(data stored in ACNUC13479 zone)

EMBL: AK317276

ID   AK317276; SV 1; linear; mRNA; STD; PLN; 1110 BP.
XX
AC   AK317276;
XX
DT   04-FEB-2009 (Rel. 99, Created)
DT   21-APR-2009 (Rel. 100, Last updated, Version 2)
XX
DE   Arabidopsis thaliana AT5G05670 mRNA, complete cds, clone: RAFL21-65-B09.
XX
KW   CAP trapper; FLI_CDNA.
XX
OS   Arabidopsis thaliana (thale cress)
OC   Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
OC   Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae; Pentapetalae;
OC   rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis.
XX
RN   [1]
RP   1-1110
RA   Fukami-Kobayashi K., Iida K., Kobayashi M., Seki M., Ishida J.,
RA   Nakajima M., Kawashima M., Morosawa T., Toyoda A., Sakaki Y., Carninci P.,
RA   Kawai J., Hayashizaki Y., Shinozaki K.;
RT   ;
RL   Submitted (15-OCT-2008) to the INSDC.
RL   Contact:Kaoru Fukami-Kobayashi RIKEN, BioResource Center; 3-1-1 Koyadai,
RL   Tsukuba, Ibaraki 305-0074, Japan URL    :http://www.brc.riken.jp/
XX
RN   [2]
RX   DOI; 10.1093/dnares/dsp009.
RX   PUBMED; 19423640.
RA   Iida K., Fukami-Kobayashi K., Toyoda A., Sakaki Y., Kobayashi M., Seki M.,
RA   Shinozaki K.;
RT   "Analysis of multiple occurrences of alternative splicing events in
RT   Arabidopsis thaliana using novel sequenced full-length cDNAs";
RL   DNA Res. 16(3):155-164(2009).
XX
DR   MD5; 7e2301473bdf49091bf96aea6dec275a.
XX
CC   An Arabidopsis full-length cDNA library was constructed
CC   essentially as reported previously. (Seki et al. (1998) Plant J.
CC   15:707-720; Seki et al. (2002) Science 296:141-145)
CC   This clone is in a modified pBluescript vector.
CC   Please visit our web site (http://rarge.gsc.riken.jp/) for further
CC   details.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1110
FT                   /organism="Arabidopsis thaliana"
FT                   /chromosome="5"
FT                   /ecotype="Columbia"
FT                   /mol_type="mRNA"
FT                   /clone_lib="RAFL21"
FT                   /clone="RAFL21-65-B09"
FT                   /tissue_type="rosette leaf"
FT                   /note="treated with various stress (heat and UV), hormone
FT                   (ABA, auxin, ethylene, JA, SA, GA, and cytokinin), and BTH
FT                   treatments"
FT                   /db_xref="taxon:3702"
FT   CDS_pept        105..887
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /gene="AT5G05670"
FT                   /note="TAIR description: signal recognition particle
FT                   binding"
FT                   /note="alternative splicing: AT5G05670.1"
FT                   /db_xref="GOA:Q9FFK7"
FT                   /db_xref="InterPro:IPR019009"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q9FFK7"
FT                   /protein_id="BAH19952.1"
FT                   /translation="MENLEDLKILAEQWSHQGIEYLQKIPPNQLYAAIGVLLFTTILLF
FT                   LSIRLVRRTKSNTVLLSGLTGSGKTVLFYQLRDGSSHQGTVTSMEPNEGTFVLHSENTK
FT                   KGKIKPVHLVDVPGHSRLRPKLEEFLPQAAAIVFVVDALEFLPNCRAASEYLYEILTNA
FT                   NVVKKKIPVLLCCNKTDKLTAHTKEFIRKQMEKEIEKLRASRSAVSTADIANDFTIGIE
FT                   GEVFSFTHCSNKVTVAEASGLTGETIQIEDFIREYIKP"
XX
SQ   Sequence 1110 BP; 313 A; 241 C; 240 G; 316 T; 0 other;
     gtcgccgtgt tcttctccgc ttccaccgtc gttgtattcg tcttccgcct cctctcccat        60
     cggttttgaa cagcttggca gaagaagtga aacttgagag agtaatggag aacttggaag       120
     atctgaaaat tctggctgag cagtggtcgc atcaaggaat tgaatatctt cagaagatac       180
     caccgaatca gctgtatgcc gccattggtg ttttgttgtt tacaaccatc ttgctcttcc       240
     tatccattcg cctggtcaga cgtaccaaat ccaacactgt actcctttct gggctgaccg       300
     gaagtggaaa gactgtgctc ttttaccaac tccgagatgg atcgtcgcat cagggcactg       360
     taacatcaat ggaaccaaat gaaggcactt ttgttcttca cagtgaaaat actaagaaag       420
     gaaaaatcaa gcctgttcat cttgttgatg ttcctgggca ctctcggctt cgacccaagc       480
     tagaagaatt cttgccccaa gcagctgcca ttgtgttcgt agtggatgcc ttggagttcc       540
     tcccaaactg tcgtgcagct tcagagtacc tatacgagat tctgaccaat gcgaatgttg       600
     tcaagaagaa gattccagtc ctcctttgct gtaacaagac cgataaactc actgcacaca       660
     ccaaggagtt tatccggaag caaatggaga aagaaattga gaaactgagg gcttcaagga       720
     gtgcagtctc tactgctgat atagcgaatg acttcaccat tggaattgag ggagaagtgt       780
     tctccttcac gcattgctcc aacaaagtca ctgtcgctga ggcatctgga cttaccggag       840
     aaaccatcca gattgaagac ttcattcgag aatacatcaa gccatgagct ccaacatgcc       900
     ttcatagatt gaatctacca caagtttctt atgctttggg ctgtgacttt gatttgagtt       960
     tagagatcct tttgtatatg agatctttgg atgatttagg gtgttcaaaa ctgagtagct      1020
     gtattttcga gttagataat ctgttttaaa tcggaatgat tttaaggaaa tgttaaatga      1080
     cttaattctc ttacaaaaaa aaaaaaaaaa                                       1110
//

If you have problems or comments...

PBIL Back to PBIL home page