencing project";
RL   Unpublished.
XX
DR   MD5; 9e7d60c4990c07355707a99dc4dbbea1.
XX
CC   Human cDNA sequencing project focused on splicing variants of mRNA
CC   in NEDO functional analysis of protein and research application
CC   project supported by Ministry of Economy, Trade and Industry,
CC   Japan; cDNA selection for complete cds sequencing: Reverse
CC   Proteomics Research Institute (REPRORI), Hitachi, Ltd., Japan
CC   (Hitachi) and Japan Biological Informatics Consortium, Japan
CC   (JBIC); cDNA complete cds sequencing: JBIC; cDNA library
CC   construction: Helix Research Institute supported by Japan Key
CC   Technology Center, Japan (HRI); cDNA 5'- & 3'-end sequencing:
CC   Research Association for Biotechnology, Japan, Biotechnology
CC   Center, National Institute of Technology and Evaluation, Japan and
CC   HRI; cDNA mapping to human genome: Central Research Laboratory,
CC   Hitachi; evaluation and annotation: REPRORI.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1286
FT                   /organism="Homo sapiens"
FT                   /mol_type="mRNA"
FT                   /clone_lib="BRTHA3"
FT                   /clone="BRTHA3004349"
FT                   /tissue_type="thalamus"
FT                   /note="cloning vector: pME18SFL3"
FT                   /db_xref="taxon:9606"
FT   CDS_pept        191..1036
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="highly similar to Dual specificity mitogen-activated
FT                   protein kinase kinase 4 (EC 2.7.12.2)"
FT                   /db_xref="GOA:B7Z9Y5"
FT                   /db_xref="H-InvDB:HIT000499713.4"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:B7Z9Y5"
FT                   /protein_id="BAH14471.1"
FT                   /translation="MVHKPSGQIMAVKRIRSTVDEKEQKQLLMDLDVVMRSSDCPYIVQ
FT                   FYGALFREGDCWICMELMSTSFDKFYKYVYSVLDDVIPEEILGKITLATVKALNHLKEN
FT                   LKIIHRDIKPSNILLDRSGNIKLCDFGISGQLVDSIAKTRDAGCRPYMAPERIDPSASR
FT                   QGYDVRSDVWSLGITLYELATGRFPYPKWNSVFDQLTQVVKGDPPQLSNSEEREFSPSF
FT                   INFVNLCLTKDESKRPKYKELLKHPFILMYEERAVEVACYVCKILGQMPATPSSPMYVD
FT                   "
XX
SQ   Sequence 1286 BP; 398 A; 250 C; 289 G; 349 T; 0 other;
     atctagagat cgtaacagta cggacacaga agaacagttg cagtgatgtg caggagagag        60
     actgagaaca cacagcattg agtcatcagg aaaactgaag atctcccctg aacaacactg       120
     ggatttcact gcagaggact tgaaagacct tggagaaatt ggacgaggag cttatggttc       180
     tgtcaacaaa atggtccaca aaccaagtgg gcaaataatg gcagttaaaa gaattcggtc       240
     aacagtggat gaaaaagaac aaaaacaact tcttatggat ttggatgtag taatgcggag       300
     tagtgattgc ccatacattg ttcagtttta tggtgcactc ttcagagagg gtgactgttg       360
     gatctgtatg gaactcatgt ctacctcgtt tgataagttt tacaaatatg tatatagtgt       420
     attagatgat gttattccag aagaaatttt aggcaaaatc actttagcaa ctgtgaaagc       480
     actaaaccac ttaaaagaaa acttgaaaat tattcacaga gatatcaaac cttccaatat       540
     tcttctggac agaagtggaa atattaagct ctgtgacttc ggcatcagtg gacagcttgt       600
     ggactctatt gccaagacaa gagatgctgg ctgtaggcca tacatggcac ctgaaagaat       660
     agacccaagc gcatcacgac aaggatatga tgtccgctct gatgtctgga gtttggggat       720
     cacattgtat gagttggcca caggccgatt tccttatcca aagtggaata gtgtatttga       780
     tcaactaaca caagtcgtga aaggagatcc tccgcagctg agtaattctg aggaaaggga       840
     attctccccg agtttcatca actttgtcaa cttgtgcctt acgaaggatg aatccaaaag       900
     gccaaagtat aaagagcttc tgaaacatcc ctttattttg atgtatgaag aacgtgccgt       960
     tgaggtcgca tgctatgttt gtaaaatcct gggtcaaatg ccagctactc ccagctctcc      1020
     catgtatgtc gattgatatc gctgctacat cagactctag aaaaaagggc tgagaggaag      1080
     caagacgtaa agaattttca tcccgtatca cagtgttttt attgctcgcc cagacaccat      1140
     gtgcaataag attggtgttc gtttccatca tgtctgtata ctcctgtcac ctagaacgtg      1200
     catccttgta atacctgatt gatcacacag tgttagtgct ggtcagagag acctcatcct      1260
     gctcttttgt gatgaacata ttcatg                                           1286
//

If you have problems or comments...

PBIL Back to PBIL home page