(data stored in ACNUC31108 zone)

EMBL: AK316348

ID   AK316348; SV 1; linear; mRNA; STD; HUM; 1571 BP.
XX
AC   AK316348;
XX
DT   23-JAN-2009 (Rel. 99, Created)
DT   23-JAN-2009 (Rel. 99, Last updated, Version 1)
XX
DE   Homo sapiens cDNA, FLJ79247 complete cds, highly similar to Leukocyte
DE   antigen CD37.
XX
KW   FLI_CDNA; oligo capping.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1571
RA   Isogai T., Yamamoto J.;
RT   ;
RL   Submitted (11-JAN-2008) to the INSDC.
RL   Contact:Takao Isogai Reverse Proteomics Research Institute; 1-9-11
RL   Kaji-cho, Chiyoda-ku, Tokyo 101-0044, Japan E-mail :flj-cdna@nifty.com
XX
RN   [2]
RA   Wakamatsu A., Yamamoto J., Kimura K., Ishii S., Watanabe K., Sugiyama A.,
RA   Murakawa K., Kaida T., Tsuchiya K., Fukuzumi Y., Kumagai A., Oishi Y.,
RA   Yamamoto S., Ono Y., Komori Y., Yamazaki M., Kisu Y., Nishikawa T.,
RA   Sugano S., Nomura N., Isogai T.;
RT   "NEDO human cDNA sequencing project";
RL   Unpublished.
XX
DR   MD5; 69d5e43068a7d4c7b62c557180d4c396.
DR   Ensembl-Gn; ENSG00000104894; homo_sapiens.
DR   Ensembl-Tr; ENST00000535669; homo_sapiens.
XX
CC   Human cDNA sequencing project focused on splicing variants of mRNA
CC   in NEDO functional analysis of protein and research application
CC   project supported by Ministry of Economy, Trade and Industry,
CC   Japan; cDNA selection for complete cds sequencing: Reverse
CC   Proteomics Research Institute (REPRORI), Hitachi, Ltd., Japan
CC   (Hitachi) and Japan Biological Informatics Consortium, Japan
CC   (JBIC); cDNA complete cds sequencing: JBIC; cDNA library
CC   construction: Helix Research Institute supported by Japan Key
CC   Technology Center, Japan (HRI); cDNA 5'- & 3'-end sequencing:
CC   Research Association for Biotechnology, Japan, Biotechnology
CC   Center, National Institute of Technology and Evaluation, Japan and
CC   HRI; cDNA mapping to human genome: Central Research Laboratory,
CC   Hitachi; evaluation and annotation: REPRORI.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1571
FT                   /organism="Homo sapiens"
FT                   /mol_type="mRNA"
FT                   /clone_lib="SYNOV2"
FT                   /clone="SYNOV2004895"
FT                   /tissue_type="synovial membrane tissue from rheumatoid
FT                   arthritis"
FT                   /note="cloning vector: pME18SFL3"
FT                   /db_xref="taxon:9606"
FT   CDS_pept        12..824
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="highly similar to Leukocyte antigen CD37"
FT                   /db_xref="GOA:B7ZAN3"
FT                   /db_xref="H-InvDB:HIT000499961.4"
FT                   /db_xref="HGNC:HGNC:1666"
FT                   /db_xref="InterPro:IPR000301"
FT                   /db_xref="InterPro:IPR008952"
FT                   /db_xref="InterPro:IPR018499"
FT                   /db_xref="InterPro:IPR018503"
FT                   /db_xref="UniProtKB/TrEMBL:B7ZAN3"
FT                   /protein_id="BAH14719.1"
FT                   /translation="MSAQESCLSLIKYFLFVFNLFFFVLGSLIFCFGIWILIDKTSFVS
FT                   FVGLAFVPLQIWSKVLAISGIFTMGIALLGCVGALKELRCLLGLYFGMLLLLFATQITL
FT                   GILISTQRAQLERSLRDVVEKTIQKYGTNPEETAAEESWDYVQFQLRCCGWHYPQDWFQ
FT                   VLILRGNGSEAHRVPCSCYNLSATNDSTILDKVILPQLSRLGHLARSRHSADICAVPAE
FT                   SHIYREGCAQGLQKWLHNNLISIVGICLGVGLLEVIWPRPHPRSALNP"
XX
SQ   Sequence 1571 BP; 274 A; 533 C; 454 G; 310 T; 0 other;
     actaggtgaa gatgtcagcc caggagagct gcctcagcct catcaagtac ttcctcttcg        60
     ttttcaacct cttcttcttc gtcctcggca gcctgatctt ctgcttcggc atctggatcc       120
     tcatcgacaa gaccagcttc gtgtcctttg tgggcttggc cttcgtgcct ctgcagatct       180
     ggtccaaagt cctggccatc tcaggaatct tcaccatggg catcgccctc ctgggttgtg       240
     tgggggccct caaggagctc cgctgcctcc tgggcctgta ttttgggatg ctgctgctcc       300
     tgtttgccac acagatcacc ctgggaatcc tcatctccac tcagcgggcc cagctggagc       360
     gaagcttgcg ggacgtcgta gagaaaacca tccaaaagta cggcaccaac cccgaggaga       420
     ccgcggccga ggagagctgg gactatgtgc agttccagct gcgctgctgc ggctggcact       480
     acccgcagga ctggttccaa gtcctcatcc tgagaggtaa cgggtcggag gcgcaccgcg       540
     tgccctgctc ctgctacaac ttgtcggcga ccaacgactc cacaatccta gataaggtga       600
     tcttgcccca gctcagcagg cttggacacc tggcgcggtc cagacacagt gcagacatct       660
     gcgctgtccc tgcagagagc cacatctacc gcgagggctg cgcgcagggc ctccagaagt       720
     ggctgcacaa caaccttatt tccatagtgg gcatttgcct gggcgtcggc ctactcgagg       780
     tgatctggcc ccgcccccac ccgcgatcgg ccctaaatcc ctagatggcc ctgcccttca       840
     tttcgcgtcc ttcggttgcc tgggaaggac gagctcaggg cggagcgcag cccaccccgg       900
     ccctcccgcc gctccaccca gcaccggagg gtgggggcgg cccagcttca gggagccctg       960
     attgggtgta cgcagggaaa gcctcctgct attggctgcg atctccctcc cctttctccg      1020
     cagatgactg tcatggtgct gagcgtacag ctacagcgca gggcactccg ccggaaatgc      1080
     gagccgcacg tgccgggcgc tggggattcg agccccgggc ccagcctgat cgctgacggc      1140
     ggcggcgggc acagcggcag tctgtggggt ggctggggca tggcgggtgc ctgccccaac      1200
     tggggagaca aggcaccgca gggcaagctg cccatggccc tggggctctg gccgctgtgg      1260
     gttcaagacg aggaccagcc tgacactgga agtgcgggcg cagaattaga ggaggcacaa      1320
     ttagaggctg aggcagaggg ggaagacaga tgagcctcca aaataaagga ccctgggctt      1380
     gcttccgacc ttactccttc tcagcctcta cccccacttg tagcagctat tcccgcctca      1440
     tcagccagcc ctgcggcagt tcccgtcgag ccccgccctt ttctacctat ccccttctcc      1500
     agccccttcc cgcccaattc acggccccac ccctgacctt tctcgcccgg gtgggcatca      1560
     cccccgtctc g                                                           1571
//

If you have problems or comments...

PBIL Back to PBIL home page