(data stored in ACNUC7421 zone)

EMBL: AK316991

ID   AK316991; SV 1; linear; mRNA; STD; PLN; 1128 BP.
XX
AC   AK316991;
XX
DT   04-FEB-2009 (Rel. 99, Created)
DT   21-APR-2009 (Rel. 100, Last updated, Version 2)
XX
DE   Arabidopsis thaliana AT5G43280 mRNA, complete cds, clone: RAFL14-52-B16.
XX
KW   CAP trapper; FLI_CDNA.
XX
OS   Arabidopsis thaliana (thale cress)
OC   Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
OC   Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae; Pentapetalae;
OC   rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis.
XX
RN   [1]
RP   1-1128
RA   Fukami-Kobayashi K., Iida K., Kobayashi M., Seki M., Ishida J.,
RA   Nakajima M., Kawashima M., Morosawa T., Toyoda A., Sakaki Y., Carninci P.,
RA   Kawai J., Hayashizaki Y., Shinozaki K.;
RT   ;
RL   Submitted (15-OCT-2008) to the INSDC.
RL   Contact:Kaoru Fukami-Kobayashi RIKEN, BioResource Center; 3-1-1 Koyadai,
RL   Tsukuba, Ibaraki 305-0074, Japan URL    :http://www.brc.riken.jp/
XX
RN   [2]
RX   DOI; 10.1093/dnares/dsp009.
RX   PUBMED; 19423640.
RA   Iida K., Fukami-Kobayashi K., Toyoda A., Sakaki Y., Kobayashi M., Seki M.,
RA   Shinozaki K.;
RT   "Analysis of multiple occurrences of alternative splicing events in
RT   Arabidopsis thaliana using novel sequenced full-length cDNAs";
RL   DNA Res. 16(3):155-164(2009).
XX
DR   MD5; f1b9b953ffb0d23dfaa7b02a64044e23.
XX
CC   An Arabidopsis full-length cDNA library was constructed
CC   essentially as reported previously. (Seki et al. (1998) Plant J.
CC   15:707-720; Seki et al. (2002) Science 296:141-145)
CC   This clone is in a modified pBluescript vector.
CC   Please visit our web site (http://rarge.gsc.riken.jp/) for further
CC   details.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1128
FT                   /organism="Arabidopsis thaliana"
FT                   /chromosome="5"
FT                   /ecotype="Columbia"
FT                   /mol_type="mRNA"
FT                   /clone_lib="RAFL14"
FT                   /clone="RAFL14-52-B16"
FT                   /tissue_type="roots"
FT                   /db_xref="taxon:3702"
FT   CDS_pept        28..690
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /gene="AT5G43280"
FT                   /note="TAIR description: ATDCI1
FT                   (DELTA(3,5),DELTA(2,4)-DIENOYL-COA ISOMERASE 1)"
FT                   /note="alternative splicing: AT5G43280.2"
FT                   /db_xref="GOA:Q9FHR8"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9FHR8"
FT                   /protein_id="BAH19686.1"
FT                   /translation="MTMESYKTLEIIRKNTDSSVFHLIINRPSHLNALSLDFFIEFPKA
FT                   LSSLDQNPDVSVIILSGAGKHFCSGIDLNSLSSISTQSSSGNDRGRSSEQLRRKIKSMQ
FT                   AAITAIEQCRKPVIAAIHGACIGGGVDLITACDIRYCSEDAFFSIKEVDLAIVADLGTL
FT                   QRLPSIVGYANAMELALTARRFSGSEAKDLGLVSKVFGSKSELDNGVTTIAEDSGMI"
XX
SQ   Sequence 1128 BP; 316 A; 244 C; 230 G; 338 T; 0 other;
     atcatcatca tcactgtatt tcaaactatg acaatggagt catacaaaac cctagaaatc        60
     attcgcaaga acactgattc ctccgtattt catctcatca tcaacagacc atcacatctc       120
     aacgccttat ctctcgattt cttcatcgaa ttccccaaag ctctctcatc tctcgaccaa       180
     aatccagatg tctccgtcat catcctctcc ggcgccggaa aacacttctg ctccggtatc       240
     gatctcaatt ccctctcttc aatctcgaca caatcctcct ccggtaacga cagaggacga       300
     tctagcgagc agctacgccg taagatcaag tcgatgcaag cggcgattac agcgattgaa       360
     caatgccgga aacctgtaat cgccgctatt cacggcgcgt gtatcggtgg cggtgttgat       420
     ctgattaccg cttgtgatat taggtattgc tctgaggatg cgtttttctc gattaaagag       480
     gttgatctag cgattgttgc ggatcttggt acacttcagc gattaccgag tatcgttggg       540
     tatgctaacg ccatggaatt ggctttaact gctcggagat tctctggaag tgaagcaaag       600
     gatcttggtt tggtttctaa agttttcgga tctaaatcgg agcttgataa tggcgtcact       660
     acaatcgccg aagattctgg gatgatttag ggttcgaatc acgtttttcg aacgaatttt       720
     ctcggaattc gtttcatttt tcgacttttc gtttaatcgg aataggaggc aagtctcctt       780
     tagctgtgac agggacaaag gcagtgttat taagaagcag agaggtgagt gtagaacaag       840
     gacttgacta tgtagcaact tggaactcgg ctatgcttat atcagatgat ctcaacgaag       900
     ctgtttctgc tcagatgatg aaaagaaaac ctcggtttgc taaactttga tacagtctct       960
     ctgttgcttc tttatctttc aaagctcttc tggtaactaa agtaataaga tattacttca      1020
     aataagttta gttattgata gttccctaat tacggattag ggctatagat aaaatggtct      1080
     tctacacatg agaatatgat taatactctg cacaaaaaaa aaaaaaaa                   1128
//

If you have problems or comments...

PBIL Back to PBIL home page