(data stored in ACNUC8465 zone)

EMBL: AK318824

ID   AK318824; SV 1; linear; mRNA; STD; PLN; 1490 BP.
XX
AC   AK318824;
XX
DT   21-APR-2009 (Rel. 100, Created)
DT   21-APR-2009 (Rel. 100, Last updated, Version 1)
XX
DE   Arabidopsis thaliana AT4G29810 mRNA, complete cds, clone: RAFL16-79-D23.
XX
KW   CAP trapper; FLI_CDNA.
XX
OS   Arabidopsis thaliana (thale cress)
OC   Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
OC   Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae; Pentapetalae;
OC   rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis.
XX
RN   [1]
RP   1-1490
RA   Fukami-Kobayashi K., Iida K., Kobayashi M., Seki M., Ishida J.,
RA   Nakajima M., Kawashima M., Morosawa T., Toyoda A., Sakaki Y., Carninci P.,
RA   Kawai J., Hayashizaki Y., Shinozaki K.;
RT   ;
RL   Submitted (05-NOV-2008) to the INSDC.
RL   Contact:Kaoru Fukami-Kobayashi RIKEN, BioResource Center; 3-1-1 Koyadai,
RL   Tsukuba, Ibaraki 305-0074, Japan URL    :http://www.brc.riken.jp/
XX
RN   [2]
RX   DOI; 10.1093/dnares/dsp009.
RX   PUBMED; 19423640.
RA   Iida K., Fukami-Kobayashi K., Toyoda A., Sakaki Y., Kobayashi M., Seki M.,
RA   Shinozaki K.;
RT   "Analysis of multiple occurrences of alternative splicing events in
RT   Arabidopsis thaliana using novel sequenced full-length cDNAs";
RL   DNA Res. 16(3):155-164(2009).
XX
DR   MD5; da1865aaed40bf4a5ed82919f33642d5.
XX
CC   An Arabidopsis full-length cDNA library was constructed
CC   essentially as reported previously. (Seki et al. (1998) Plant J.
CC   15:707-720; Seki et al. (2002) Science 296:141-145)
CC   This clone is in a modified pBluescript vector.
CC   Please visit our web site (http://rarge.gsc.riken.jp/) for further
CC   details.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1490
FT                   /organism="Arabidopsis thaliana"
FT                   /chromosome="4"
FT                   /ecotype="Columbia"
FT                   /mol_type="mRNA"
FT                   /clone_lib="RAFL16"
FT                   /clone="RAFL16-79-D23"
FT                   /note="dark-grown"
FT                   /db_xref="taxon:3702"
FT   CDS_pept        357..1133
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /gene="AT4G29810"
FT                   /note="alternative splicing: not found in TAIR7 gene
FT                   models"
FT                   /db_xref="GOA:C0Z2L0"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:C0Z2L0"
FT                   /protein_id="BAH56939.1"
FT                   /translation="MVKVIGKGSSGVVQLVQHKWTGQFFALKVIQLNIDEAIRKAIAQE
FT                   LKINQSSQCPNLVTSYQSFYDNGAISLILEYMDGGSLADFLKSVKAIPDSYLSAIFRQV
FT                   LQGLIYLHHDRHIIHRDLKPSNLLINHRGEVKITDFGVSTVMTNTAGLANTFVGTYNYM
FT                   SPERIVGNKYGNKSDIWSLGLVVLECATGKFPYAPPNQEETWTSVFELMEAIVDQPPPA
FT                   LPSGNFSPELSSFISTCLQKDPNSRSSAKELMVCFI"
XX
SQ   Sequence 1490 BP; 444 A; 294 C; 306 G; 446 T; 0 other;
     gaagcgaaga acgaagtaga cgaagacgat gaagaaaggt ggattcagca ataatctcaa        60
     gctcgcaatt cctgttgctg gcgagcaatc catcaccaaa ttcctgtatg tttctcgatc       120
     tctctttctc catggatctg tggatagata gatgtatttg tgtgtggaaa tgtctctggt       180
     tttgtttttg aaggaggaaa ggttttggtt ctctctgtag gactcaaagc ggtacgttta       240
     aggatggaga tctacgtgtt aacaaggatg gagttcgaat catttctcaa ttggagcctg       300
     aagtcctgtc tccaattaag ccagctgatg atcagctgag cttgtcggat ttggatatgg       360
     ttaaagtcat tggcaaagga agtagtggtg ttgttcagct ggttcaacac aaatggactg       420
     gccaattttt cgccttgaag gtcattcaac taaatattga tgaagcaatt cgcaaggcaa       480
     ttgcacaaga gctcaaaata aatcaatcgt cacagtgtcc aaatcttgtt acctcgtacc       540
     agtcatttta tgacaatggc gcaatctcac taatcttgga gtacatggac ggaggatctc       600
     tagcagactt tctcaagtca gttaaagcca tccctgactc ctatctttct gccatcttta       660
     gacaagtgct tcaaggatta atctatcttc atcacgatag gcatatcatc catcgtgact       720
     tgaaaccatc caatctgttg atcaaccaca gaggagaagt caaaataact gactttggtg       780
     tgagtaccgt tatgacaaac accgcaggtt tagcaaacac atttgtgggg acttacaatt       840
     atatgtctcc agagagaatc gttggaaaca agtacggaaa taaaagtgat atatggagct       900
     tgggtttagt agtactcgaa tgtgcaacag gaaagttccc ttatgcacct ccgaatcaag       960
     aggaaacatg gaccagtgtt ttcgagttga tggaagccat tgttgaccaa ccgccacccg      1020
     ctcttccttc aggaaatttc tcccctgagt tatcttcatt catctccaca tgtttgcaga      1080
     aggatccaaa cagtcgaagc tctgcaaagg aactgatggt ttgttttata taatcccttt      1140
     tgcatgtttt tcatccattg aaatgttgaa tcatactctg tgtcaaacaa tttcaggaac      1200
     atcctttctt gaacaaatac gactactcgg ggatcaatct cgcgtcctac ttcacagatg      1260
     caggatcgcc acttgcaaca cttgggaacc tgtctggtac gttctccgtg taaactacaa      1320
     gggagacata atatcaccat ctggttcctg ttatcatctg aagatttctt gttttacctt      1380
     ccagtgataa aatgatcttt ataatacata tagatatatt aaattgctgt attttaagat      1440
     tatagatata taaggtacat gagagtgttt atctaaaaaa aaaaaaaaaa                 1490
//

If you have problems or comments...

PBIL Back to PBIL home page