(data stored in ACNUC8465 zone)

EMBL: AK316177

ID   AK316177; SV 1; linear; mRNA; STD; HUM; 1430 BP.
XX
AC   AK316177;
XX
DT   23-JAN-2009 (Rel. 99, Created)
DT   23-JAN-2009 (Rel. 99, Last updated, Version 1)
XX
DE   Homo sapiens cDNA, FLJ79076 complete cds, highly similar to Dual
DE   specificity mitogen-activated protein kinase kinase 4 (EC 2.7.12.2).
XX
KW   FLI_CDNA; oligo capping.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1430
RA   Isogai T., Yamamoto J.;
RT   ;
RL   Submitted (11-JAN-2008) to the INSDC.
RL   Contact:Takao Isogai Reverse Proteomics Research Institute; 1-9-11
RL   Kaji-cho, Chiyoda-ku, Tokyo 101-0044, Japan E-mail :flj-cdna@nifty.com
XX
RN   [2]
RA   Wakamatsu A., Yamamoto J., Kimura K., Ishii S., Watanabe K., Sugiyama A.,
RA   Murakawa K., Kaida T., Tsuchiya K., Fukuzumi Y., Kumagai A., Oishi Y.,
RA   Yamamoto S., Ono Y., Komori Y., Yamazaki M., Kisu Y., Nishikawa T.,
RA   Sugano S., Nomura N., Isogai T.;
RT   "NEDO human cDNA sequencing project";
RL   Unpublished.
XX
DR   MD5; 9d8f2aa00bdd0d5bfd36a81b91c8e9e2.
XX
CC   Human cDNA sequencing project focused on splicing variants of mRNA
CC   in NEDO functional analysis of protein and research application
CC   project supported by Ministry of Economy, Trade and Industry,
CC   Japan; cDNA selection for complete cds sequencing: Reverse
CC   Proteomics Research Institute (REPRORI), Hitachi, Ltd., Japan
CC   (Hitachi) and Japan Biological Informatics Consortium, Japan
CC   (JBIC); cDNA complete cds sequencing: JBIC; cDNA library
CC   construction: Helix Research Institute supported by Japan Key
CC   Technology Center, Japan (HRI); cDNA 5'- & 3'-end sequencing:
CC   Research Association for Biotechnology, Japan, Biotechnology
CC   Center, National Institute of Technology and Evaluation, Japan and
CC   HRI; cDNA mapping to human genome: Central Research Laboratory,
CC   Hitachi; evaluation and annotation: REPRORI.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1430
FT                   /organism="Homo sapiens"
FT                   /mol_type="mRNA"
FT                   /dev_stage="fetal"
FT                   /clone_lib="FEBRA2"
FT                   /clone="FEBRA2027557"
FT                   /tissue_type="brain"
FT                   /note="cloning vector: pME18SFL3"
FT                   /db_xref="taxon:9606"
FT   CDS_pept        56..871
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="highly similar to Dual specificity mitogen-activated
FT                   protein kinase kinase 4 (EC 2.7.12.2)"
FT                   /db_xref="GOA:B7ZA62"
FT                   /db_xref="H-InvDB:HIT000499790.4"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:B7ZA62"
FT                   /protein_id="BAH14548.1"
FT                   /translation="MCRRIRSTVDEKEQKQLLMDLDVVMRSSDCPYIVQFYGALFREGD
FT                   CWICMELMSTSFDKFYKYVYSVLDDVIPEEILGKITLATVKALNHLKENLKIIHRDIKP
FT                   SNILLDRSGNIKLCDFGISGQLVDSIAKTRDAGCRPYMAPERIDPSASRQGYDVRSDVW
FT                   SLGITLYELATGRFPYPKWNSVFDQLTQVVKGDPPQLSNSEEREFSPSFINFVNLCLTK
FT                   DESKRPKYKELLKHPFILMYEERAVEVACYVCKILDQMPATPSSPMYVD"
XX
SQ   Sequence 1430 BP; 431 A; 273 C; 320 G; 406 T; 0 other;
     agcagtattc atctagagat cgtaacagta cggacacaga agaacagttg cagtgatgtg        60
     caggagaatt cggtcaacag tggatgaaaa agaacaaaaa caacttctta tggatttgga       120
     tgtagtaatg cggagtagtg attgcccata cattgttcag ttttatggtg cactcttcag       180
     agagggtgac tgttggatct gtatggaact catgtctacc tcgtttgata agttttacaa       240
     atatgtatat agtgtattag atgatgttat tccagaagaa attttaggca aaatcacttt       300
     agcaactgtg aaagcactaa accacttaaa agaaaacttg aaaattattc acagagatat       360
     caaaccttcc aatattcttc tggacagaag tggaaatatt aagctctgcg acttcggcat       420
     cagtggacag cttgtggact ctattgccaa gacaagagat gctggctgta ggccatacat       480
     ggcacctgaa agaatagacc caagcgcatc acgacaagga tatgatgtcc gctctgatgt       540
     ctggagtttg gggatcacat tgtatgagtt ggccacaggc cgatttcctt atccaaagtg       600
     gaatagtgta tttgatcaac taacacaagt cgtgaaagga gatcctccgc agctgagtaa       660
     ttctgaggaa agggaattct ccccgagttt catcaacttt gtcaacttgt gccttacgaa       720
     ggatgaatcc aaaaggccaa agtataaaga gcttctgaaa catcccttta ttttgatgta       780
     tgaagaacgt gccgttgagg tcgcatgcta tgtttgtaaa atcctggatc aaatgccagc       840
     tactcccagc tctcccatgt atgtcgattg atatcgctgc tacatcagac tctagaaaaa       900
     agggctgaga ggaagcaaga cgtaaagaat tttcatcccg tatcacagtg tttttattgc       960
     tcgcccagac accatgtgca ataagattgg tgttcgtttc catcatgtct gtatactcct      1020
     gtcacctaga acgtgcatcc ttgtaatacc tgattgatca cacagtgtta gtgctggtca      1080
     gagagacctc atcctgctct tttgtgatga acatattcat gaaatgtgga agtcagtacg      1140
     atcaagttgt tgactgtgat tagatcacat cttaaattca tttctagact caaaacctgg      1200
     agatgcagct actggaatgg tgttttgtca gacttccaaa tcctggaagg acacagtgat      1260
     gaatgtacta tgtctgaaca tagaaactcg ggcttgagtg agaagagctt gcacagccaa      1320
     cgagacacat tgccttctgg agctgggaga caaaggagga atttactttc ttcaccaagt      1380
     gcaatagatt actgatgtga tattctgttg ctttacagtt acagttgatg                 1430
//

If you have problems or comments...

PBIL Back to PBIL home page