(data stored in ACNUC16935 zone)

EMBL: AK317101

ID   AK317101; SV 1; linear; mRNA; STD; PLN; 1221 BP.
XX
AC   AK317101;
XX
DT   04-FEB-2009 (Rel. 99, Created)
DT   21-APR-2009 (Rel. 100, Last updated, Version 3)
XX
DE   Arabidopsis thaliana AT5G03240 mRNA, complete cds, clone: RAFL21-69-O11.
XX
KW   CAP trapper; FLI_CDNA.
XX
OS   Arabidopsis thaliana (thale cress)
OC   Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
OC   Spermatophyta; Magnoliophyta; eudicotyledons; Gunneridae; Pentapetalae;
OC   rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis.
XX
RN   [1]
RP   1-1221
RA   Fukami-Kobayashi K., Iida K., Kobayashi M., Seki M., Ishida J.,
RA   Nakajima M., Kawashima M., Morosawa T., Toyoda A., Sakaki Y., Carninci P.,
RA   Kawai J., Hayashizaki Y., Shinozaki K.;
RT   ;
RL   Submitted (15-OCT-2008) to the INSDC.
RL   Contact:Kaoru Fukami-Kobayashi RIKEN, BioResource Center; 3-1-1 Koyadai,
RL   Tsukuba, Ibaraki 305-0074, Japan URL    :http://www.brc.riken.jp/
XX
RN   [2]
RX   DOI; 10.1093/dnares/dsp009.
RX   PUBMED; 19423640.
RA   Iida K., Fukami-Kobayashi K., Toyoda A., Sakaki Y., Kobayashi M., Seki M.,
RA   Shinozaki K.;
RT   "Analysis of multiple occurrences of alternative splicing events in
RT   Arabidopsis thaliana using novel sequenced full-length cDNAs";
RL   DNA Res. 16(3):155-164(2009).
XX
DR   MD5; d0176143f4329b1419685bce379f1d1e.
XX
CC   An Arabidopsis full-length cDNA library was constructed
CC   essentially as reported previously. (Seki et al. (1998) Plant J.
CC   15:707-720; Seki et al. (2002) Science 296:141-145)
CC   This clone is in a modified pBluescript vector.
CC   Please visit our web site (http://rarge.gsc.riken.jp/) for further
CC   details.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1221
FT                   /organism="Arabidopsis thaliana"
FT                   /chromosome="5"
FT                   /ecotype="Columbia"
FT                   /mol_type="mRNA"
FT                   /clone_lib="RAFL21"
FT                   /clone="RAFL21-69-O11"
FT                   /tissue_type="rosette leaf"
FT                   /note="treated with various stress (heat and UV), hormone
FT                   (ABA, auxin, ethylene, JA, SA, GA, and cytokinin), and BTH
FT                   treatments"
FT                   /db_xref="taxon:3702"
FT   CDS_pept        69..989
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /gene="AT5G03240"
FT                   /note="TAIR description: UBQ3 (POLYUBIQUITIN 3); protein
FT                   binding"
FT                   /note="alternative splicing: AT5G03240.3"
FT                   /db_xref="GOA:Q1EC66"
FT                   /db_xref="InterPro:IPR000626"
FT                   /db_xref="InterPro:IPR019954"
FT                   /db_xref="InterPro:IPR019956"
FT                   /db_xref="InterPro:IPR029071"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1EC66"
FT                   /protein_id="BAH19791.1"
FT                   /translation="MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF
FT                   AGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
FT                   KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
FT                   TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV
FT                   LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
FT                   RTLADYNIQKESTLHLVLRLRGGSF"
XX
SQ   Sequence 1221 BP; 350 A; 267 C; 268 G; 336 T; 0 other;
     catggtcaat ccagcttcta aattttgtcc tgattactaa gatatcgatt cgtagtgttt        60
     acatctgtat gcaaatcttc gtgaaaacac tcactggcaa gactatcact ctcgaggttg       120
     agagctctga caccatcgac aatgttaagg caaagattca ggacaaggaa ggcattcctc       180
     cggatcagca aagattaata ttcgccggta aacagctaga agatggccgt accttggccg       240
     attacaacat tcagaaagaa tcaacccttc atttggttct ccgtttaaga ggcggtatgc       300
     aaatctttgt caagactctg actggcaaga ccattacttt ggaggttgag agctctgaca       360
     ctattgacaa cgtcaaagca aagatccagg acaaggaagg aatccctccg gatcagcaga       420
     gacttatctt tgccggtaag cagcttgaag acggaagaac tcttgctgac tacaacattc       480
     aaaaggagtc gacccttcat ttggtgcttc gtctcagagg tggtatgcaa atctttgtca       540
     agaccctcac tggtaaaaca atcacccttg aggttgagag ttcagacacc attgacaatg       600
     tcaaagctaa gatccaagat aaagagggaa ttcctccgga tcagcagagg cttatctttg       660
     ccggtaagca gctcgaagat ggacgcaccc ttgcagatta caacatccaa aaggagtcga       720
     cacttcatct tgtgcttcgt ctccgtggtg gtatgcagat ctttgtgaag acccttaccg       780
     gaaagaccat tactctggag gttgaaagct cagacaccat cgataatgtc aaggctaaga       840
     ttcaggacaa ggaagggatc ccaccagacc aacagagact catcttcgct ggaaaacagc       900
     ttgaggatgg tcgcacactt gcagattaca acatccagaa ggagtcgact cttcacttgg       960
     ttcttcgtct tcgtggtgga agcttctaag ctttttgtga tctgatgata agtggttggt      1020
     tcgtgtctca tgcacttggg aggtgatcta tttcacctgg tgtagtttgt gtttccgtca      1080
     gttggaaaaa cttatcccta tcgatttcgt tttcattttc tgcttttctt ttatgtacct      1140
     tcgtttgggc ttgtaacggg cctttgtatt tcaactctca ataataatcc aagtgcatgt      1200
     taaacaaaaa aaaaaaaaaa a                                                1221
//

If you have problems or comments...

PBIL Back to PBIL home page