(data stored in ACNUC23119 zone)

EMBL: AK341215

ID   AK341215; SV 1; linear; mRNA; STD; INV; 1320 BP.
XX
AC   AK341215;
XX
DT   12-JUN-2009 (Rel. 101, Created)
DT   12-JUN-2009 (Rel. 101, Last updated, Version 1)
XX
DE   Acyrthosiphon pisum ACYPI006147 mRNA, clone: 262G1, complete cds,
DE   full-insert cDNA sequence based on the ESTs (5'-EST:EX645090,
DE   3'-EST:EX645235).
XX
KW   CAP trapper; FLI_CDNA.
XX
OS   Acyrthosiphon pisum (pea aphid)
OC   Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota;
OC   Neoptera; Paraneoptera; Hemiptera; Sternorrhyncha; Aphidomorpha;
OC   Aphidoidea; Aphididae; Macrosiphini; Acyrthosiphon.
XX
RN   [1]
RP   1-1320
RA   Shigenobu S., Nakabachi A., Richards S.;
RT   ;
RL   Submitted (09-JUN-2009) to the INSDC.
RL   Contact:Shuji Shigenobu National Institutes of Natural Sciences, Okazaki
RL   Institute for Integrative Bioscience; Higashiyama, Myodaiji, Okazaki, Aichi
RL   444-8787, Japan
XX
RN   [2]
RA   Shigenobu S., Nakabachi A., Richards S.;
RT   "A full-length cDNA resource of the pea aphid, Acyrthosiphon pisum";
RL   Unpublished.
XX
DR   MD5; a64234d190edfaaff7c7a193e4f7b493.
XX
CC   Pea aphid whole body normalized full-length cDNA library was
CC   constructed by Atsushi Nakabachi.
CC   Approximately 50,000 clones were sequenced from both ends at
CC   Baylor College Medicine as a part of the pea aphid genome project
CC   organized by International Aphid Genomics Consortium. The EST
CC   sequences have been deposited in GenBank (EX601480-EX654440,
CC   FF291997-FF339412).
CC   For each clone, the sequences of pair of 5'- and 3'-EST were
CC   assembled by CAP3. For 10,920 clones, the pair of ESTs were
CC   sufficient to recover the complete insert sequences. These
CC   full-insert sequences are deposited here.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1320
FT                   /organism="Acyrthosiphon pisum"
FT                   /strain="LSR1"
FT                   /mol_type="mRNA"
FT                   /sex="parthenogenetic female"
FT                   /dev_stage="mixed stage"
FT                   /clone_lib="Pea aphid whole body normalized full-length
FT                   cDNA library"
FT                   /clone="262G1"
FT                   /tissue_type="Whole body"
FT                   /note="Vector: pFLCIII"
FT                   /db_xref="taxon:7029"
FT   CDS_pept        225..707
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /gene="ACYPI006147"
FT                   /note="RefSeq transcript XM_001942687 PREDICTED:
FT                   Acyrthosiphon pisum similar to putative odorant-binding
FT                   protein (LOC100165186), mRNA"
FT                   /db_xref="UniProtKB/TrEMBL:C4WUT5"
FT                   /protein_id="BAH71655.1"
FT                   /translation="MKVSAATAVLVALVATVQSSDPCNISTCYKSGTTKPPMAVTPTHL
FT                   PVQSSSTQTSHPQTTYAKDHVHGSTTTKSGVNATVTTASGASVNGTEPPAVVKSSAGVT
FT                   GNSTTPKPTMTERHVALKQKLNTIAVKCKDELHAPQEIMALVSNTVVPQNEHKGAT"
XX
SQ   Sequence 1320 BP; 462 A; 283 C; 262 G; 313 T; 0 other;
     gagtcgaata cactcgtcga tagtcgtacc aggtgacttt atactgcagc gcgaagacca        60
     catagatcaa tattaccgtt tgtcgcgttt tagagttaat tataagggat acacgcgggc       120
     aagtttaaat ttcattaatt acaccgagca gtgcaatatc atagatatca tcggcgtcgt       180
     gcgagatcag ctcttcgtgc atacctagta cattcgtcga cattatgaag gtatctgcag       240
     cgaccgccgt cctggtcgct ctggtcgcca ccgtgcagag ctcggaccca tgtaacatat       300
     ctacttgcta caagagcggc acgacgaagc cgccaatggc cgttacgccc actcacctgc       360
     cggtacagtc atcgtccacc cagaccagcc acccacagac cacgtacgcc aaggatcacg       420
     tgcacggttc aaccaccacc aagtcgggtg tcaatgctac ggtcacgaca gccagcggag       480
     cgtccgtcaa cggcactgaa ccgccggccg tcgtcaagtc ttccgccgga gtaaccggaa       540
     actccaccac gcccaagcct acaatgaccg aaagacatgt ggctctgaaa cagaagttga       600
     acacaattgc ggtgaagtgc aaggacgagc tgcacgcgcc ccaagagatc atggcactgg       660
     tcagtaacac ggtagtaccg cagaacgagc acaaaggtgc tacttagagt gcgtgtacaa       720
     aatcttaatt tgatcaaaaa ataacaagtt cagtgtggaa gacggcaagg cgatggctag       780
     aatacgcttc gcaaatcaac cagaagagca caagaaggca gtaaccataa tagaaacttg       840
     cgaaaaagaa gctgttatcg atccgaaaac cactgaaaaa tgcgcagctg gacgagtaat       900
     cagaaactgc ttcgtcaaaa acggagaaaa aataaatttc ttccctaaag cataagtctt       960
     gatatgtgga cggaaaatgg aaagaatgag tttgaaaatt tcaatcaaac atggatatac      1020
     taaaaatacc tatattatgt aatattaaat tatttaagtt atgattttta cgaataaaac      1080
     ataaaaaaaa cttaattcag tatttatttt attagcatcc atcataaaaa tattttgatt      1140
     tagaacatgt taaaaactac agaatgtcaa aaataatata ctattagtat gtacacatta      1200
     aaattatatt ttttaatgaa taggtatata ttataaatca cagtttagtg tggacttatt      1260
     tttatataga aaagaaatat atcaacttca ccaatgtaaa aattaaaaaa aaaaaaaaaa      1320
//

If you have problems or comments...

PBIL Back to PBIL home page