(data stored in ACNUC7421 zone)

EMBL: AL009126

ID   AL009126; SV 3; circular; genomic DNA; STD; PRO; 4215606 BP.
XX
AC   AL009126; Z99104-Z99124;
XX
PR   Project:PRJNA76;
XX
DT   18-JUL-2002 (Rel. 72, Created)
DT   08-FEB-2018 (Rel. 135, Last updated, Version 14)
XX
DE   Bacillus subtilis subsp. subtilis str. 168 complete genome.
XX
KW   complete genome.
XX
OS   Bacillus subtilis subsp. subtilis str. 168
OC   Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Bacillus.
XX
RN   [1]
RP   1-4215606
RX   DOI; 10.1038/36786.
RX   PUBMED; 9384377.
RA   Kunst F., Ogasawara N., Moszer I., Albertini A.M., Alloni G., Azevedo V.,
RA   Bertero M.G., Bessieres P., Bolotin A., Borchert S., Borriss R.,
RA   Boursier L., Brans A., Braun M., Brignell S.C., Bron S., Brouillet S.,
RA   Bruschi C.V., Caldwell B., Capuano V., Carter N.M., Choi S.K., Codani J.J.,
RA   Connerton I.F., Cummings N.J., Daniel R.A., Denizot F., Devine K.M.,
RA   Dusterhoft A., Ehrlich S.D., Emmerson P.T., Entian K.D., Errington J.,
RA   Fabret C., Ferrari E., Foulger D., Fritz C., Fujita M., Fujita Y., Fuma S.,
RA   Galizzi A., Galleron N., Ghim S.Y., Glaser P., Goffeau A., Golightly E.J.,
RA   Grandi G., Guiseppi G., Guy B.J., Haga K., Haiech J., Harwood C.R.,
RA   Henaut A., Hilbert H., Holsappel S., Hosono S., Hullo M.F., Itaya M.,
RA   Jones L., Joris B., Karamata D., Kasahara Y., Klaerr-Blanchard M.,
RA   Klein C., Kobayashi Y., Koetter P., Koningstein G., Krogh S., Kumano M.,
RA   Kurita K., Lapidus A., Lardinois S., Lauber J., Lazarevic V., Lee S.M.,
RA   Levine A., Liu H., Masuda S., Mauel C., Medigue C., Medina N.,
RA   Mellado R.P., Mizuno M., Moestl D., Nakai S., Noback M., Noone D.,
RA   O'Reilly M., Ogawa K., Ogiwara A., Oudega B., Park S.H., Parro V.,
RA   Pohl T.M., Portetelle D., Porwollik S., Prescott A.M., Presecan E.,
RA   Pujic P., Purnelle B., Rapoport G., Rey M., Reynolds S., Rieger M.,
RA   Rivolta C., Rocha E., Roche B., Rose M., Sadaie Y., Sato T., Scanlan E.,
RA   Schleich S., Schroeter R., Scoffone F., Sekiguchi J., Sekowska A.,
RA   Seror S.J., Serror P., Shin B.S., Soldo B., Sorokin A., Tacconi E.,
RA   Takagi T., Takahashi H., Takemaru K., Takeuchi M., Tamakoshi A., Tanaka T.,
RA   Terpstra P., Tognoni A., Tosato V., Uchiyama S., Vandenbol M., Vannier F.,
RA   Vassarotti A., Viari A., Wambutt R., Wedler E., Wedler H., Weitzenegger T.,
RA   Winters P., Wipat A., Yamamoto H., Yamane K., Yasumoto K., Yata K.,
RA   Yoshida K., Yoshikawa H.F., Zumstein E., Yoshikawa H., Danchin A.;
RT   "The complete genome sequence of the gram-positive bacterium Bacillus
RT   subtilis";
RL   Nature 390(6657):249-256(1997).
XX
RN   [2]
RP   1-4215606
RX   DOI; .1099/mic.0.027839-0.
RX   PUBMED; 19383706.
RA   Barbe V., Cruveiller S., Kunst F., Lenoble P., Meurice G., Sekowska A.,
RA   Vallenet D., Wang T., Moszer I., Medigue C., Danchin A.;
RT   "From a consortium sequence to a unified sequence: the Bacillus subtilis
RT   168 reference genome a decade later";
RL   Microbiology (Reading, Engl.) 155(Pt 6):1758-1775(2009).
XX
RN   [3]
RP   1-4215606
RX   DOI; 10.1099/mic.0.064691-0.
RX   PUBMED; 23429746.
RA   Belda E., Sekowska A., Le Fevre F., Mornico D., Morgat A., Ouzounis C.,
RA   Vallenet D., Medigue C., Danchin A.;
RT   "An updated metabolic view of the Bacillus subtilis 168 genome";
RL   Microbiology (Reading, Engl.) 159(Pt 4):757-770(2013).
XX
RN   [4]
RP   1-4215606
RA   Kunst F., Ogasawara N., Yoshikawa H., Danchin A.;
RT   ;
RL   Submitted (18-NOV-1997) to the INSDC.
RL   I. Moszer, A. Danchin, Genetique des Genomes Bacteriens, Institut Pasteur,
RL   28 rue du Docteur Roux, 75724 Paris Cedex 15, FRANCE. E-mail:
RL   moszer@pasteur.fr, antoine.danchin@normalesup.org Phone: +33 (0)1 45 68 84
RL   41, Fax: +33 (0)1 45 68 89 48
XX
RN   [5]
RP   1-4215606
RG   Institut Pasteur and Genoscope
RA   Genoscope - C.E.A.;
RT   ;
RL   Submitted (29-JAN-2009) to the INSDC.
RL   Genoscope - Centre National de Sequencage : BP 191 91006 EVRY cedex -
RL   FRANCE (E-mail : seqref@genoscope.cns.fr - Web : www.genoscope.cns.fr)
XX
RN   [6]
RP   1-4215606
RG   AMAbiotics and Genoscope
RA   Genoscope - C.E.A.;
RT   ;
RL   Submitted (24-JAN-2013) to the INSDC.
RL   A. Danchin, AMAbiotics, Bldg G1, 2, rue Gaston Cremieux, 91000 EVRY
RL   antoine.danchin@normalesup.org Bldg G1 Genoscope / CEA (Commissariat a
RL   l'energie atomique et aux energies alternatives): BP 191 91006 EVRY cedex -
RL   FRANCE (E-mail: seqref@genoscope.cns.fr - Web: www.genoscope.cns.fr)
XX
RN   [8]
RX   DOI; .1111/1751-7915.13043.
RX   PUBMED; 29280348.
RA   Borriss R., Danchin A., Harwood C.R., Medigue C., Rocha E.P.C.,
RA   Sekowska A., Vallenet D.;
RT   "Bacillus subtilis, the model Gram-positive bacterium: 20 years of
RT   annotation refinement";
RL   Microb Biotechnol 11(1):3-17(2018).
XX
DR   MD5; 4b9805db31f5e137ab05929cdb198c35.
DR   BioSample; SAMEA3138188.
DR   EnsemblGenomes-Gn; BSU03569.
DR   EnsemblGenomes-Gn; BSU03570.
DR   EnsemblGenomes-Gn; BSU05343.
DR   EnsemblGenomes-Gn; BSU05344.
DR   EnsemblGenomes-Gn; BSU05890.
DR   EnsemblGenomes-Gn; BSU05899.
DR   EnsemblGenomes-Gn; BSU06033.
DR   EnsemblGenomes-Gn; BSU06034.
DR   EnsemblGenomes-Gn; BSU06036.
DR   EnsemblGenomes-Gn; BSU06037.
DR   EnsemblGenomes-Gn; BSU06038.
DR   EnsemblGenomes-Gn; BSU06049.
DR   EnsemblGenomes-Gn; BSU06073.
DR   EnsemblGenomes-Gn; BSU06074.
DR   EnsemblGenomes-Gn; BSU06076.
DR   EnsemblGenomes-Gn; BSU06077.
DR   EnsemblGenomes-Gn; BSU06078.
DR   EnsemblGenomes-Gn; BSU06079.
DR   EnsemblGenomes-Gn; BSU06083.
DR   EnsemblGenomes-Gn; BSU07170.
DR   EnsemblGenomes-Gn; BSU07180.
DR   EnsemblGenomes-Gn; BSU09259.
DR   EnsemblGenomes-Gn; BSU11381.
DR   EnsemblGenomes-Gn; BSU11382.
DR   EnsemblGenomes-Gn; BSU16890.
DR   EnsemblGenomes-Gn; BSU16900.
DR   EnsemblGenomes-Gn; BSU17266.
DR   EnsemblGenomes-Gn; BSU17267.
DR   EnsemblGenomes-Gn; BSU17678.
DR   EnsemblGenomes-Gn; BSU18819.
DR   EnsemblGenomes-Gn; BSU18909.
DR   EnsemblGenomes-Gn; BSU18979.
DR   EnsemblGenomes-Gn; BSU19810.
DR   EnsemblGenomes-Gn; BSU21598.
DR   EnsemblGenomes-Gn; BSU21599.
DR   EnsemblGenomes-Gn; BSU21670.
DR   EnsemblGenomes-Gn; BSU22660.
DR   EnsemblGenomes-Gn; BSU23329.
DR   EnsemblGenomes-Gn; BSU23330.
DR   EnsemblGenomes-Gn; BSU23836.
DR   EnsemblGenomes-Gn; BSU23837.
DR   EnsemblGenomes-Gn; BSU25760.
DR   EnsemblGenomes-Gn; BSU26039.
DR   EnsemblGenomes-Gn; BSU26040.
DR   EnsemblGenomes-Gn; BSU26390.
DR   EnsemblGenomes-Gn; BSU26558.
DR   EnsemblGenomes-Gn; BSU26559.
DR   EnsemblGenomes-Gn; BSU26748.
DR   EnsemblGenomes-Gn; BSU26749.
DR   EnsemblGenomes-Gn; BSU26750.
DR   EnsemblGenomes-Gn; BSU32960.
DR   EnsemblGenomes-Gn; BSU32970.
DR   EnsemblGenomes-Gn; BSU35230.
DR   EnsemblGenomes-Gn; BSU35239.
DR   EnsemblGenomes-Gn; BSU35609.
DR   EnsemblGenomes-Gn; BSU35610.
DR   EnsemblGenomes-Gn; BSU35679.
DR   EnsemblGenomes-Gn; BSU35698.
DR   EnsemblGenomes-Gn; BSU35699.
DR   EnsemblGenomes-Gn; BSU36499.
DR   EnsemblGenomes-Gn; BSU36668.
DR   EnsemblGenomes-Gn; BSU36669.
DR   EnsemblGenomes-Gn; BSU39029.
DR   EnsemblGenomes-Gn; BSU39030.
DR   EnsemblGenomes-Gn; BSU39129.
DR   EnsemblGenomes-Gn; BSU40359.
DR   EnsemblGenomes-Gn; BSU40573.
DR   EnsemblGenomes-Gn; BSU40574.
DR   EnsemblGenomes-Gn; BSU40578.
DR   EnsemblGenomes-Gn; BSU40579.
DR   EnsemblGenomes-Gn; BSU_rRNA_1.
DR   EnsemblGenomes-Gn; BSU_rRNA_10.
DR   EnsemblGenomes-Gn; BSU_rRNA_11.
DR   EnsemblGenomes-Gn; BSU_rRNA_12.
DR   EnsemblGenomes-Gn; BSU_rRNA_13.
DR   EnsemblGenomes-Gn; BSU_rRNA_14.
DR   EnsemblGenomes-Gn; BSU_rRNA_15.
DR   EnsemblGenomes-Gn; BSU_rRNA_16.
DR   EnsemblGenomes-Gn; BSU_rRNA_17.
DR   EnsemblGenomes-Gn; BSU_rRNA_18.
DR   EnsemblGenomes-Gn; BSU_rRNA_19.
DR   EnsemblGenomes-Gn; BSU_rRNA_2.
DR   EnsemblGenomes-Gn; BSU_rRNA_20.
DR   EnsemblGenomes-Gn; BSU_rRNA_21.
DR   EnsemblGenomes-Gn; BSU_rRNA_22.
DR   EnsemblGenomes-Gn; BSU_rRNA_23.
DR   EnsemblGenomes-Gn; BSU_rRNA_24.
DR   EnsemblGenomes-Gn; BSU_rRNA_25.
DR   EnsemblGenomes-Gn; BSU_rRNA_26.
DR   EnsemblGenomes-Gn; BSU_rRNA_27.
DR   EnsemblGenomes-Gn; BSU_rRNA_28.
DR   EnsemblGenomes-Gn; BSU_rRNA_29.
DR   EnsemblGenomes-Gn; BSU_rRNA_3.
DR   EnsemblGenomes-Gn; BSU_rRNA_30.
DR   EnsemblGenomes-Gn; BSU_rRNA_4.
DR   EnsemblGenomes-Gn; BSU_rRNA_5.
DR   EnsemblGenomes-Gn; BSU_rRNA_6.
DR   EnsemblGenomes-Gn; BSU_rRNA_7.
DR   EnsemblGenomes-Gn; BSU_rRNA_8.
DR   EnsemblGenomes-Gn; BSU_rRNA_9.
DR   EnsemblGenomes-Gn; BSU_tRNA_1.
DR   EnsemblGenomes-Gn; BSU_tRNA_10.
DR   EnsemblGenomes-Gn; BSU_tRNA_11.
DR   EnsemblGenomes-Gn; BSU_tRNA_12.
DR   EnsemblGenomes-Gn; BSU_tRNA_13.
DR   EnsemblGenomes-Gn; BSU_tRNA_14.
DR   EnsemblGenomes-Gn; BSU_tRNA_15.
DR   EnsemblGenomes-Gn; BSU_tRNA_16.
DR   EnsemblGenomes-Gn; BSU_tRNA_17.
DR   EnsemblGenomes-Gn; BSU_tRNA_18.
DR   EnsemblGenomes-Gn; BSU_tRNA_19.
DR   EnsemblGenomes-Gn; BSU_tRNA_2.
DR   EnsemblGenomes-Gn; BSU_tRNA_20.
DR   EnsemblGenomes-Gn; BSU_tRNA_21.
DR   EnsemblGenomes-Gn; BSU_tRNA_22.
DR   EnsemblGenomes-Gn; BSU_tRNA_23.
DR   EnsemblGenomes-Gn; BSU_tRNA_24.
DR   EnsemblGenomes-Gn; BSU_tRNA_25.
DR   EnsemblGenomes-Gn; BSU_tRNA_26.
DR   EnsemblGenomes-Gn; BSU_tRNA_27.
DR   EnsemblGenomes-Gn; BSU_tRNA_28.
DR   EnsemblGenomes-Gn; BSU_tRNA_29.
DR   EnsemblGenomes-Gn; BSU_tRNA_3.
DR   EnsemblGenomes-Gn; BSU_tRNA_30.
DR   EnsemblGenomes-Gn; BSU_tRNA_31.
DR   EnsemblGenomes-Gn; BSU_tRNA_32.
DR   EnsemblGenomes-Gn; BSU_tRNA_33.
DR   EnsemblGenomes-Gn; BSU_tRNA_34.
DR   EnsemblGenomes-Gn; BSU_tRNA_35.
DR   EnsemblGenomes-Gn; BSU_tRNA_36.
DR   EnsemblGenomes-Gn; BSU_tRNA_37.
DR   EnsemblGenomes-Gn; BSU_tRNA_38.
DR   EnsemblGenomes-Gn; BSU_tRNA_39.
DR   EnsemblGenomes-Gn; BSU_tRNA_4.
DR   EnsemblGenomes-Gn; BSU_tRNA_40.
DR   EnsemblGenomes-Gn; BSU_tRNA_41.
DR   EnsemblGenomes-Gn; BSU_tRNA_42.
DR   EnsemblGenomes-Gn; BSU_tRNA_43.
DR   EnsemblGenomes-Gn; BSU_tRNA_44.
DR   EnsemblGenomes-Gn; BSU_tRNA_45.
DR   EnsemblGenomes-Gn; BSU_tRNA_46.
DR   EnsemblGenomes-Gn; BSU_tRNA_47.
DR   EnsemblGenomes-Gn; BSU_tRNA_48.
DR   EnsemblGenomes-Gn; BSU_tRNA_49.
DR   EnsemblGenomes-Gn; BSU_tRNA_5.
DR   EnsemblGenomes-Gn; BSU_tRNA_50.
DR   EnsemblGenomes-Gn; BSU_tRNA_51.
DR   EnsemblGenomes-Gn; BSU_tRNA_52.
DR   EnsemblGenomes-Gn; BSU_tRNA_53.
DR   EnsemblGenomes-Gn; BSU_tRNA_54.
DR   EnsemblGenomes-Gn; BSU_tRNA_55.
DR   EnsemblGenomes-Gn; BSU_tRNA_56.
DR   EnsemblGenomes-Gn; BSU_tRNA_57.
DR   EnsemblGenomes-Gn; BSU_tRNA_58.
DR   EnsemblGenomes-Gn; BSU_tRNA_59.
DR   EnsemblGenomes-Gn; BSU_tRNA_6.
DR   EnsemblGenomes-Gn; BSU_tRNA_60.
DR   EnsemblGenomes-Gn; BSU_tRNA_61.
DR   EnsemblGenomes-Gn; BSU_tRNA_62.
DR   EnsemblGenomes-Gn; BSU_tRNA_63.
DR   EnsemblGenomes-Gn; BSU_tRNA_64.
DR   EnsemblGenomes-Gn; BSU_tRNA_65.
DR   EnsemblGenomes-Gn; BSU_tRNA_66.
DR   EnsemblGenomes-Gn; BSU_tRNA_67.
DR   EnsemblGenomes-Gn; BSU_tRNA_68.
DR   EnsemblGenomes-Gn; BSU_tRNA_69.
DR   EnsemblGenomes-Gn; BSU_tRNA_7.
DR   EnsemblGenomes-Gn; BSU_tRNA_70.
DR   EnsemblGenomes-Gn; BSU_tRNA_71.
DR   EnsemblGenomes-Gn; BSU_tRNA_72.
DR   EnsemblGenomes-Gn; BSU_tRNA_73.
DR   EnsemblGenomes-Gn; BSU_tRNA_74.
DR   EnsemblGenomes-Gn; BSU_tRNA_75.
DR   EnsemblGenomes-Gn; BSU_tRNA_76.
DR   EnsemblGenomes-Gn; BSU_tRNA_77.
DR   EnsemblGenomes-Gn; BSU_tRNA_78.
DR   EnsemblGenomes-Gn; BSU_tRNA_79.
DR   EnsemblGenomes-Gn; BSU_tRNA_8.
DR   EnsemblGenomes-Gn; BSU_tRNA_80.
DR   EnsemblGenomes-Gn; BSU_tRNA_81.
DR   EnsemblGenomes-Gn; BSU_tRNA_82.
DR   EnsemblGenomes-Gn; BSU_tRNA_83.
DR   EnsemblGenomes-Gn; BSU_tRNA_84.
DR   EnsemblGenomes-Gn; BSU_tRNA_85.
DR   EnsemblGenomes-Gn; BSU_tRNA_86.
DR   EnsemblGenomes-Gn; BSU_tRNA_9.
DR   EnsemblGenomes-Gn; EBG00000977859.
DR   EnsemblGenomes-Gn; EBG00000977860.
DR   EnsemblGenomes-Gn; EBG00000977861.
DR   EnsemblGenomes-Gn; EBG00000977862.
DR   EnsemblGenomes-Gn; EBG00000977863.
DR   EnsemblGenomes-Gn; EBG00000977864.
DR   EnsemblGenomes-Gn; EBG00000977865.
DR   EnsemblGenomes-Gn; EBG00000977866.
DR   EnsemblGenomes-Gn; EBG00000977867.
DR   EnsemblGenomes-Gn; EBG00000977868.
DR   EnsemblGenomes-Gn; EBG00000977869.
DR   EnsemblGenomes-Gn; EBG00000977870.
DR   EnsemblGenomes-Gn; EBG00000977871.
DR   EnsemblGenomes-Gn; EBG00000977872.
DR   EnsemblGenomes-Gn; EBG00000977873.
DR   EnsemblGenomes-Gn; EBG00000977874.
DR   EnsemblGenomes-Gn; EBG00000977875.
DR   EnsemblGenomes-Gn; EBG00000977876.
DR   EnsemblGenomes-Gn; EBG00000977877.
DR   EnsemblGenomes-Gn; EBG00000977878.
DR   EnsemblGenomes-Gn; EBG00000977879.
DR   EnsemblGenomes-Gn; EBG00000977880.
DR   EnsemblGenomes-Gn; EBG00000977881.
DR   EnsemblGenomes-Gn; EBG00000977882.
DR   EnsemblGenomes-Gn; EBG00000977883.
DR   EnsemblGenomes-Gn; EBG00000977884.
DR   EnsemblGenomes-Gn; EBG00000977885.
DR   EnsemblGenomes-Gn; EBG00000977886.
DR   EnsemblGenomes-Gn; EBG00000977887.
DR   EnsemblGenomes-Gn; EBG00000977888.
DR   EnsemblGenomes-Gn; EBG00000977889.
DR   EnsemblGenomes-Gn; EBG00000977890.
DR   EnsemblGenomes-Gn; EBG00000977891.
DR   EnsemblGenomes-Gn; EBG00000977892.
DR   EnsemblGenomes-Gn; EBG00000977893.
DR   EnsemblGenomes-Gn; EBG00000977894.
DR   EnsemblGenomes-Gn; EBG00000977895.
DR   EnsemblGenomes-Gn; EBG00000977896.
DR   EnsemblGenomes-Gn; EBG00000977897.
DR   EnsemblGenomes-Gn; EBG00000977898.
DR   EnsemblGenomes-Gn; EBG00000977899.
DR   EnsemblGenomes-Gn; EBG00000977900.
DR   EnsemblGenomes-Gn; EBG00000977901.
DR   EnsemblGenomes-Gn; EBG00000977902.
DR   EnsemblGenomes-Gn; EBG00000977903.
DR   EnsemblGenomes-Gn; EBG00000977904.
DR   EnsemblGenomes-Gn; EBG00000977905.
DR   EnsemblGenomes-Gn; EBG00000977906.
DR   EnsemblGenomes-Gn; EBG00000977907.
DR   EnsemblGenomes-Gn; EBG00000977908.
DR   EnsemblGenomes-Gn; EBG00000977909.
DR   EnsemblGenomes-Gn; EBG00000977910.
DR   EnsemblGenomes-Gn; EBG00000977911.
DR   EnsemblGenomes-Gn; EBG00000977912.
DR   EnsemblGenomes-Gn; EBG00000977913.
DR   EnsemblGenomes-Gn; EBG00000977914.
DR   EnsemblGenomes-Gn; EBG00000977915.
DR   EnsemblGenomes-Gn; EBG00000977916.
DR   EnsemblGenomes-Gn; EBG00000977917.
DR   EnsemblGenomes-Gn; EBG00000977918.
DR   EnsemblGenomes-Gn; EBG00000977919.
DR   EnsemblGenomes-Gn; EBG00000977920.
DR   EnsemblGenomes-Gn; EBG00000977921.
DR   EnsemblGenomes-Gn; EBG00000977922.
DR   EnsemblGenomes-Gn; EBG00000977923.
DR   EnsemblGenomes-Gn; EBG00000977924.
DR   EnsemblGenomes-Gn; EBG00000977925.
DR   EnsemblGenomes-Gn; EBG00000977926.
DR   EnsemblGenomes-Gn; EBG00000977927.
DR   EnsemblGenomes-Gn; EBG00000977928.
DR   EnsemblGenomes-Gn; EBG00000977929.
DR   EnsemblGenomes-Gn; EBG00000977930.
DR   EnsemblGenomes-Gn; EBG00000977931.
DR   EnsemblGenomes-Gn; EBG00000977932.
DR   EnsemblGenomes-Gn; EBG00000977933.
DR   EnsemblGenomes-Gn; EBG00000977934.
DR   EnsemblGenomes-Gn; EBG00000977935.
DR   EnsemblGenomes-Gn; EBG00000977936.
DR   EnsemblGenomes-Gn; EBG00000977937.
DR   EnsemblGenomes-Gn; EBG00000977938.
DR   EnsemblGenomes-Gn; EBG00000977939.
DR   EnsemblGenomes-Gn; EBG00000977940.
DR   EnsemblGenomes-Gn; EBG00000977941.
DR   EnsemblGenomes-Gn; EBG00000977942.
DR   EnsemblGenomes-Gn; EBG00000977943.
DR   EnsemblGenomes-Gn; EBG00000977944.
DR   EnsemblGenomes-Gn; EBG00000977945.
DR   EnsemblGenomes-Gn; EBG00000977946.
DR   EnsemblGenomes-Gn; EBG00000977947.
DR   EnsemblGenomes-Gn; EBG00000977948.
DR   EnsemblGenomes-Gn; EBG00000977949.
DR   EnsemblGenomes-Gn; EBG00000977950.
DR   EnsemblGenomes-Gn; EBG00000977951.
DR   EnsemblGenomes-Gn; EBG00000977952.
DR   EnsemblGenomes-Gn; EBG00000977953.
DR   EnsemblGenomes-Gn; EBG00000977954.
DR   EnsemblGenomes-Gn; EBG00000977955.
DR   EnsemblGenomes-Gn; EBG00000977956.
DR   EnsemblGenomes-Gn; EBG00000977957.
DR   EnsemblGenomes-Gn; EBG00000977958.
DR   EnsemblGenomes-Gn; EBG00000977959.
DR   EnsemblGenomes-Gn; EBG00000977960.
DR   EnsemblGenomes-Gn; EBG00000977961.
DR   EnsemblGenomes-Gn; EBG00000977962.
DR   EnsemblGenomes-Gn; EBG00000977963.
DR   EnsemblGenomes-Gn; EBG00000977964.
DR   EnsemblGenomes-Gn; EBG00000977965.
DR   EnsemblGenomes-Gn; EBG00000977966.
DR   EnsemblGenomes-Gn; EBG00000977967.
DR   EnsemblGenomes-Gn; EBG00000977968.
DR   EnsemblGenomes-Gn; EBG00000977969.
DR   EnsemblGenomes-Gn; EBG00000977970.
DR   EnsemblGenomes-Gn; EBG00000977971.
DR   EnsemblGenomes-Gn; EBG00000977972.
DR   EnsemblGenomes-Gn; EBG00000977973.
DR   EnsemblGenomes-Gn; EBG00000977974.
DR   EnsemblGenomes-Gn; EBG00000977975.
DR   EnsemblGenomes-Gn; EBG00000977976.
DR   EnsemblGenomes-Gn; EBG00000977977.
DR   EnsemblGenomes-Gn; EBG00000977978.
DR   EnsemblGenomes-Gn; EBG00000977979.
DR   EnsemblGenomes-Gn; EBG00000977980.
DR   EnsemblGenomes-Gn; EBG00000977981.
DR   EnsemblGenomes-Gn; EBG00000977982.
DR   EnsemblGenomes-Gn; EBG00000977983.
DR   EnsemblGenomes-Gn; EBG00000977984.
DR   EnsemblGenomes-Gn; EBG00000977985.
DR   EnsemblGenomes-Gn; EBG00000977986.
DR   EnsemblGenomes-Gn; EBG00000977987.
DR   EnsemblGenomes-Gn; EBG00000977988.
DR   EnsemblGenomes-Gn; EBG00000977989.
DR   EnsemblGenomes-Gn; EBG00000977990.
DR   EnsemblGenomes-Gn; EBG00000977991.
DR   EnsemblGenomes-Gn; EBG00000977992.
DR   EnsemblGenomes-Gn; EBG00000977993.
DR   EnsemblGenomes-Gn; EBG00000977994.
DR   EnsemblGenomes-Gn; EBG00000977995.
DR   EnsemblGenomes-Gn; EBG00000977996.
DR   EnsemblGenomes-Gn; EBG00000977997.
DR   EnsemblGenomes-Gn; EBG00000977998.
DR   EnsemblGenomes-Gn; EBG00000977999.
DR   EnsemblGenomes-Gn; EBG00000978000.
DR   EnsemblGenomes-Gn; EBG00000978001.
DR   EnsemblGenomes-Gn; EBG00000978002.
DR   EnsemblGenomes-Gn; EBG00000978003.
DR   EnsemblGenomes-Gn; EBG00000978004.
DR   EnsemblGenomes-Gn; EBG00000978005.
DR   EnsemblGenomes-Gn; EBG00000978006.
DR   EnsemblGenomes-Gn; EBG00000978007.
DR   EnsemblGenomes-Gn; EBG00000978008.
DR   EnsemblGenomes-Gn; EBG00000978009.
DR   EnsemblGenomes-Gn; EBG00000978010.
DR   EnsemblGenomes-Gn; EBG00000978011.
DR   EnsemblGenomes-Gn; EBG00000978012.
DR   EnsemblGenomes-Gn; EBG00000978013.
DR   EnsemblGenomes-Gn; EBG00000978014.
DR   EnsemblGenomes-Gn; EBG00000978015.
DR   EnsemblGenomes-Gn; EBG00000978016.
DR   EnsemblGenomes-Gn; EBG00000978017.
DR   EnsemblGenomes-Gn; EBG00000978018.
DR   EnsemblGenomes-Gn; EBG00000978019.
DR   EnsemblGenomes-Gn; EBG00000978020.
DR   EnsemblGenomes-Gn; EBG00000978021.
DR   EnsemblGenomes-Gn; EBG00000978022.
DR   EnsemblGenomes-Gn; EBG00000978023.
DR   EnsemblGenomes-Gn; EBG00000978024.
DR   EnsemblGenomes-Gn; EBG00000978025.
DR   EnsemblGenomes-Gn; EBG00000978026.
DR   EnsemblGenomes-Gn; EBG00000978027.
DR   EnsemblGenomes-Gn; EBG00000978028.
DR   EnsemblGenomes-Gn; EBG00000978029.
DR   EnsemblGenomes-Gn; EBG00000978030.
DR   EnsemblGenomes-Gn; EBG00000978031.
DR   EnsemblGenomes-Tr; BSU03569.
DR   EnsemblGenomes-Tr; BSU03570.
DR   EnsemblGenomes-Tr; BSU05343.
DR   EnsemblGenomes-Tr; BSU05344.
DR   EnsemblGenomes-Tr; BSU05890.
DR   EnsemblGenomes-Tr; BSU05899.
DR   EnsemblGenomes-Tr; BSU06033.
DR   EnsemblGenomes-Tr; BSU06034.
DR   EnsemblGenomes-Tr; BSU06036.
DR   EnsemblGenomes-Tr; BSU06037.
DR   EnsemblGenomes-Tr; BSU06038.
DR   EnsemblGenomes-Tr; BSU06049.
DR   EnsemblGenomes-Tr; BSU06073.
DR   EnsemblGenomes-Tr; BSU06074.
DR   EnsemblGenomes-Tr; BSU06076.
DR   EnsemblGenomes-Tr; BSU06077.
DR   EnsemblGenomes-Tr; BSU06078.
DR   EnsemblGenomes-Tr; BSU06079.
DR   EnsemblGenomes-Tr; BSU06083.
DR   EnsemblGenomes-Tr; BSU07170.
DR   EnsemblGenomes-Tr; BSU07180.
DR   EnsemblGenomes-Tr; BSU09259.
DR   EnsemblGenomes-Tr; BSU11381.
DR   EnsemblGenomes-Tr; BSU11382.
DR   EnsemblGenomes-Tr; BSU16890.
DR   EnsemblGenomes-Tr; BSU16900.
DR   EnsemblGenomes-Tr; BSU17266.
DR   EnsemblGenomes-Tr; BSU17267.
DR   EnsemblGenomes-Tr; BSU17678.
DR   EnsemblGenomes-Tr; BSU18819.
DR   EnsemblGenomes-Tr; BSU18909.
DR   EnsemblGenomes-Tr; BSU18979.
DR   EnsemblGenomes-Tr; BSU19810.
DR   EnsemblGenomes-Tr; BSU21598.
DR   EnsemblGenomes-Tr; BSU21599.
DR   EnsemblGenomes-Tr; BSU21670.
DR   EnsemblGenomes-Tr; BSU22660.
DR   EnsemblGenomes-Tr; BSU23329.
DR   EnsemblGenomes-Tr; BSU23330.
DR   EnsemblGenomes-Tr; BSU23836.
DR   EnsemblGenomes-Tr; BSU23837.
DR   EnsemblGenomes-Tr; BSU25760.
DR   EnsemblGenomes-Tr; BSU26039.
DR   EnsemblGenomes-Tr; BSU26040.
DR   EnsemblGenomes-Tr; BSU26390.
DR   EnsemblGenomes-Tr; BSU26558.
DR   EnsemblGenomes-Tr; BSU26559.
DR   EnsemblGenomes-Tr; BSU26748.
DR   EnsemblGenomes-Tr; BSU26749.
DR   EnsemblGenomes-Tr; BSU26750.
DR   EnsemblGenomes-Tr; BSU32960.
DR   EnsemblGenomes-Tr; BSU32970.
DR   EnsemblGenomes-Tr; BSU35230.
DR   EnsemblGenomes-Tr; BSU35239.
DR   EnsemblGenomes-Tr; BSU35609.
DR   EnsemblGenomes-Tr; BSU35610.
DR   EnsemblGenomes-Tr; BSU35679.
DR   EnsemblGenomes-Tr; BSU35698.
DR   EnsemblGenomes-Tr; BSU35699.
DR   EnsemblGenomes-Tr; BSU36499.
DR   EnsemblGenomes-Tr; BSU36668.
DR   EnsemblGenomes-Tr; BSU36669.
DR   EnsemblGenomes-Tr; BSU39029.
DR   EnsemblGenomes-Tr; BSU39030.
DR   EnsemblGenomes-Tr; BSU39129.
DR   EnsemblGenomes-Tr; BSU40359.
DR   EnsemblGenomes-Tr; BSU40573.
DR   EnsemblGenomes-Tr; BSU40574.
DR   EnsemblGenomes-Tr; BSU40578.
DR   EnsemblGenomes-Tr; BSU40579.
DR   EnsemblGenomes-Tr; BSU_rRNA_1-1.
DR   EnsemblGenomes-Tr; BSU_rRNA_10-1.
DR   EnsemblGenomes-Tr; BSU_rRNA_11-1.
DR   EnsemblGenomes-Tr; BSU_rRNA_12-1.
DR   EnsemblGenomes-Tr; BSU_rRNA_13-1.
DR   EnsemblGenomes-Tr; BSU_rRNA_14-1.
DR   EnsemblGenomes-Tr; BSU_rRNA_15-1.
DR   EnsemblGenomes-Tr; BSU_rRNA_16-1.
DR   EnsemblGenomes-Tr; BSU_rRNA_17-1.
DR   EnsemblGenomes-Tr; BSU_rRNA_18-1.
DR   EnsemblGenomes-Tr; BSU_rRNA_19-1.
DR   EnsemblGenomes-Tr; BSU_rRNA_2-1.
DR   EnsemblGenomes-Tr; BSU_rRNA_20-1.
DR   EnsemblGenomes-Tr; BSU_rRNA_21-1.
DR   EnsemblGenomes-Tr; BSU_rRNA_22-1.
DR   EnsemblGenomes-Tr; BSU_rRNA_23-1.
DR   EnsemblGenomes-Tr; BSU_rRNA_24-1.
DR   EnsemblGenomes-Tr; BSU_rRNA_25-1.
DR   EnsemblGenomes-Tr; BSU_rRNA_26-1.
DR   EnsemblGenomes-Tr; BSU_rRNA_27-1.
DR   EnsemblGenomes-Tr; BSU_rRNA_28-1.
DR   EnsemblGenomes-Tr; BSU_rRNA_29-1.
DR   EnsemblGenomes-Tr; BSU_rRNA_3-1.
DR   EnsemblGenomes-Tr; BSU_rRNA_30-1.
DR   EnsemblGenomes-Tr; BSU_rRNA_4-1.
DR   EnsemblGenomes-Tr; BSU_rRNA_5-1.
DR   EnsemblGenomes-Tr; BSU_rRNA_6-1.
DR   EnsemblGenomes-Tr; BSU_rRNA_7-1.
DR   EnsemblGenomes-Tr; BSU_rRNA_8-1.
DR   EnsemblGenomes-Tr; BSU_rRNA_9-1.
DR   EnsemblGenomes-Tr; BSU_tRNA_1-1.
DR   EnsemblGenomes-Tr; BSU_tRNA_10-1.
DR   EnsemblGenomes-Tr; BSU_tRNA_11-1.
DR   EnsemblGenomes-Tr; BSU_tRNA_12-1.
DR   EnsemblGenomes-Tr; BSU_tRNA_13-1.
DR   EnsemblGenomes-Tr; BSU_tRNA_14-1.
DR   EnsemblGenomes-Tr; BSU_tRNA_15-1.
DR   EnsemblGenomes-Tr; BSU_tRNA_16-1.
DR   EnsemblGenomes-Tr; BSU_tRNA_17-1.
DR   EnsemblGenomes-Tr; BSU_tRNA_18-1.
DR   EnsemblGenomes-Tr; BSU_tRNA_19-1.
DR   EnsemblGenomes-Tr; BSU_tRNA_2-1.
DR   EnsemblGenomes-Tr; BSU_tRNA_20-1.
DR   EnsemblGenomes-Tr; BSU_tRNA_21-1.
DR   EnsemblGenomes-Tr; BSU_tRNA_22-1.
DR   EnsemblGenomes-Tr; BSU_tRNA_23-1.
DR   EnsemblGenomes-Tr; BSU_tRNA_24-1.
DR   EnsemblGenomes-Tr; BSU_tRNA_25-1.
DR   EnsemblGenomes-Tr; BSU_tRNA_26-1.
DR   EnsemblGenomes-Tr; BSU_tRNA_27-1.
DR   EnsemblGenomes-Tr; BSU_tRNA_28-1.
DR   EnsemblGenomes-Tr; BSU_tRNA_29-1.
DR   EnsemblGenomes-Tr; BSU_tRNA_3-1.
DR   EnsemblGenomes-Tr; BSU_tRNA_30-1.
DR   EnsemblGenomes-Tr; BSU_tRNA_31-1.
DR   EnsemblGenomes-Tr; BSU_tRNA_32-1.
DR   EnsemblGenomes-Tr; BSU_tRNA_33-1.
DR   EnsemblGenomes-Tr; BSU_tRNA_34-1.
DR   EnsemblGenomes-Tr; BSU_tRNA_35-1.
DR   EnsemblGenomes-Tr; BSU_tRNA_36-1.
DR   EnsemblGenomes-Tr; BSU_tRNA_37-1.
DR   EnsemblGenomes-Tr; BSU_tRNA_38-1.
DR   EnsemblGenomes-Tr; BSU_tRNA_39-1.
DR   EnsemblGenomes-Tr; BSU_tRNA_4-1.
DR   EnsemblGenomes-Tr; BSU_tRNA_40-1.
DR   EnsemblGenomes-Tr; BSU_tRNA_41-1.
DR   EnsemblGenomes-Tr; BSU_tRNA_42-1.
DR   EnsemblGenomes-Tr; BSU_tRNA_43-1.
DR   EnsemblGenomes-Tr; BSU_tRNA_44-1.
DR   EnsemblGenomes-Tr; BSU_tRNA_45-1.
DR   EnsemblGenomes-Tr; BSU_tRNA_46-1.
DR   EnsemblGenomes-Tr; BSU_tRNA_47-1.
DR   EnsemblGenomes-Tr; BSU_tRNA_48-1.
DR   EnsemblGenomes-Tr; BSU_tRNA_49-1.
DR   EnsemblGenomes-Tr; BSU_tRNA_5-1.
DR   EnsemblGenomes-Tr; BSU_tRNA_50-1.
DR   EnsemblGenomes-Tr; BSU_tRNA_51-1.
DR   EnsemblGenomes-Tr; BSU_tRNA_52-1.
DR   EnsemblGenomes-Tr; BSU_tRNA_53-1.
DR   EnsemblGenomes-Tr; BSU_tRNA_54-1.
DR   EnsemblGenomes-Tr; BSU_tRNA_55-1.
DR   EnsemblGenomes-Tr; BSU_tRNA_56-1.
DR   EnsemblGenomes-Tr; BSU_tRNA_57-1.
DR   EnsemblGenomes-Tr; BSU_tRNA_58-1.
DR   EnsemblGenomes-Tr; BSU_tRNA_59-1.
DR   EnsemblGenomes-Tr; BSU_tRNA_6-1.
DR   EnsemblGenomes-Tr; BSU_tRNA_60-1.
DR   EnsemblGenomes-Tr; BSU_tRNA_61-1.
DR   EnsemblGenomes-Tr; BSU_tRNA_62-1.
DR   EnsemblGenomes-Tr; BSU_tRNA_63-1.
DR   EnsemblGenomes-Tr; BSU_tRNA_64-1.
DR   EnsemblGenomes-Tr; BSU_tRNA_65-1.
DR   EnsemblGenomes-Tr; BSU_tRNA_66-1.
DR   EnsemblGenomes-Tr; BSU_tRNA_67-1.
DR   EnsemblGenomes-Tr; BSU_tRNA_68-1.
DR   EnsemblGenomes-Tr; BSU_tRNA_69-1.
DR   EnsemblGenomes-Tr; BSU_tRNA_7-1.
DR   EnsemblGenomes-Tr; BSU_tRNA_70-1.
DR   EnsemblGenomes-Tr; BSU_tRNA_71-1.
DR   EnsemblGenomes-Tr; BSU_tRNA_72-1.
DR   EnsemblGenomes-Tr; BSU_tRNA_73-1.
DR   EnsemblGenomes-Tr; BSU_tRNA_74-1.
DR   EnsemblGenomes-Tr; BSU_tRNA_75-1.
DR   EnsemblGenomes-Tr; BSU_tRNA_76-1.
DR   EnsemblGenomes-Tr; BSU_tRNA_77-1.
DR   EnsemblGenomes-Tr; BSU_tRNA_78-1.
DR   EnsemblGenomes-Tr; BSU_tRNA_79-1.
DR   EnsemblGenomes-Tr; BSU_tRNA_8-1.
DR   EnsemblGenomes-Tr; BSU_tRNA_80-1.
DR   EnsemblGenomes-Tr; BSU_tRNA_81-1.
DR   EnsemblGenomes-Tr; BSU_tRNA_82-1.
DR   EnsemblGenomes-Tr; BSU_tRNA_83-1.
DR   EnsemblGenomes-Tr; BSU_tRNA_84-1.
DR   EnsemblGenomes-Tr; BSU_tRNA_85-1.
DR   EnsemblGenomes-Tr; BSU_tRNA_86-1.
DR   EnsemblGenomes-Tr; BSU_tRNA_9-1.
DR   EnsemblGenomes-Tr; EBT00001760715.
DR   EnsemblGenomes-Tr; EBT00001760717.
DR   EnsemblGenomes-Tr; EBT00001760720.
DR   EnsemblGenomes-Tr; EBT00001760722.
DR   EnsemblGenomes-Tr; EBT00001760723.
DR   EnsemblGenomes-Tr; EBT00001760725.
DR   EnsemblGenomes-Tr; EBT00001760727.
DR   EnsemblGenomes-Tr; EBT00001760728.
DR   EnsemblGenomes-Tr; EBT00001760731.
DR   EnsemblGenomes-Tr; EBT00001760732.
DR   EnsemblGenomes-Tr; EBT00001760734.
DR   EnsemblGenomes-Tr; EBT00001760736.
DR   EnsemblGenomes-Tr; EBT00001760737.
DR   EnsemblGenomes-Tr; EBT00001760740.
DR   EnsemblGenomes-Tr; EBT00001760742.
DR   EnsemblGenomes-Tr; EBT00001760744.
DR   EnsemblGenomes-Tr; EBT00001760746.
DR   EnsemblGenomes-Tr; EBT00001760750.
DR   EnsemblGenomes-Tr; EBT00001760752.
DR   EnsemblGenomes-Tr; EBT00001760754.
DR   EnsemblGenomes-Tr; EBT00001760756.
DR   EnsemblGenomes-Tr; EBT00001760758.
DR   EnsemblGenomes-Tr; EBT00001760759.
DR   EnsemblGenomes-Tr; EBT00001760763.
DR   EnsemblGenomes-Tr; EBT00001760766.
DR   EnsemblGenomes-Tr; EBT00001760767.
DR   EnsemblGenomes-Tr; EBT00001760771.
DR   EnsemblGenomes-Tr; EBT00001760772.
DR   EnsemblGenomes-Tr; EBT00001760775.
DR   EnsemblGenomes-Tr; EBT00001760777.
DR   EnsemblGenomes-Tr; EBT00001760779.
DR   EnsemblGenomes-Tr; EBT00001760782.
DR   EnsemblGenomes-Tr; EBT00001760784.
DR   EnsemblGenomes-Tr; EBT00001760786.
DR   EnsemblGenomes-Tr; EBT00001760788.
DR   EnsemblGenomes-Tr; EBT00001760790.
DR   EnsemblGenomes-Tr; EBT00001760792.
DR   EnsemblGenomes-Tr; EBT00001760794.
DR   EnsemblGenomes-Tr; EBT00001760795.
DR   EnsemblGenomes-Tr; EBT00001760797.
DR   EnsemblGenomes-Tr; EBT00001760799.
DR   EnsemblGenomes-Tr; EBT00001760802.
DR   EnsemblGenomes-Tr; EBT00001760803.
DR   EnsemblGenomes-Tr; EBT00001760805.
DR   EnsemblGenomes-Tr; EBT00001760808.
DR   EnsemblGenomes-Tr; EBT00001760810.
DR   EnsemblGenomes-Tr; EBT00001760812.
DR   EnsemblGenomes-Tr; EBT00001760813.
DR   EnsemblGenomes-Tr; EBT00001760815.
DR   EnsemblGenomes-Tr; EBT00001760817.
DR   EnsemblGenomes-Tr; EBT00001760820.
DR   EnsemblGenomes-Tr; EBT00001760821.
DR   EnsemblGenomes-Tr; EBT00001760823.
DR   EnsemblGenomes-Tr; EBT00001760826.
DR   EnsemblGenomes-Tr; EBT00001760828.
DR   EnsemblGenomes-Tr; EBT00001760829.
DR   EnsemblGenomes-Tr; EBT00001760831.
DR   EnsemblGenomes-Tr; EBT00001760833.
DR   EnsemblGenomes-Tr; EBT00001760835.
DR   EnsemblGenomes-Tr; EBT00001760837.
DR   EnsemblGenomes-Tr; EBT00001760838.
DR   EnsemblGenomes-Tr; EBT00001760841.
DR   EnsemblGenomes-Tr; EBT00001760843.
DR   EnsemblGenomes-Tr; EBT00001760845.
DR   EnsemblGenomes-Tr; EBT00001760847.
DR   EnsemblGenomes-Tr; EBT00001760849.
DR   EnsemblGenomes-Tr; EBT00001760851.
DR   EnsemblGenomes-Tr; EBT00001760852.
DR   EnsemblGenomes-Tr; EBT00001760854.
DR   EnsemblGenomes-Tr; EBT00001760856.
DR   EnsemblGenomes-Tr; EBT00001760858.
DR   EnsemblGenomes-Tr; EBT00001760861.
DR   EnsemblGenomes-Tr; EBT00001760864.
DR   EnsemblGenomes-Tr; EBT00001760865.
DR   EnsemblGenomes-Tr; EBT00001760867.
DR   EnsemblGenomes-Tr; EBT00001760869.
DR   EnsemblGenomes-Tr; EBT00001760871.
DR   EnsemblGenomes-Tr; EBT00001760872.
DR   EnsemblGenomes-Tr; EBT00001760874.
DR   EnsemblGenomes-Tr; EBT00001760876.
DR   EnsemblGenomes-Tr; EBT00001760878.
DR   EnsemblGenomes-Tr; EBT00001760881.
DR   EnsemblGenomes-Tr; EBT00001760883.
DR   EnsemblGenomes-Tr; EBT00001760886.
DR   EnsemblGenomes-Tr; EBT00001760888.
DR   EnsemblGenomes-Tr; EBT00001760889.
DR   EnsemblGenomes-Tr; EBT00001760891.
DR   EnsemblGenomes-Tr; EBT00001760893.
DR   EnsemblGenomes-Tr; EBT00001760894.
DR   EnsemblGenomes-Tr; EBT00001760896.
DR   EnsemblGenomes-Tr; EBT00001760898.
DR   EnsemblGenomes-Tr; EBT00001760900.
DR   EnsemblGenomes-Tr; EBT00001760902.
DR   EnsemblGenomes-Tr; EBT00001760903.
DR   EnsemblGenomes-Tr; EBT00001760905.
DR   EnsemblGenomes-Tr; EBT00001760907.
DR   EnsemblGenomes-Tr; EBT00001760909.
DR   EnsemblGenomes-Tr; EBT00001760910.
DR   EnsemblGenomes-Tr; EBT00001760912.
DR   EnsemblGenomes-Tr; EBT00001760914.
DR   EnsemblGenomes-Tr; EBT00001760916.
DR   EnsemblGenomes-Tr; EBT00001760918.
DR   EnsemblGenomes-Tr; EBT00001760919.
DR   EnsemblGenomes-Tr; EBT00001760921.
DR   EnsemblGenomes-Tr; EBT00001760922.
DR   EnsemblGenomes-Tr; EBT00001760925.
DR   EnsemblGenomes-Tr; EBT00001760927.
DR   EnsemblGenomes-Tr; EBT00001760929.
DR   EnsemblGenomes-Tr; EBT00001760930.
DR   EnsemblGenomes-Tr; EBT00001760932.
DR   EnsemblGenomes-Tr; EBT00001760934.
DR   EnsemblGenomes-Tr; EBT00001760936.
DR   EnsemblGenomes-Tr; EBT00001760938.
DR   EnsemblGenomes-Tr; EBT00001760940.
DR   EnsemblGenomes-Tr; EBT00001760942.
DR   EnsemblGenomes-Tr; EBT00001760944.
DR   EnsemblGenomes-Tr; EBT00001760946.
DR   EnsemblGenomes-Tr; EBT00001760947.
DR   EnsemblGenomes-Tr; EBT00001760949.
DR   EnsemblGenomes-Tr; EBT00001760951.
DR   EnsemblGenomes-Tr; EBT00001760953.
DR   EnsemblGenomes-Tr; EBT00001760954.
DR   EnsemblGenomes-Tr; EBT00001760956.
DR   EnsemblGenomes-Tr; EBT00001760958.
DR   EnsemblGenomes-Tr; EBT00001760959.
DR   EnsemblGenomes-Tr; EBT00001760961.
DR   EnsemblGenomes-Tr; EBT00001760963.
DR   EnsemblGenomes-Tr; EBT00001760965.
DR   EnsemblGenomes-Tr; EBT00001760967.
DR   EnsemblGenomes-Tr; EBT00001760968.
DR   EnsemblGenomes-Tr; EBT00001760970.
DR   EnsemblGenomes-Tr; EBT00001760972.
DR   EnsemblGenomes-Tr; EBT00001760974.
DR   EnsemblGenomes-Tr; EBT00001760976.
DR   EnsemblGenomes-Tr; EBT00001760978.
DR   EnsemblGenomes-Tr; EBT00001760980.
DR   EnsemblGenomes-Tr; EBT00001760982.
DR   EnsemblGenomes-Tr; EBT00001760984.
DR   EnsemblGenomes-Tr; EBT00001760985.
DR   EnsemblGenomes-Tr; EBT00001760988.
DR   EnsemblGenomes-Tr; EBT00001760989.
DR   EnsemblGenomes-Tr; EBT00001760991.
DR   EnsemblGenomes-Tr; EBT00001760993.
DR   EnsemblGenomes-Tr; EBT00001760995.
DR   EnsemblGenomes-Tr; EBT00001760997.
DR   EnsemblGenomes-Tr; EBT00001760999.
DR   EnsemblGenomes-Tr; EBT00001761001.
DR   EnsemblGenomes-Tr; EBT00001761004.
DR   EnsemblGenomes-Tr; EBT00001761005.
DR   EnsemblGenomes-Tr; EBT00001761007.
DR   EnsemblGenomes-Tr; EBT00001761009.
DR   EnsemblGenomes-Tr; EBT00001761011.
DR   EnsemblGenomes-Tr; EBT00001761012.
DR   EnsemblGenomes-Tr; EBT00001761013.
DR   EnsemblGenomes-Tr; EBT00001761014.
DR   EnsemblGenomes-Tr; EBT00001761015.
DR   EnsemblGenomes-Tr; EBT00001761016.
DR   EnsemblGenomes-Tr; EBT00001761017.
DR   EnsemblGenomes-Tr; EBT00001761018.
DR   EnsemblGenomes-Tr; EBT00001761019.
DR   EnsemblGenomes-Tr; EBT00001761020.
DR   EnsemblGenomes-Tr; EBT00001761021.
DR   EnsemblGenomes-Tr; EBT00001761022.
DR   EnsemblGenomes-Tr; EBT00001761023.
DR   EnsemblGenomes-Tr; EBT00001761024.
DR   EnsemblGenomes-Tr; EBT00001761025.
DR   EnsemblGenomes-Tr; EBT00001761026.
DR   EnsemblGenomes-Tr; EBT00001761027.
DR   EnsemblGenomes-Tr; EBT00001761028.
DR   EnsemblGenomes-Tr; EBT00001761029.
DR   EnsemblGenomes-Tr; EBT00001761030.
DR   EnsemblGenomes-Tr; EBT00001761031.
DR   EnsemblGenomes-Tr; EBT00001761032.
DR   EuropePMC; PMC103618; 10498703.
DR   EuropePMC; PMC1112048; 15901699.
DR   EuropePMC; PMC1280175; 16251307.
DR   EuropePMC; PMC1448744; 15611189.
DR   EuropePMC; PMC1524751; 16772031.
DR   EuropePMC; PMC1574309; 16869956.
DR   EuropePMC; PMC165468; 12519939.
DR   EuropePMC; PMC2242806; 18045455.
DR   EuropePMC; PMC2289816; 18307761.
DR   EuropePMC; PMC2474695; 18670626.
DR   EuropePMC; PMC2632007; 19074389.
DR   EuropePMC; PMC2632123; 19060158.
DR   EuropePMC; PMC2735659; 19561016.
DR   EuropePMC; PMC2772482; 19767427.
DR   EuropePMC; PMC2784878; 19682248.
DR   EuropePMC; PMC2786600; 19820088.
DR   EuropePMC; PMC2824700; 20067631.
DR   EuropePMC; PMC2860498; 20436965.
DR   EuropePMC; PMC2885750; 19383706.
DR   EuropePMC; PMC2900268; 20546576.
DR   EuropePMC; PMC2978689; 21085634.
DR   EuropePMC; PMC3000357; 21170359.
DR   EuropePMC; PMC3019169; 21264304.
DR   EuropePMC; PMC3140582; 21330441.
DR   EuropePMC; PMC3152330; 21478170.
DR   EuropePMC; PMC3193587; 21840319.
DR   EuropePMC; PMC3370555; 22504824.
DR   EuropePMC; PMC3384302; 22373923.
DR   EuropePMC; PMC3415491; 22730127.
DR   EuropePMC; PMC3416357; 22544248.
DR   EuropePMC; PMC3416434; 22610424.
DR   EuropePMC; PMC3463246; 23066504.
DR   EuropePMC; PMC3479198; 22904070.
DR   EuropePMC; PMC3479203; 22904090.
DR   EuropePMC; PMC3485338; 23119071.
DR   EuropePMC; PMC3485967; 22941078.
DR   EuropePMC; PMC3497475; 23002222.
DR   EuropePMC; PMC3516659; 24293722.
DR   EuropePMC; PMC3542257; 23326572.
DR   EuropePMC; PMC3620942; 23510095.
DR   EuropePMC; PMC3654967; 23618128.
DR   EuropePMC; PMC3676062; 23543720.
DR   EuropePMC; PMC3719520; 23709504.
DR   EuropePMC; PMC3861659; 24194525.
DR   EuropePMC; PMC3928365; 24558473.
DR   EuropePMC; PMC4018868; 24657871.
DR   EuropePMC; PMC4036058; 22956758.
DR   EuropePMC; PMC4039378; 24281055.
DR   EuropePMC; PMC4125768; 25103757.
DR   EuropePMC; PMC4137073; 25048541.
DR   EuropePMC; PMC4187847; 25069979.
DR   EuropePMC; PMC4237932; 25224913.
DR   EuropePMC; PMC4263823; 25502661.
DR   EuropePMC; PMC4366234; 25790031.
DR   EuropePMC; PMC4480331; 25851715.
DR   EuropePMC; PMC4592849; 26296725.
DR   EuropePMC; PMC4634966; 26539825.
DR   EuropePMC; PMC4634974; 26540271.
DR   EuropePMC; PMC4818034; 27035918.
DR   EuropePMC; PMC4862544; 26856828.
DR   EuropePMC; PMC4890260; 27257436.
DR   EuropePMC; PMC4899322; 26915493.
DR   EuropePMC; PMC4995803; 27559429.
DR   EuropePMC; PMC5108699; 27234886.
DR   EuropePMC; PMC5169363; 28066362.
DR   EuropePMC; PMC5210572; 27899624.
DR   EuropePMC; PMC5247444; 28163698.
DR   EuropePMC; PMC5418572; 28462927.
DR   EuropePMC; PMC549560; 15698474.
DR   EuropePMC; PMC555942; 15757509.
DR   EuropePMC; PMC5573067; 28461449.
DR   EuropePMC; PMC5585990; 28039230.
DR   EuropePMC; PMC5601351; 28754705.
DR   EuropePMC; PMC5666159; 29089431.
DR   EuropePMC; PMC5730154; 29240826.
DR   EuropePMC; PMC5743806; 29280348.
DR   EuropePMC; PMC5756622; 27120414.
DR   EuropePMC; PMC6013613; 29930040.
DR   EuropePMC; PMC60312; 11737947.
DR   EuropePMC; PMC6052121; 30050512.
DR   EuropePMC; PMC6097659; 29925569.
DR   EuropePMC; PMC6299973; 30567498.
DR   EuropePMC; PMC6391936; 30842758.
DR   EuropePMC; PMC6581720; 31244791.
DR   EuropePMC; PMC6582243; 31249559.
DR   EuropePMC; PMC93828; 10348873.
DR   EuropePMC; PMC94815; 11092850.
DR   EuropePMC; PMC99059; 11752255.
DR   GOA; O32274.
DR   GOA; P42061.
DR   InterPro; IPR003362; Bact_transf.
DR   InterPro; IPR014986; Phage_phiCD119_XkdN.
DR   InterPro; IPR016784; UCP021288_ACT.
DR   InterPro; IPR023765; SBP_5_CS.
DR   InterPro; IPR024514; DUF3388.
DR   InterPro; IPR038559; Phage_phiCD119_XkdN_sf.
DR   PDB; 1XOC; X-ray.
DR   PDB; 3KLU; X-ray.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00011; RNaseP_bact_b.
DR   RFAM; RF00013; 6S.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00039; DicF.
DR   RFAM; RF00050; FMN.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00080; yybP-ykoY.
DR   RFAM; RF00162; SAM.
DR   RFAM; RF00167; Purine.
DR   RFAM; RF00168; Lysine.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00230; T-box.
DR   RFAM; RF00234; glmS.
DR   RFAM; RF00379; ydaO-yuaA.
DR   RFAM; RF00380; ykoK.
DR   RFAM; RF00442; ykkC-yxkD.
DR   RFAM; RF00504; Glycine.
DR   RFAM; RF00515; PyrR.
DR   RFAM; RF00516; ylbH.
DR   RFAM; RF00522; PreQ1.
DR   RFAM; RF00555; L13_leader.
DR   RFAM; RF00556; L19_leader.
DR   RFAM; RF00557; L10_leader.
DR   RFAM; RF00558; L20_leader.
DR   RFAM; RF00559; L21_leader.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01410; BsrC.
DR   RFAM; RF01411; BsrF.
DR   RFAM; RF01412; BsrG.
DR   RFAM; RF01690; Bacillaceae-1.
DR   RFAM; RF01691; Bacillus-plasmid.
DR   RFAM; RF01735; epsC.
DR   RFAM; RF01749; pan.
DR   RFAM; RF01764; yjdF.
DR   RFAM; RF01766; cspA.
DR   RFAM; RF01820; RsaE.
DR   RFAM; RF01854; Bacteria_large_SRP.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   RFAM; RF02273; FsrA.
DR   SILVA-LSU; AL009126.
DR   SILVA-SSU; AL009126.
DR   StrainInfo; 103309; 0.
DR   UniProtKB/Swiss-Prot; O31769; YMFK_BACSU.
DR   UniProtKB/Swiss-Prot; O32274; TUAA_BACSU.
DR   UniProtKB/Swiss-Prot; O34608; YDIN_BACSU.
DR   UniProtKB/Swiss-Prot; P08497; LPA2_BACSU.
DR   UniProtKB/Swiss-Prot; P35153; YPUE_BACSU.
DR   UniProtKB/Swiss-Prot; P42061; APPA_BACSU.
DR   UniProtKB/Swiss-Prot; P45930; YQBN_BACSU.
XX
CC   On or before Mar 17, 2009 this sequence version replaced
CC   gi:32468687, gi:32468690, gi:32468695, gi:32468704, gi:32468715,
CC   gi:32468723, gi:32468738, gi:32468743, gi:32468745, gi:32468758,
CC   gi:32468767, gi:32468778, gi:32468787, gi:32468796, gi:32468802,
CC   gi:32468809, gi:32468813, gi:32468825, gi:32468830, gi:32468833,
CC   gi:32468840, gi:38680335.
CC   Annotation results relative to BLAST similarities, COG
CC   assignations, enzymatic function prediction (PRIAM software), TMHMM
CC   and SignalP predictions, and synteny conservation (Syntonizer
CC   software) are available in the MicroScope annotation platform
CC   http://www.genoscope.cns.fr/agc/microscope.
CC   The large cluster comprising the i, h and g rDNA regions could not
CC   be properly resolved, we therefore incorporated the original
CC   sequence of rRNAihg in the final assembly.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..4215606
FT                   /organism="Bacillus subtilis subsp. subtilis str. 168"
FT                   /sub_species="subtilis"
FT                   /strain="168"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:224308"
FT   gene            410..1750
FT                   /gene="dnaA"
FT                   /locus_tag="BSU_00010"
FT                   /old_locus_tag="BSU00010"
FT   CDS_pept        410..1750
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaA"
FT                   /locus_tag="BSU_00010"
FT                   /old_locus_tag="BSU00010"
FT                   /product="chromosomal replication initiator informational
FT                   ATPase"
FT                   /function="16.9: Replicate"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 2167836, 2846289, 12682299,
FT                   16120674, 1779750, 28166228; Product type f : factor"
FT                   /db_xref="EnsemblGenomes-Gn:BSU00010"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11777"
FT                   /db_xref="GOA:P05648"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="PDB:4TPS"
FT                   /db_xref="SubtiList:BG10065"
FT                   /db_xref="UniProtKB/Swiss-Prot:P05648"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:2167836, 2846289, 12682299, 16120674, 1779750,
FT                   28166228"
FT                   /protein_id="CAB11777.1"
FT                   /translation="MENILDLWNQALAQIEKKLSKPSFETWMKSTKAHSLQGDTLTITA
FT                   PNEFARDWLESRYLHLIADTIYELTGEELSIKFVIPQNQDVEDFMPKPQVKKAVKEDTS
FT                   DFPQNMLNPKYTFDTFVIGSGNRFAHAASLAVAEAPAKAYNPLFIYGGVGLGKTHLMHA
FT                   IGHYVIDHNPSAKVVYLSSEKFTNEFINSIRDNKAVDFRNRYRNVDVLLIDDIQFLAGK
FT                   EQTQEEFFHTFNTLHEESKQIVISSDRPPKEIPTLEDRLRSRFEWGLITDITPPDLETR
FT                   IAILRKKAKAEGLDIPNEVMLYIANQIDSNIRELEGALIRVVAYSSLINKDINADLAAE
FT                   ALKDIIPSSKPKVITIKEIQRVVGQQFNIKLEDFKAKKRTKSVAFPRQIAMYLSREMTD
FT                   SSLPKIGEEFGGRDHTTVIHAHEKISKLLADDEQLQQHVKEIKEQLK"
FT   gene            1939..3075
FT                   /gene="dnaN"
FT                   /locus_tag="BSU_00020"
FT                   /old_locus_tag="BSU00020"
FT   CDS_pept        1939..3075
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaN"
FT                   /locus_tag="BSU_00020"
FT                   /old_locus_tag="BSU00020"
FT                   /product="DNA polymerase III (beta subunit)"
FT                   /function="16.9: Replicate"
FT                   /EC_number="2.7.7.7"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 2846289, 11395445, 12682299,
FT                   20453097, 23228104, 28878042; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU00020"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11778"
FT                   /db_xref="GOA:P05649"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="PDB:4TR6"
FT                   /db_xref="PDB:6E8D"
FT                   /db_xref="SubtiList:BG10066"
FT                   /db_xref="UniProtKB/Swiss-Prot:P05649"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:2846289, 11395445, 12682299, 20453097, 23228104,
FT                   28878042"
FT                   /protein_id="CAB11778.1"
FT                   /translation="MKFTIQKDRLVESVQDVLKAVSSRTTIPILTGIKIVASDDGVSFT
FT                   GSDSDISIESFIPKEEGDKEIVTIEQPGSIVLQARFFSEIVKKLPMATVEIEVQNQYLT
FT                   IIRSGKAEFNLNGLDADEYPHLPQIEEHHAIQIPTDLLKNLIRQTVFAVSTSETRPILT
FT                   GVNWKVEQSELLCTATDSHRLALRKAKLDIPEDRSYNVVIPGKSLTELSKILDDNQELV
FT                   DIVITETQVLFKAKNVLFFSRLLDGNYPDTTSLIPQDSKTEIIVNTKEFLQAIDRASLL
FT                   AREGRNNVVKLSAKPAESIEISSNSPEIGKVVEAIVADQIEGEELNISFSPKYMLDALK
FT                   VLEGAEIRVSFTGAMRPFLIRTPNDETIVQLILPVRTY"
FT   gene            3206..3421
FT                   /gene="rlbA"
FT                   /locus_tag="BSU_00030"
FT                   /old_locus_tag="BSU00030"
FT   CDS_pept        3206..3421
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rlbA"
FT                   /locus_tag="BSU_00030"
FT                   /old_locus_tag="BSU00030"
FT                   /product="RNA binding protein involved in ribosome
FT                   maturation"
FT                   /function="16.13: Shape"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 24637032, 24939895; Product
FT                   type f: factor"
FT                   /db_xref="EnsemblGenomes-Gn:BSU00030"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11779"
FT                   /db_xref="GOA:P05650"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR014330"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="SubtiList:BG10067"
FT                   /db_xref="UniProtKB/Swiss-Prot:P05650"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:24637032, 24939895"
FT                   /protein_id="CAB11779.1"
FT                   /translation="MANPISIDTEMITLGQFLKLADVIQSGGMAKWFLSEHEVLVNDEP
FT                   DNRRGRKLYVGDVVEIEGFGSFQVVN"
FT   gene            3437..4549
FT                   /gene="recF"
FT                   /locus_tag="BSU_00040"
FT                   /old_locus_tag="BSU00040"
FT   CDS_pept        3437..4549
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recF"
FT                   /locus_tag="BSU_00040"
FT                   /old_locus_tag="BSU00040"
FT                   /product="RecA filament-DNA complex stabilisation, ssDNA
FT                   and dsDNA binding, ATP binding"
FT                   /function="16.6: Maintain"
FT                   /function="16.9: Replicate"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 15186413, 16061691, 16385024,
FT                   22342069; Product type f: factor"
FT                   /db_xref="EnsemblGenomes-Gn:BSU00040"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11780"
FT                   /db_xref="GOA:P05651"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR018078"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042174"
FT                   /db_xref="SubtiList:BG10068"
FT                   /db_xref="UniProtKB/Swiss-Prot:P05651"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:15186413, 16061691, 16385024, 22342069"
FT                   /protein_id="CAB11780.1"
FT                   /translation="MYIQNLELTSYRNYDHAELQFENKVNVIIGENAQGKTNLMEAIYV
FT                   LSMAKSHRTSNDKELIRWDKDYAKIEGRVMKQNGAIPMQLVISKKGKKGKVNHIEQQKL
FT                   SQYVGALNTIMFAPEDLNLVKGSPQVRRRFLDMEIGQVSPVYLHDLSLYQKILSQRNHF
FT                   LKQLQTRKQTDRTMLDVLTDQLVEVAAKVVVKRLQFTAQLEKWAQPIHAGISRGLEELT
FT                   LKYHTALDVSDPLDLSKIGDSYQEAFSKLREKEIERGVTLSGPHRDDVLFYVNGRDVQT
FT                   YGSQGQQRTTALSLKLAEIDLIHEEIGEYPILLLDDVLSELDDYRQSHLLHTIQGRVQT
FT                   FVTTTSVDGIDHETLRQAGMFRVQNGALVK"
FT   gene            4567..4812
FT                   /gene="remB"
FT                   /locus_tag="BSU_00050"
FT                   /old_locus_tag="BSU00050"
FT   CDS_pept        4567..4812
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="remB"
FT                   /locus_tag="BSU_00050"
FT                   /old_locus_tag="BSU00050"
FT                   /product="regulator of extracellular matrix formation"
FT                   /function="16.5: Explore"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 19363116; Product type r:
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BSU00050"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11781"
FT                   /db_xref="InterPro:IPR007169"
FT                   /db_xref="SubtiList:BG10069"
FT                   /db_xref="UniProtKB/Swiss-Prot:P37525"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:19363116"
FT                   /protein_id="CAB11781.2"
FT                   /translation="MYIHLGDDFVVSTRDIVGIFDFKANMSPIVEEFLKKQKHKVVPSV
FT                   NGTPKSIVVTVQNIYYSPLSSSTLKKRAQFMFEIDS"
FT   gene            4867..6783
FT                   /gene="gyrB"
FT                   /locus_tag="BSU_00060"
FT                   /old_locus_tag="BSU00060"
FT   CDS_pept        4867..6783
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gyrB"
FT                   /locus_tag="BSU_00060"
FT                   /old_locus_tag="BSU00060"
FT                   /product="DNA gyrase (subunit B)"
FT                   /function="16.9: Replicate"
FT                   /function="16.3: Control"
FT                   /function="16.2: Construct biomass (Anabolism)"
FT                   /EC_number="5.99.1.3"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 12682299, 12767818, 17320901;
FT                   Product type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU00060"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11782"
FT                   /db_xref="GOA:P05652"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR034160"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="SubtiList:BG10070"
FT                   /db_xref="UniProtKB/Swiss-Prot:P05652"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:12682299, 12767818, 17320901"
FT                   /protein_id="CAB11782.1"
FT                   /translation="MEQQQNSYDENQIQVLEGLEAVRKRPGMYIGSTNSKGLHHLVWEI
FT                   VDNSIDEALAGYCTDINIQIEKDNSITVVDNGRGIPVGIHEKMGRPAVEVIMTVLHAGG
FT                   KFDGSGYKVSGGLHGVGASVVNALSTELDVTVHRDGKIHRQTYKRGVPVTDLEIIGETD
FT                   HTGTTTHFVPDPEIFSETTEYDYDLLANRVRELAFLTKGVNITIEDKREGQERKNEYHY
FT                   EGGIKSYVEYLNRSKEVVHEEPIYIEGEKDGITVEVALQYNDSYTSNIYSFTNNINTYE
FT                   GGTHEAGFKTGLTRVINDYARKKGLIKENDPNLSGDDVREGLTAIISIKHPDPQFEGQT
FT                   KTKLGNSEARTITDTLFSTAMETFMLENPDAAKKIVDKGLMAARARMAAKKARELTRRK
FT                   SALEISNLPGKLADCSSKDPSISELYIVEGDSAGGSAKQGRDRHFQAILPLRGKILNVE
FT                   KARLDKILSNNEVRSMITALGTGIGEDFNLEKARYHKVVIMTDADVDGAHIRTLLLTFF
FT                   YRYMRQIIENGYVYIAQPPLYKVQQGKRVEYAYNDKELEELLKTLPQTPKPGLQRYKGL
FT                   GEMNATQLWETTMDPSSRTLLQVTLEDAMDADETFEMLMGDKVEPRRNFIEANARYVKN
FT                   LDI"
FT   gene            6994..9459
FT                   /gene="gyrA"
FT                   /locus_tag="BSU_00070"
FT                   /old_locus_tag="BSU00070"
FT   CDS_pept        6994..9459
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gyrA"
FT                   /locus_tag="BSU_00070"
FT                   /old_locus_tag="BSU00070"
FT                   /product="DNA gyrase (subunit A)"
FT                   /function="16.9: Replicate"
FT                   /function="16.3: Control"
FT                   /function="16.2: Construct biomass (Anabolism)"
FT                   /EC_number="5.99.1.3"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 12682299, 12767818, 17320901,
FT                   27557712; Product type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU00070"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11783"
FT                   /db_xref="GOA:P05653"
FT                   /db_xref="InterPro:IPR002205"
FT                   /db_xref="InterPro:IPR005743"
FT                   /db_xref="InterPro:IPR006691"
FT                   /db_xref="InterPro:IPR013757"
FT                   /db_xref="InterPro:IPR013758"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR035516"
FT                   /db_xref="PDB:4DDQ"
FT                   /db_xref="SubtiList:BG10071"
FT                   /db_xref="UniProtKB/Swiss-Prot:P05653"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:12682299, 12767818, 17320901, 27557712"
FT                   /protein_id="CAB11783.1"
FT                   /translation="MSEQNTPQVREINISQEMRTSFLDYAMSVIVSRALPDVRDGLKPV
FT                   HRRILYAMNDLGMTSDKPYKKSARIVGEVIGKYHPHGDSAVYESMVRMAQDFNYRYMLV
FT                   DGHGNFGSVDGDSAAAMRYTEARMSKISMEILRDITKDTIDYQDNYDGSEREPVVMPSR
FT                   FPNLLVNGAAGIAVGMATNIPPHQLGEIIDGVLAVSENPDITIPELMEVIPGPDFPTAG
FT                   QILGRSGIRKAYESGRGSITIRAKAEIEQTSSGKERIIVTELPYQVNKAKLIEKIADLV
FT                   RDKKIEGITDLRDESDRTGMRIVIEIRRDANANVILNNLYKQTALQTSFGINLLALVDG
FT                   QPKVLTLKQCLEHYLDHQKVVIRRRTAYELRKAEARAHILEGLRVALDHLDAVISLIRN
FT                   SQTAEIARTGLIEQFSLTEKQAQAILDMRLQRLTGLEREKIEEEYQSLVKLIAELKDIL
FT                   ANEYKVLEIIREELTEIKERFNDERRTEIVTSGLETIEDEDLIERENIVVTLTHNGYVK
FT                   RLPASTYRSQKRGGKGVQGMGTNEDDFVEHLISTSTHDTILFFSNKGKVYRAKGYEIPE
FT                   YGRTAKGIPIINLLEVEKGEWINAIIPVTEFNAELYLFFTTKHGVSKRTSLSQFANIRN
FT                   NGLIALSLREDDELMGVRLTDGTKQIIIGTKNGLLIRFPETDVREMGRTAAGVKGITLT
FT                   DDDVVVGMEILEEESHVLIVTEKGYGKRTPAEEYRTQSRGGKGLKTAKITENNGQLVAV
FT                   KATKGEEDLMIITASGVLIRMDINDISITGRVTQGVRLIRMAEEEHVATVALVEKNEED
FT                   ENEEEQEEV"
FT   gene            9810..11364
FT                   /gene="rrnO-16S"
FT                   /locus_tag="BSU_rRNA_1"
FT   rRNA            9810..11364
FT                   /gene="rrnO-16S"
FT                   /locus_tag="BSU_rRNA_1"
FT                   /product="ribosomal RNA-16S"
FT                   /function="16.2: Construct biomass (Anabolism)"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; Product type n: RNA"
FT   gene            11464..11540
FT                   /gene="trnO-Ile"
FT                   /locus_tag="BSU_tRNA_5"
FT   tRNA            11464..11540
FT                   /gene="trnO-Ile"
FT                   /locus_tag="BSU_tRNA_5"
FT                   /product="tRNA-Ile"
FT                   /function="16.2: Construct biomass (Anabolism)"
FT                   /note="Evidence 2a: Function from experimental evidences in
FT                   other organisms; Product type n: RNA"
FT                   /inference="profile:tRNAscan:1.23"
FT   gene            11552..11627
FT                   /gene="trnO-Ala"
FT                   /locus_tag="BSU_tRNA_6"
FT   tRNA            11552..11627
FT                   /gene="trnO-Ala"
FT                   /locus_tag="BSU_tRNA_6"
FT                   /product="tRNA-Ala"
FT                   /function="16.2: Construct biomass (Anabolism)"
FT                   /note="transfer RNA-Ala(UGC); Evidence 2a: Function from
FT                   experimental evidences in other organisms; Product type n:
FT                   RNA"
FT                   /inference="profile:tRNAscan:1.23"
FT   gene            11709..14636
FT                   /gene="rrnO-23S"
FT                   /locus_tag="BSU_rRNA_2"
FT   rRNA            11709..14636
FT                   /gene="rrnO-23S"
FT                   /locus_tag="BSU_rRNA_2"
FT                   /product="ribosomal RNA-23S"
FT                   /function="16.2: Construct biomass (Anabolism)"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; Product type n: RNA"
FT   gene            14692..14810
FT                   /gene="rrnO-5S"
FT                   /locus_tag="BSU_rRNA_3"
FT   rRNA            14692..14810
FT                   /gene="rrnO-5S"
FT                   /locus_tag="BSU_rRNA_3"
FT                   /product="ribosomal RNA-5S"
FT                   /function="16.2: Construct biomass (Anabolism)"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; Product type n: RNA"
FT   gene            complement(14847..15794)
FT                   /gene="yaaC"
FT                   /locus_tag="BSU_00080"
FT                   /old_locus_tag="BSU00080"
FT   CDS_pept        complement(14847..15794)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaaC"
FT                   /locus_tag="BSU_00080"
FT                   /old_locus_tag="BSU00080"
FT                   /product="conserved protein of unknown function"
FT                   /note="Evidence 4: Unknown function but conserved in other
FT                   organisms; PubMedId: 22333191"
FT                   /db_xref="EnsemblGenomes-Gn:BSU00080"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11784"
FT                   /db_xref="InterPro:IPR026988"
FT                   /db_xref="SubtiList:BG10072"
FT                   /db_xref="UniProtKB/Swiss-Prot:P37526"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB11784.1"
FT                   /translation="MTYHEWKDLALFYSVESTQKFLEKVYILNGINDAKKNSFKNSERF
FT                   IYFLKHAESFYKQAAYSPLEIKPILLFYGMAQLIKACLITRDPHYPSHTSVLAHGVTTR
FT                   KRKKQNYCFSDDEVKIQRNGLCVHFMKHLFGQSDIVDERYTMKKLLMAIPELSDIFYFQ
FT                   QKERFMTKVEKDKNEIFVPEEVVINYKMSDSRFAEYMSHHYQWSFTKKNEHGLLFEISP
FT                   QDKEPWTSTSLLFDMEKNQYYIPSQREQFLRLPEMTIHYLILYNVGMIARYETEWWYEL
FT                   LTQHISDDYVLIQQFLLVSEKKFPKYASQFLLHF"
FT   gene            15915..17381
FT                   /gene="guaB"
FT                   /locus_tag="BSU_00090"
FT                   /old_locus_tag="BSU00090"
FT   CDS_pept        15915..17381
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="guaB"
FT                   /locus_tag="BSU_00090"
FT                   /old_locus_tag="BSU00090"
FT                   /product="inosine-monophosphate dehydrogenase"
FT                   /function="16.2: Construct biomass (Anabolism)"
FT                   /EC_number="1.1.1.205"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 12682299, 1722815, 17611193,
FT                   1979163, 3125411, 8917437; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU00090"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11785"
FT                   /db_xref="GOA:P21879"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR001093"
FT                   /db_xref="InterPro:IPR005990"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR015875"
FT                   /db_xref="SubtiList:BG10073"
FT                   /db_xref="UniProtKB/Swiss-Prot:P21879"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:12682299, 1722815, 17611193, 1979163, 3125411,
FT                   8917437"
FT                   /protein_id="CAB11785.1"
FT                   /translation="MWESKFSKEGLTFDDVLLVPAKSEVLPRDVDLSVELTKTLKLNIP
FT                   VISAGMDTVTESAMAIAMARQGGLGIIHKNMSIEQQAEQVDKVKRSERGVITNPFFLTP
FT                   DHQVFDAEHLMGKYRISGVPIVNNEEDQKLVGIITNRDLRFISDYSMKISDVMTKEELV
FT                   TASVGTTLDEAEKILQKHKIEKLPLVDDQNKLKGLITIKDIEKVIEFPNSSKDIHGRLI
FT                   VGAAVGVTGDTMTRVKKLVEANVDVIVIDTAHGHSQGVLNTVTKIRETYPELNIIAGNV
FT                   ATAEATRALIEAGADVVKVGIGPGSICTTRVVAGVGVPQITAIYDCATEARKHGKTIIA
FT                   DGGIKFSGDITKALAAGGHAVMLGSLLAGTSESPGETEIYQGRRFKVYRGMGSVAAMEK
FT                   GSKDRYFQEENKKFVPEGIEGRTPYKGPVEETVYQLVGGLRSGMGYCGSKDLRALREEA
FT                   QFIRMTGAGLRESHPHDVQITKESPNYTIS"
FT   gene            17534..18865
FT                   /gene="dacA"
FT                   /locus_tag="BSU_00100"
FT                   /old_locus_tag="BSU00100"
FT   CDS_pept        17534..18865
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dacA"
FT                   /locus_tag="BSU_00100"
FT                   /old_locus_tag="BSU00100"
FT                   /product="D-alanyl-D-alanine carboxypeptidase
FT                   (penicillin-binding protein 5)"
FT                   /EC_number="3.4.16.4"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 8370539, 9864321, 10383963,
FT                   21378199; Product type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU00100"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11786"
FT                   /db_xref="GOA:P08750"
FT                   /db_xref="InterPro:IPR001967"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR012907"
FT                   /db_xref="InterPro:IPR015956"
FT                   /db_xref="InterPro:IPR018044"
FT                   /db_xref="InterPro:IPR037167"
FT                   /db_xref="SubtiList:BG10074"
FT                   /db_xref="UniProtKB/Swiss-Prot:P08750"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:8370539, 9864321, 10383963, 21378199"
FT                   /protein_id="CAB11786.1"
FT                   /translation="MNIKKCKQLLMSLVVLTLAVTCLAPMSKAKAASDPIDINASAAIM
FT                   IEASSGKILYSKNADKRLPIASMTKMMTEYLLLEAIDQGKVKWDQTYTPDDYVYEISQD
FT                   NSLSNVPLRKDGKYTVKELYQATAIYSANAAAIAIAEIVAGSETKFVEKMNAKAKELGL
FT                   TDYKFVNATGLENKDLHGHQPEGTSVNEESEVSAKDMAVLADHLITDYPEILETSSIAK
FT                   TKFREGTDDEMDMPNWNFMLKGLVSEYKKATVDGLKTGSTDSAGSCFTGTAERNGMRVI
FT                   TVVLNAKGNLHTGRFDETKKMFDYAFDNFSMKEIYAEGDQVKGHKTISVDKGKEKEVGI
FT                   VTNKAFSLPVKNGEEKNYKAKVTLNKDNLTAPVKKGTKVGKLTAEYTGDEKDYGFLNSD
FT                   LAGVDLVTKENVEKANWFVLTMRSIGGFFAGIWGSIVDTVTGWF"
FT   gene            19062..19946
FT                   /gene="pdxS"
FT                   /locus_tag="BSU_00110"
FT                   /old_locus_tag="BSU00110"
FT   CDS_pept        19062..19946
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pdxS"
FT                   /locus_tag="BSU_00110"
FT                   /old_locus_tag="BSU00110"
FT                   /product="glutamine amidotransferase for pyridoxal
FT                   phosphate synthesis; pyridoxal 5'-phosphate synthase
FT                   complex, synthase subunit"
FT                   /function="16.2: Construct biomass (Anabolism)"
FT                   /EC_number="4.-.-.-"
FT                   /EC_number="4.3.3.6"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 14762015, 15771487, 15911615,
FT                   16157873, 17144654; Product type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU00110"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11787"
FT                   /db_xref="GOA:P37527"
FT                   /db_xref="InterPro:IPR001852"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR033755"
FT                   /db_xref="PDB:2NV1"
FT                   /db_xref="PDB:2NV2"
FT                   /db_xref="SubtiList:BG10075"
FT                   /db_xref="UniProtKB/Swiss-Prot:P37527"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:14762015, 15771487, 15911615, 16157873, 17144654"
FT                   /protein_id="CAB11787.1"
FT                   /translation="MAQTGTERVKRGMAEMQKGGVIMDVINAEQAKIAEEAGAVAVMAL
FT                   ERVPADIRAAGGVARMADPTIVEEVMNAVSIPVMAKARIGHIVEARVLEAMGVDYIDES
FT                   EVLTPADEEFHLNKNEYTVPFVCGCRDLGEATRRIAEGASMLRTKGEPGTGNIVEAVRH
FT                   MRKVNAQVRKVVAMSEDELMTEAKNLGAPYELLLQIKKDGKLPVVNFAAGGVATPADAA
FT                   LMMQLGADGVFVGSGIFKSDNPAKFAKAIVEATTHFTDYKLIAELSKELGTAMKGIEIS
FT                   NLLPEQRMQERGW"
FT   gene            19968..20558
FT                   /gene="pdxT"
FT                   /locus_tag="BSU_00120"
FT                   /old_locus_tag="BSU00120"
FT   CDS_pept        19968..20558
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pdxT"
FT                   /locus_tag="BSU_00120"
FT                   /old_locus_tag="BSU00120"
FT                   /product="glutamine amidotransferase for pyridoxal
FT                   phosphate synthesis; pyridoxal 5'-phosphate synthase
FT                   complex, glutamine amidotransferase subunit PdxT"
FT                   /function="16.2: Construct biomass (Anabolism)"
FT                   /EC_number="3.5.1.2"
FT                   /EC_number="4.3.3.6"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 14585832, 14762015, 15771487,
FT                   17144654, 18271580, 26735940; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU00120"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11788"
FT                   /db_xref="GOA:P37528"
FT                   /db_xref="InterPro:IPR002161"
FT                   /db_xref="InterPro:IPR021196"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="PDB:1R9G"
FT                   /db_xref="PDB:2NV0"
FT                   /db_xref="PDB:2NV2"
FT                   /db_xref="SubtiList:BG10076"
FT                   /db_xref="UniProtKB/Swiss-Prot:P37528"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:14585832, 14762015, 15771487, 17144654, 18271580,
FT                   26735940"
FT                   /protein_id="CAB11788.1"
FT                   /translation="MLTIGVLGLQGAVREHIHAIEACGAAGLVVKRPEQLNEVDGLILP
FT                   GGESTTMRRLIDTYQFMEPLREFAAQGKPMFGTCAGLIILAKEIAGSDNPHLGLLNVVV
FT                   ERNSFGRQVDSFEADLTIKGLDEPFTGVFIRAPHILEAGENVEVLSEHNGRIVAAKQGQ
FT                   FLGCSFHPELTEDHRVTQLFVEMVEEYKQKALV"
FT   gene            20611..20823
FT                   /gene="tboS"
FT                   /locus_tag="BSU_misc_RNA_1"
FT   misc_RNA        20611..20823
FT                   /gene="tboS"
FT                   /locus_tag="BSU_misc_RNA_1"
FT                   /product="T-box riboswitch specific of serine tRNA ligase"
FT                   /function="16.3: Control"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 1317842, 9098041, 12165569,
FT                   12547201; Product type n: RNA"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:1317842, 9098041, 12165569, 12547201"
FT   gene            20880..22157
FT                   /gene="serS"
FT                   /locus_tag="BSU_00130"
FT                   /old_locus_tag="BSU00130"
FT   CDS_pept        20880..22157
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="serS"
FT                   /locus_tag="BSU_00130"
FT                   /old_locus_tag="BSU00130"
FT                   /product="seryl-tRNA synthetase"
FT                   /function="16.2: Construct biomass (Anabolism)"
FT                   /EC_number="6.1.1.11"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 10546897, 12682299, 14732487;
FT                   Product type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU00130"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11789"
FT                   /db_xref="GOA:P37464"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002317"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR015866"
FT                   /db_xref="InterPro:IPR033729"
FT                   /db_xref="InterPro:IPR042103"
FT                   /db_xref="SubtiList:BG10077"
FT                   /db_xref="UniProtKB/Swiss-Prot:P37464"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:10546897, 12682299, 14732487"
FT                   /protein_id="CAB11789.1"
FT                   /translation="MLDTKMLRANFQEIKAKLVHKGEDLTDFDKFEALDDRRRELIGKV
FT                   EELKGKRNEVSQQVAVLKREKKDADHIIKEMREVGEEIKKLDEELRTVEAELDTILLSI
FT                   PNIPHESVPVGETEDDNVEVRKWGEKPSFAYEPKPHWDIADELGILDFERAAKVTGSRF
FT                   VFYKGLGARLERALYNFMLDLHVDEYNYTEVIPPYMVNRASMTGTGQLPKFEEDAFKIR
FT                   EEDYFLIPTAEVPITNMHRDEILSGDSLPINYAAFSACFRSEAGSAGRDTRGLIRQHQF
FT                   NKVELVKFVKPEDSYEELEKLTNQAERVLQLLELPYRVMSMCTGDLGFTAAKKYDIEVW
FT                   IPSQDTYREISSCSNFEAFQARRANIRFRREAKGKPEHVHTLNGSGLAVGRTVAAILEN
FT                   YQQEDGSVVIPKVLRPYMGNREVMKP"
FT   gene            22292..22384
FT                   /gene="trnSL-Ser1"
FT                   /locus_tag="BSU_tRNA_7"
FT   tRNA            22292..22384
FT                   /gene="trnSL-Ser1"
FT                   /locus_tag="BSU_tRNA_7"
FT                   /product="tRNA-Ser"
FT                   /function="16.2: Construct biomass (Anabolism)"
FT                   /note="transfer RNA-Ser(UGA); Evidence 2a: Function from
FT                   experimental evidences in other organisms; Product type n:
FT                   RNA"
FT                   /inference="profile:tRNAscan:1.23"
FT   gene            complement(22496..23149)
FT                   /gene="dck"
FT                   /locus_tag="BSU_00140"
FT                   /old_locus_tag="BSU00140"
FT   CDS_pept        complement(22496..23149)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dck"
FT                   /locus_tag="BSU_00140"
FT                   /old_locus_tag="BSU00140"
FT                   /product="deoxyadenosine/deoxycytidine kinase"
FT                   /function="16.11: Scavenge (Catabolism)"
FT                   /EC_number="2.7.1.76"
FT                   /EC_number="2.7.1.74"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 6251049, 11078735; Product
FT                   type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU00140"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11790"
FT                   /db_xref="GOA:P37529"
FT                   /db_xref="InterPro:IPR002624"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031314"
FT                   /db_xref="SubtiList:BG10078"
FT                   /db_xref="UniProtKB/Swiss-Prot:P37529"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:6251049, 11078735"
FT                   /protein_id="CAB11790.1"
FT                   /translation="MKEHHIPKNSIITVAGTVGVGKSTLTKTLAKRLGFKTSLEEVDHN
FT                   PYLEKFYHDFERWSFHLQIYFLAERFKEQKTIFEAGGGFVQDRSIYEDTGIFAKMHADK
FT                   GTMSKVDYKTYTSLFEAMVMTPYFPHPDVLIYLEGDLENILNRIEQRGREMELQTSRSY
FT                   WEEMHTRYENWISGFNACPVLKLRIEDYDLLNDENSIENIVDQIASVIHDNQKK"
FT   gene            complement(23146..23769)
FT                   /gene="dgk"
FT                   /locus_tag="BSU_00150"
FT                   /old_locus_tag="BSU00150"
FT   CDS_pept        complement(23146..23769)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dgk"
FT                   /locus_tag="BSU_00150"
FT                   /old_locus_tag="BSU00150"
FT                   /product="deoxyguanosine kinase"
FT                   /function="16.11: Scavenge (Catabolism)"
FT                   /EC_number="2.7.1.113"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 11078735; Product type e:
FT                   enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU00150"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11791"
FT                   /db_xref="GOA:P37530"
FT                   /db_xref="InterPro:IPR002624"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031314"
FT                   /db_xref="SubtiList:BG10079"
FT                   /db_xref="UniProtKB/Swiss-Prot:P37530"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:11078735"
FT                   /protein_id="CAB11791.1"
FT                   /translation="MNTAPFIAIEGPIGAGKTTLATMLSQKFGFPMINEIVEDNPYLDK
FT                   FYDNIKEWSFQLEMFFLCHRYKQLEDTSDHFLKKGQPVIADYHIYKNVIFAERTLSPHQ
FT                   LEKYKKIYHLLTDDLPKPNFIIYIKASLPTLLHRIEKRGRPFEKKIETSYLEQLISDYE
FT                   VAIKQLQEADPELTVLTVDGDSKDFVLNKSDFERIAAHVKELIV"
FT   gene            complement(23868..25151)
FT                   /gene="sleL"
FT                   /locus_tag="BSU_00160"
FT                   /old_locus_tag="BSU00160"
FT   CDS_pept        complement(23868..25151)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sleL"
FT                   /locus_tag="BSU_00160"
FT                   /old_locus_tag="BSU00160"
FT                   /product="spore peptidoglycan N-acetylglucosaminidase"
FT                   /function="16.13: Shape"
FT                   /function="16.8: Protect"
FT                   /EC_number="3.2.1.-"
FT                   /note="Evidence 1c: Function from experimental evidences in
FT                   the studied genus; PubMedId: 11011148, 11737650, 12177332,
FT                   10419957, 18456807, 18835992, 19933362, 28333204; Product
FT                   type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU00160"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11792"
FT                   /db_xref="GOA:P37531"
FT                   /db_xref="InterPro:IPR001223"
FT                   /db_xref="InterPro:IPR011583"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR029070"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="InterPro:IPR041704"
FT                   /db_xref="SubtiList:BG10080"
FT                   /db_xref="UniProtKB/Swiss-Prot:P37531"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB11792.1"
FT                   /translation="MVKQGDTLSAIASQYRTTTNDITETNEIPNPDSLVVGQTIVIPIA
FT                   GQFYDVKRGDTLTSIARQFNTTAAELARVNRIQLNTVLQIGFRLYIPPAPKRDIESNAY
FT                   LEPRGNQVSENLQQAAREASPYLTYLGAFSFQAQRNGTLVAPPLTNLRSITESQNTTLM
FT                   MIITNLENQAFSDELGRILLNDETVKRRLLNEIVENARRYGFRDIHFDFEYLRPQDREA
FT                   YNQFLREARDLFHREGLEISTALAPKTSATQQGRWYEAHDYRAHGEIVDFVVLMTYEWG
FT                   YSGGPPQAVSPIGPVRDVIEYALTEMPANKIVMGQNLYGYDWTLPYTAGGTPARAVSPQ
FT                   QAIVIADQNNASIQYDQTAQAPFFRYTDAENRRHEVWFEDARSIQAKFNLIKELNLRGI
FT                   SYWKLGLSFPQNWLLLSDQFNVVKKTFR"
FT   gene            complement(25221..25766)
FT                   /gene="yaaI"
FT                   /locus_tag="BSU_00170"
FT                   /old_locus_tag="BSU00170"
FT   CDS_pept        complement(25221..25766)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaaI"
FT                   /locus_tag="BSU_00170"
FT                   /old_locus_tag="BSU00170"
FT                   /product="putative amidase (isochorismatase family)"
FT                   /function="16.11: Scavenge (Catabolism)"
FT                   /EC_number="3.-.-.-"
FT                   /note="Evidence 3: Putative function from multiple
FT                   computational evidences; PubMedId: 2521622; Product type e:
FT                   enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU00170"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11793"
FT                   /db_xref="GOA:P37532"
FT                   /db_xref="InterPro:IPR000868"
FT                   /db_xref="InterPro:IPR036380"
FT                   /db_xref="SubtiList:BG10081"
FT                   /db_xref="UniProtKB/Swiss-Prot:P37532"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB11793.1"
FT                   /translation="MSKADKALLIVDMINNFEFDMGETLAKKTEKIVPHILSLKEHARQ
FT                   NEWPIIYINDHYGLWQADIKNIQQECTNERSKDIITKIAPVDADYFLIKPKHSAFYETA
FT                   LHTLLTELQVRHIIITGIAGNICVLFTANDAYMREYSITIPKDCIASNSDEDNEFALTM
FT                   MENVLFAEITTEEQIIEK"
FT   gene            25852..26337
FT                   /gene="tadA"
FT                   /locus_tag="BSU_00180"
FT                   /old_locus_tag="BSU00180"
FT   CDS_pept        25852..26337
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tadA"
FT                   /locus_tag="BSU_00180"
FT                   /old_locus_tag="BSU00180"
FT                   /product="tRNA specific adenosine A34 deaminase"
FT                   /function="10.3: tRNA and rRNA base modification"
FT                   /function="16.2: Construct biomass (Anabolism)"
FT                   /EC_number="3.5.4.33"
FT                   /note="Evidence 2a: Function from experimental evidences in
FT                   other organisms; PubMedId: 15677468, 16014871, 16415880,
FT                   16700551, 23658230; Product type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU00180"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11794"
FT                   /db_xref="GOA:P21335"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR016192"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR028883"
FT                   /db_xref="SubtiList:BG10082"
FT                   /db_xref="UniProtKB/Swiss-Prot:P21335"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB11794.1"
FT                   /translation="MTQDELYMKEAIKEAKKAEEKGEVPIGAVLVINGEIIARAHNLRE
FT                   TEQRSIAHAEMLVIDEACKALGTWRLEGATLYVTLEPCPMCAGAVVLSRVEKVVFGAFD
FT                   PKGGCSGTLMNLLQEERFNHQAEVVSGVLEEECGGMLSAFFRELRKKKKAARKNLSE"
FT   gene            26379..26732
FT                   /gene="scr"
FT                   /locus_tag="BSU_misc_RNA_2"
FT   misc_RNA        26379..26732
FT                   /gene="scr"
FT                   /locus_tag="BSU_misc_RNA_2"
FT                   /product="small cytoplasmic RNA (scRNA, 4.5S RNA), signal
FT                   recognition particle-like (SRP) component"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 1372600, 1689715"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:1372600, 1689715"
FT   gene            26814..28505
FT                   /gene="dnaX"
FT                   /locus_tag="BSU_00190"
FT                   /old_locus_tag="BSU00190"
FT   CDS_pept        26814..28505
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaX"
FT                   /locus_tag="BSU_00190"
FT                   /old_locus_tag="BSU00190"
FT                   /product="DNA polymerase III subunit tau subunit"
FT                   /function="16.9: Replicate"
FT                   /EC_number="2.7.7.7"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 9341154, 10844689, 12466528,
FT                   12974630, 14757052, 15927750, 25850333, 26786318; Product
FT                   type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU00190"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11795"
FT                   /db_xref="GOA:P09122"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR012763"
FT                   /db_xref="InterPro:IPR022754"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="SubtiList:BG10083"
FT                   /db_xref="UniProtKB/Swiss-Prot:P09122"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:9341154, 10844689, 12466528, 12974630, 14757052,
FT                   15927750, 25850333, 26786318"
FT                   /protein_id="CAB11795.2"
FT                   /translation="MSYQALYRVFRPQRFEDVVGQEHITKTLQNALLQKKFSHAYLFSG
FT                   PRGTGKTSAAKIFAKAVNCEHAPVDEPCNECAACKGITNGSISDVIEIDAASNNGVDEI
FT                   RDIRDKVKFAPSAVTYKVYIIDEVHMLSIGAFNALLKTLEEPPEHCIFILATTEPHKIP
FT                   LTIISRCQRFDFKRITSQAIVGRMNKIVDAEQLQVEEGSLEIIASAADGGMRDALSLLD
FT                   QAISFSGDILKVEDALLITGAVSQLYIGKLAKSLHDKNVSDALETLNELLQQGKDPAKL
FT                   IEDMIFYFRDMLLYKTAPGLEGVLEKVKVDETFRELSEQIPAQALYEMIDILNKSHQEM
FT                   KWTNHPRIFFEVAVVKICQTSHQSAADLPEVDMLMKKIQQLEQEVERLKTTGIKAAAES
FT                   PKKEAPRVPKGGKSNYKAPVGRIHEILKEATRPDLDLLRNSWGKLLAHLKQQNKVSHAA
FT                   LLNDSEPVAAGSAAFVLKFKYEIHCKMVAEDNNGVRTNLEQILESMLGKRMDLIGVPEA
FT                   QWGKIREEFLEDHQQENEGSNEPAEEDPLIAEAKKLVGADLIEIKD"
FT   gene            28529..28852
FT                   /gene="ebfC"
FT                   /locus_tag="BSU_00200"
FT                   /old_locus_tag="BSU00200"
FT   CDS_pept        28529..28852
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ebfC"
FT                   /locus_tag="BSU_00200"
FT                   /old_locus_tag="BSU00200"
FT                   /product="nucleoid associated protein"
FT                   /function="16.3: Control"
FT                   /function="16.9: Replicate"
FT                   /note="Evidence 2a: Function from experimental evidences in
FT                   other organisms; PubMedId: 16740939, 19208644, 19594923,
FT                   20639362, 22333191, 22544270; Product type f : factor"
FT                   /db_xref="EnsemblGenomes-Gn:BSU00200"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11796"
FT                   /db_xref="GOA:P24281"
FT                   /db_xref="InterPro:IPR004401"
FT                   /db_xref="InterPro:IPR036894"
FT                   /db_xref="SubtiList:BG10084"
FT                   /db_xref="UniProtKB/Swiss-Prot:P24281"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB11796.1"
FT                   /translation="MRGGMGNMQKMMKQMQKMQKDMAKAQEELAEKVVEGTAGGGMVTV
FT                   KANGQKEILDVIIKEEVVDPEDIDMLQDLVLAATNEALKKVDEITNETMGQFTKGMNMP
FT                   GLF"
FT   gene            28867..29463
FT                   /gene="recR"
FT                   /locus_tag="BSU_00210"
FT                   /old_locus_tag="BSU00210"
FT   CDS_pept        28867..29463
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recR"
FT                   /locus_tag="BSU_00210"
FT                   /old_locus_tag="BSU00210"
FT                   /product="recA filament-DNA complex stabilisation factor"
FT                   /function="16.6: Maintain"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 12065426, 24285298, 24891441;
FT                   Product type f: factor"
FT                   /db_xref="EnsemblGenomes-Gn:BSU00210"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11797"
FT                   /db_xref="GOA:P24277"
FT                   /db_xref="InterPro:IPR000093"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR015967"
FT                   /db_xref="InterPro:IPR023627"
FT                   /db_xref="InterPro:IPR023628"
FT                   /db_xref="InterPro:IPR034137"
FT                   /db_xref="SubtiList:BG10085"
FT                   /db_xref="UniProtKB/Swiss-Prot:P24277"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:12065426, 24285298, 24891441"
FT                   /protein_id="CAB11797.1"
FT                   /translation="MQYPEPISKLIDSFMKLPGIGPKTAVRLAFFVLGMKEDVVLDFAK
FT                   ALVNAKRNLTYCSVCGHITDQDPCYICEDTRRDKSVICVVQDPKDVIAMEKMKEYNGQY
FT                   HVLHGAISPMDGIGPEDIKIPELLKRLQDDQVTEVILATNPNIEGEATAMYISRLLKPS
FT                   GIKLSRIAHGLPVGGDLEYADEVTLSKALEGRREL"
FT   gene            29481..29705
FT                   /gene="yaaL"
FT                   /locus_tag="BSU_00220"
FT                   /old_locus_tag="BSU00220"
FT   CDS_pept        29481..29705
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaaL"
FT                   /locus_tag="BSU_00220"
FT                   /old_locus_tag="BSU00220"
FT                   /product="conserved protein of unknown function"
FT                   /note="Evidence 4: Unknown function but conserved in other
FT                   organisms"
FT                   /db_xref="EnsemblGenomes-Gn:BSU00220"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11798"
FT                   /db_xref="InterPro:IPR019644"
FT                   /db_xref="SubtiList:BG10086"
FT                   /db_xref="UniProtKB/Swiss-Prot:P37533"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB11798.1"
FT                   /translation="MGFLRKKTLRREFDEKLTEQLFKQKEEWNRQKKLVEKSLEPSAEV
FT                   LYELKVAEAKYFFYLREAKQRNLKISRWK"
FT   gene            29772..30035
FT                   /gene="bofA"
FT                   /locus_tag="BSU_00230"
FT                   /old_locus_tag="BSU00230"
FT   CDS_pept        29772..30035
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bofA"
FT                   /locus_tag="BSU_00230"
FT                   /old_locus_tag="BSU00230"
FT                   /product="inhibitor of the pro-sigma(K) processing
FT                   machinery"
FT                   /function="16.3: Control"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 15087499, 17557826; Product
FT                   type r: regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BSU00230"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11799"
FT                   /db_xref="GOA:P24282"
FT                   /db_xref="InterPro:IPR010001"
FT                   /db_xref="SubtiList:BG10087"
FT                   /db_xref="UniProtKB/Swiss-Prot:P24282"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:15087499, 17557826"
FT                   /protein_id="CAB11799.2"
FT                   /translation="MEPIFIIGIILGLVILLFLSGSAAKPLKWIGITAVKFVAGALLLV
FT                   CVNMFGGSLGIHVPINLVTTAISGILGIPGIAALVVIKQFII"
FT   gene            30279..31832
FT                   /gene="rrnA-16S"
FT                   /locus_tag="BSU_rRNA_4"
FT   rRNA            30279..31832
FT                   /gene="rrnA-16S"
FT                   /locus_tag="BSU_rRNA_4"
FT                   /product="ribosomal RNA-16S"
FT                   /function="16.2: Construct biomass (Anabolism)"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; Product type n: RNA"
FT   gene            31932..32008
FT                   /gene="trnA-Ile"
FT                   /locus_tag="BSU_tRNA_8"
FT   tRNA            31932..32008
FT                   /gene="trnA-Ile"
FT                   /locus_tag="BSU_tRNA_8"
FT                   /product="tRNA-Ile"
FT                   /function="16.2: Construct biomass (Anabolism)"
FT                   /note="transfer RNA-Ile(GAU); Evidence 2a: Function from
FT                   experimental evidences in other organisms; Product type n:
FT                   RNA"
FT                   /inference="profile:tRNAscan:1.23"
FT   gene            32020..32095
FT                   /gene="trnA-Ala"
FT                   /locus_tag="BSU_tRNA_9"
FT   tRNA            32020..32095
FT                   /gene="trnA-Ala"
FT                   /locus_tag="BSU_tRNA_9"
FT                   /product="tRNA-Ala"
FT                   /function="16.2: Construct biomass (Anabolism)"
FT                   /note="transfer RNA-Ala(UGC); Evidence 2a: Function from
FT                   experimental evidences in other organisms; Product type n:
FT                   RNA"
FT                   /inference="profile:tRNAscan:1.23"
FT   gene            32177..35103
FT                   /gene="rrnA-23S"
FT                   /locus_tag="BSU_rRNA_5"
FT   rRNA            32177..35103
FT                   /gene="rrnA-23S"
FT                   /locus_tag="BSU_rRNA_5"
FT                   /product="ribosomal RNA-23S"
FT                   /function="16.2: Construct biomass (Anabolism)"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; Product type n: RNA"
FT   gene            35237..35355
FT                   /gene="rrnA-5S"
FT                   /locus_tag="BSU_rRNA_26"
FT   rRNA            35237..35355
FT                   /gene="rrnA-5S"
FT                   /locus_tag="BSU_rRNA_26"
FT                   /product="ribosomal RNA-5S"
FT                   /function="16.2: Construct biomass (Anabolism)"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; Product type n: RNA"
FT   gene            35531..35725
FT                   /gene="csfB"
FT                   /locus_tag="BSU_00240"
FT                   /old_locus_tag="BSU00240"
FT   CDS_pept        35531..35725
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="csfB"
FT                   /locus_tag="BSU_00240"
FT                   /old_locus_tag="BSU00240"
FT                   /product="forespore-specific anti-sigma factor"
FT                   /function="16.5: Explore"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 8759874, 15044948, 21935351,
FT                   26929302; Product type cp: cell process"
FT                   /db_xref="EnsemblGenomes-Gn:BSU00240"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11800"
FT                   /db_xref="GOA:P37534"
FT                   /db_xref="InterPro:IPR019700"
FT                   /db_xref="PDB:5N7Y"
FT                   /db_xref="SubtiList:BG10088"
FT                   /db_xref="UniProtKB/Swiss-Prot:P37534"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:8759874, 15044948, 21935351, 26929302"
FT                   /protein_id="CAB11800.1"
FT                   /translation="MDETVKLNHTCVICDQEKNRGIHLYTKFICLDCERKVISTSTSDP
FT                   DYAFYVKKLKSIHTPPLYS"
FT   gene            35845..36459
FT                   /gene="xpaC"
FT                   /locus_tag="BSU_00250"
FT                   /old_locus_tag="BSU00250"
FT   CDS_pept        35845..36459
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="xpaC"
FT                   /locus_tag="BSU_00250"
FT                   /old_locus_tag="BSU00250"
FT                   /product="putative phosphatase"
FT                   /function="16.11: Scavenge (Catabolism)"
FT                   /function="16.3: Control"
FT                   /note="Evidence 3: Putative function from multiple
FT                   computational evidences; PubMedId: 23155385; Product type
FT                   e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU00250"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11801"
FT                   /db_xref="GOA:P37467"
FT                   /db_xref="InterPro:IPR018770"
FT                   /db_xref="SubtiList:BG10089"
FT                   /db_xref="UniProtKB/Swiss-Prot:P37467"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB11801.1"
FT                   /translation="MQRFFHFLVWSLTSSATFVFIGILSFFGLNQSIFLSIVYGLASGA
FT                   AVYIAGIWNARRLFLKKHELTGREYAYIKKNLEEARQKMVRLRKALFQAKSIQMFKQNA
FT                   EMLRIVRRIYLLTKKEPKRFYQAERFFYQTLDSVVELTEKYAFLSSHPKKSKELSMSLS
FT                   ETRITLTELTKRLEEDLTQAMGDEIDELQFELDAAKHSLKK"
FT   gene            36478..37638
FT                   /gene="yaaN"
FT                   /locus_tag="BSU_00260"
FT                   /old_locus_tag="BSU00260"
FT   CDS_pept        36478..37638
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaaN"
FT                   /locus_tag="BSU_00260"
FT                   /old_locus_tag="BSU00260"
FT                   /product="putative toxic compound resistance protein"
FT                   /note="Evidence 4: Unknown function but conserved in other
FT                   organisms; PubMedId: 12533473, 20713661"
FT                   /db_xref="EnsemblGenomes-Gn:BSU00260"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11802"
FT                   /db_xref="InterPro:IPR008863"
FT                   /db_xref="SubtiList:BG10090"
FT                   /db_xref="UniProtKB/Swiss-Prot:P37535"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB11802.1"
FT                   /translation="MNRDQSDLHIDELLADPFGGNIEIPGSEAVKAEKEQVRLVDVLPE
FT                   ENKEKAIQLAGQIDHKNMQSIVLYGSQAQSKLLNFSHDMINHVQKKDVGEIGEILGELM
FT                   KKLEQVNPDDLQSKKKGFLARMFGRVSSSLQEVLSKYQKTSVQIDRISLKLEHSKNALI
FT                   SDNKLLEQLYEKNKEYFAALNVYIAAGELKLEELKTKTIPELKQQAESSDHNQMAVQEV
FT                   NDLIQFADRLDKRVHDLLLSRQITIQSAPQIRLIQNTNQALAEKIQSSIVTAIPLWKNQ
FT                   VAIALTLLRQRNAVDAQQKVSDTTNELLLKNAELLKTNTIETARANERGLVDIDTLKKV
FT                   QESLISTLEETLTIQEEGRIKRRQAEEELMMMEGDLKQKLITIKER"
FT   gene            37720..39162
FT                   /gene="yaaO"
FT                   /locus_tag="BSU_00270"
FT                   /old_locus_tag="BSU00270"
FT   CDS_pept        37720..39162
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaaO"
FT                   /locus_tag="BSU_00270"
FT                   /old_locus_tag="BSU00270"
FT                   /product="putative decarboxylase"
FT                   /function="16.11: Scavenge (Catabolism)"
FT                   /EC_number="4.1.1.-"
FT                   /note="Evidence 3: Putative function from multiple
FT                   computational evidences; PubMedId: 9723923, 20876533,
FT                   24529384; Product type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU00270"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11803"
FT                   /db_xref="GOA:P37536"
FT                   /db_xref="InterPro:IPR000310"
FT                   /db_xref="InterPro:IPR008286"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR036633"
FT                   /db_xref="SubtiList:BG10091"
FT                   /db_xref="UniProtKB/Swiss-Prot:P37536"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB11803.1"
FT                   /translation="MNTPLYKALIQHARRNSHSFHVPGHHNGDVFFDDAKSIFDPLLTI
FT                   DVTELAGLDDLHHPSGVIKEAQELASQLYGSAESFFLVNGTTVGNLAMILSVCEPGDTI
FT                   LVQRNCHKSVFHAVDLSGAEPVYLAPDVDSAMHVPTHVPLGTIKEALEAYPDAKGLVLT
FT                   NPTYYGHSADLTEIITEAHHYGIPVLVDEAHGAHFILGEPFPVSALKMGADIVVQSAHK
FT                   TLPAMTMGSYLHLNSSCRINRDRVAEYLNRLQSSSPSYPIMASLDIARAYVQHIIEEQK
FT                   LSDILQRIETLKQTFDSLTNAEAVNPANPLIITDPLKLTIRSKRGHSGYTLQSILERAN
FT                   IFTELADENQVLLVLPLGGKRRINAEIIRSIDEEIEKTPPDQTFVSAEWGVQPVTVLPY
FT                   PKKVLHSFKKEYVSFEEAAGRLNAEDIIPYPPGIPMIMAGERITKESVQKLSRLISMKT
FT                   HVQGNMKIKEKQLLVYIEEEKS"
FT   gene            39159..39797
FT                   /gene="tmk"
FT                   /locus_tag="BSU_00280"
FT                   /old_locus_tag="BSU00280"
FT   CDS_pept        39159..39797
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tmk"
FT                   /locus_tag="BSU_00280"
FT                   /old_locus_tag="BSU00280"
FT                   /product="thymidylate kinase"
FT                   /function="16.2: Construct biomass (Anabolism)"
FT                   /EC_number="2.7.4.9"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 9696781, 12682299, 18523102;
FT                   Product type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU00280"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11804"
FT                   /db_xref="GOA:P37537"
FT                   /db_xref="InterPro:IPR018094"
FT                   /db_xref="InterPro:IPR018095"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR039430"
FT                   /db_xref="SubtiList:BG10092"
FT                   /db_xref="UniProtKB/Swiss-Prot:P37537"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:9696781, 12682299, 18523102"
FT                   /protein_id="CAB11804.2"
FT                   /translation="MSGLFITFEGPEGAGKTTVLQEIKNILTAEGLQVMATREPGGIDI
FT                   AEQIREVILNENNILMDPKTEALLYAAARRQHLVEKVKPALEQGFIVLCDRFIDSSLAY
FT                   QGYARGLGIDEVLSINEFAIGDMMPHVTVYFSIDPEEGLKRIYANGSREKNRLDLEKLD
FT                   FHTKVQEGYQELMKRFPERFHSVDAGQSKDLVVQDVLKVIDEALKKIQL"
FT   gene            39871..40200
FT                   /gene="darA"
FT                   /locus_tag="BSU_00290"
FT                   /old_locus_tag="BSU00290"
FT   CDS_pept        39871..40200
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="darA"
FT                   /locus_tag="BSU_00290"
FT                   /old_locus_tag="BSU00290"
FT                   /product="signal transduction receptor, cyclic di-AMP
FT                   binding"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 10913081, 25433025; Product
FT                   type rc: receptor"
FT                   /db_xref="EnsemblGenomes-Gn:BSU00290"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11805"
FT                   /db_xref="InterPro:IPR010375"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="PDB:4RLE"
FT                   /db_xref="SubtiList:BG10093"
FT                   /db_xref="UniProtKB/Swiss-Prot:P37538"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:10913081, 25433025"
FT                   /protein_id="CAB11805.1"
FT                   /translation="MKLIVAVVQDQDSNRLLKTLTDHNFRVTKLATTGGFLKSGNTTFM
FT                   IGVEDIRVNKALSLIKENGQKRDQMIAPVSPMGGNADSYVPYPVEVEVGGATVFVLPVD
FT                   EFHQF"
FT   gene            40213..40653
FT                   /gene="yaaR"
FT                   /locus_tag="BSU_00300"
FT                   /old_locus_tag="BSU00300"
FT   CDS_pept        40213..40653
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaaR"
FT                   /locus_tag="BSU_00300"
FT                   /old_locus_tag="BSU00300"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4: Unknown function but conserved in other
FT                   organisms; PubMedId: 22333191, 22720735"
FT                   /db_xref="EnsemblGenomes-Gn:BSU00300"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11806"
FT                   /db_xref="InterPro:IPR005585"
FT                   /db_xref="InterPro:IPR024042"
FT                   /db_xref="SubtiList:BG10094"
FT                   /db_xref="UniProtKB/Swiss-Prot:P37539"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB11806.1"
FT                   /translation="MKINKDIRTFIDNKQIPSVKTSEITASFKTSMENQSSKMKLDQLT
FT                   RLLSDIEAFGKRLTKSRNFKDLARFKGLVKRFVKEAVDSGLSHETSKSFDLYGNSRTLG
FT                   LVKEIDDKLIQLTEEMMDQEKPAIDLLERIGEIKGLLINLYT"
FT   gene            40665..41654
FT                   /gene="holB"
FT                   /locus_tag="BSU_00310"
FT                   /old_locus_tag="BSU00310"
FT   CDS_pept        40665..41654
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="holB"
FT                   /locus_tag="BSU_00310"
FT                   /old_locus_tag="BSU00310"
FT                   /product="DNA polymerase III clamp loader delta' subunit"
FT                   /function="16.9: Replicate"
FT                   /EC_number="2.7.7.7"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 8509334, 12060778, 12682299,
FT                   22333191, 23525462; Product type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU00310"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11807"
FT                   /db_xref="GOA:P37540"
FT                   /db_xref="InterPro:IPR004622"
FT                   /db_xref="InterPro:IPR015199"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="SubtiList:BG10095"
FT                   /db_xref="UniProtKB/Swiss-Prot:P37540"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:8509334, 12060778, 12682299, 22333191, 23525462"
FT                   /protein_id="CAB11807.1"
FT                   /translation="MAISWKEMNELQPRVMKLLYNSIEKDRLSHAYLFEGKKGTGKLDA
FT                   ALLLAKSFFCLEGGAEPCESCRNCKRIESGNHPDLHLVQPDGLSIKKAQIQALQEEFSK
FT                   TGLESHKKLYIISHADQMTANAANSLLKFLEEPNKDTMAVLITEQPQRLLDTIISRCQT
FT                   LPFQPLQPKAIEDRLIEQDVSPHMARLLANMTNNVAEAVELSRNDEFAESRAKVIKLYE
FT                   VLHQRKGHAFFFIQDQWMPFFKEKTHQEMGLDMLLLIYRDVLSIQIGNEDKLIYQDLFQ
FT                   SIKQHALQSTQQSVTNQILAVLEAKKRLHSNVNVQGLMEHLVLMLQEG"
FT   gene            41657..42484
FT                   /gene="ricT"
FT                   /locus_tag="BSU_00320"
FT                   /old_locus_tag="BSU00320"
FT   CDS_pept        41657..42484
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ricT"
FT                   /locus_tag="BSU_00320"
FT                   /old_locus_tag="BSU00320"
FT                   /product="subunit of a sporulation, competence and biofilm
FT                   formation regulatory complex of RNaseY (RicAFT complex /
FT                   FAD / two [4Fe-4S]2+)"
FT                   /function="16.3: Control"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 12270811, 23490197, 26434553,
FT                   27501195, 28295778; Product type r: regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BSU00320"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11808"
FT                   /db_xref="GOA:P37541"
FT                   /db_xref="InterPro:IPR007557"
FT                   /db_xref="SubtiList:BG10096"
FT                   /db_xref="UniProtKB/Swiss-Prot:P37541"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:12270811, 23490197, 26434553, 27501195, 28295778"
FT                   /protein_id="CAB11808.1"
FT                   /translation="MYNVIGVRFKKAGKIYYFDPNGFHIEHDSCVIVETVRGVEYGQVV
FT                   IANKQVDEHDVVLPLRKVIRVADDRDLLIVEENKQEALSAFDICQKKVIEHGLDMKLVD
FT                   VEFTFDRNKVIFYFTADGRVDFRELVKDLASIFKTRIELRQIGVRDEAKMLGGIGPCGR
FT                   MLCCSTFLGDFEPVSIKMAKDQNLSLNPTKISGLCGRLMCCLKYENDEYETAKEQLPDI
FT                   GEMITTANGPAKVVGLNILERVLQVELINREKVIEYTWEELLEEGVVSAQTTD"
FT   gene            42499..42858
FT                   /gene="dnaH"
FT                   /locus_tag="BSU_00330"
FT                   /old_locus_tag="BSU00330"
FT   CDS_pept        42499..42858
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaH"
FT                   /locus_tag="BSU_00330"
FT                   /old_locus_tag="BSU00330"
FT                   /product="subunit of the DNA replication complex"
FT                   /function="16.9: Replicate"
FT                   /function="16.3: Control"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 15927750, 16461910, 19737352,
FT                   21895792, 23909787, 28166228; Product type f : factor"
FT                   /db_xref="EnsemblGenomes-Gn:BSU00330"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11809"
FT                   /db_xref="GOA:P37542"
FT                   /db_xref="InterPro:IPR010377"
FT                   /db_xref="PDB:5DOL"
FT                   /db_xref="SubtiList:BG10097"
FT                   /db_xref="UniProtKB/Swiss-Prot:P37542"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:15927750, 16461910, 19737352, 21895792, 23909787,
FT                   28166228"
FT                   /protein_id="CAB11809.1"
FT                   /translation="MDKKELFDTVINLEEQIGSLYRQLGDLKQHIGEMIEENHHLQLEN
FT                   KHLRKRLDDTTQQIEKFKADKKESKTQKTEQTDIGEGYDNLARLYQEGFHICNVHYGSV
FT                   RKEDCLFCLSFLNKK"
FT   gene            42917..43660
FT                   /gene="trmNF"
FT                   /locus_tag="BSU_00340"
FT                   /old_locus_tag="BSU00340"
FT   CDS_pept        42917..43660
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trmNF"
FT                   /locus_tag="BSU_00340"
FT                   /old_locus_tag="BSU00340"
FT                   /product="tRNA1(Val) (adenine(37)-N6)-methyltransferase"
FT                   /function="16.3: Control"
FT                   /function="10.3: tRNA and rRNA base modification"
FT                   /function="16.2: Construct biomass (Anabolism)"
FT                   /EC_number="2.1.1.223"
FT                   /note="Evidence 2a: Function from experimental evidences in
FT                   other organisms; PubMedId: 22905870, 24809820; Product type
FT                   e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU00340"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11810"
FT                   /db_xref="GOA:P37543"
FT                   /db_xref="InterPro:IPR007848"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="SubtiList:BG10098"
FT                   /db_xref="UniProtKB/Swiss-Prot:P37543"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB11810.1"
FT                   /translation="MVSLHDDERLDYLLAEDMKIIQSPTVFAFSLDAVLLSKFAYVPIQ
FT                   KGKIVDLCTGNGIVPLLLSTRSKADILGVEIQERLHDMAVRSVEYNKLDDQIQIIHDDL
FT                   KNMPEKLGHNRYDVVTCNPPYFKTPKQTEQNMNEHLRIARHEIHCTLEDVISVSSKLLK
FT                   QGGKAALVHRPGRLLEIFELMKAYQIEPKRVQFVYPKQGKEANTILVEGIKGGRPDLKI
FT                   LPPLFVYDEQNEYTKEIRTILYGDK"
FT   gene            43647..43946
FT                   /gene="yazA"
FT                   /locus_tag="BSU_00350"
FT                   /old_locus_tag="BSU00350"
FT   CDS_pept        43647..43946
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yazA"
FT                   /locus_tag="BSU_00350"
FT                   /old_locus_tag="BSU00350"
FT                   /product="putative UvrC-Intron-type (URI) endonuclease"
FT                   /function="16.6: Maintain"
FT                   /function="16.11: Scavenge (Catabolism)"
FT                   /note="Evidence 3: Putative function from multiple
FT                   computational evidences; PubMedId: 11483577; Product type
FT                   e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU00350"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11811"
FT                   /db_xref="InterPro:IPR000305"
FT                   /db_xref="InterPro:IPR035901"
FT                   /db_xref="SubtiList:BG12700"
FT                   /db_xref="UniProtKB/Swiss-Prot:O31414"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB11811.1"
FT                   /translation="METNNHFFYVVKCKDNSWYAGYTNDLHKRVKTHNDGKGAKYTKVR
FT                   RPVELIFAESFSTKREAMQAEYYFKKLTRKKKELYIEEKRNSKEAVYVKAPNEL"
FT   gene            43921..44799
FT                   /gene="rsmI"
FT                   /locus_tag="BSU_00360"
FT                   /old_locus_tag="BSU00360"
FT   CDS_pept        43921..44799
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rsmI"
FT                   /locus_tag="BSU_00360"
FT                   /old_locus_tag="BSU00360"
FT                   /product="16S rRNA 2'-O-ribose C1402 methyltransferase"
FT                   /function="16.8: Protect"
FT                   /function="16.3: Control"
FT                   /EC_number="2.1.1.198"
FT                   /note="Evidence 2a: Function from experimental evidences in
FT                   other organisms; PubMedId: 16014871, 19965768, 25893373;
FT                   Product type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU00360"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11812"
FT                   /db_xref="GOA:P37544"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR008189"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR018063"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="SubtiList:BG10099"
FT                   /db_xref="UniProtKB/Swiss-Prot:P37544"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB11812.1"
FT                   /translation="MLRRQMSFNGKSDMGILYLVPTPIGNLEDMTFRAIDTLKSVDAIA
FT                   AEDTRQTKKLCHVYEIETPLVSYHEHNKESSGHKIIEWLKSGKNIALVSDAGLPTISDP
FT                   GAEIVKDFTDIGGYVVPLPGANAALTALIASGIVPQPFFFYGFLNRQKKEKKKELEALK
FT                   KRQETIIFYEAPHRLKETLSAMAEILGDREIAVTRELTKKYEEFIRGTISEVIGWANED
FT                   QIRGEFCLVVEGSNNEEVDEEEQWWETLTAKEHVEHYISKGATSKEAIKKAAVDRNVPK
FT                   REVYDAYHIKQ"
FT   gene            complement(44848..45138)
FT                   /gene="abrB"
FT                   /locus_tag="BSU_00370"
FT                   /old_locus_tag="BSU00370"
FT   CDS_pept        complement(44848..45138)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="abrB"
FT                   /locus_tag="BSU_00370"
FT                   /old_locus_tag="BSU00370"
FT                   /product="transcriptional regulator for transition state
FT                   genes (AbrB-SurF)"
FT                   /function="16.3: Control"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 10754235, 10809710, 11101881,
FT                   11101897, 16159768, 16223496, 16702211, 25308864, 25381239,
FT                   18676675, 22183144, 23196984, 24832089, 24847778, 25288929;
FT                   Product type r: regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BSU00370"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11813"
FT                   /db_xref="GOA:P08874"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="InterPro:IPR037914"
FT                   /db_xref="InterPro:IPR040678"
FT                   /db_xref="PDB:1YFB"
FT                   /db_xref="PDB:1YSF"
FT                   /db_xref="PDB:1Z0R"
FT                   /db_xref="PDB:2K1N"
FT                   /db_xref="PDB:2MJG"
FT                   /db_xref="PDB:2RO4"
FT                   /db_xref="SubtiList:BG10100"
FT                   /db_xref="UniProtKB/Swiss-Prot:P08874"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:10754235, 10809710, 11101881, 11101897, 16159768,
FT                   16223496, 16702211, 25308864, 25381239, 18676675, 22183144,
FT                   23196984, 24832089, 24847778, 25288929"
FT                   /protein_id="CAB11813.1"
FT                   /translation="MFMKSTGIVRKVDELGRVVIPIELRRTLGIAEKDALEIYVDDEKI
FT                   ILKKYKPNMTCQVTGEVSDDNLKLAGGKLVLSKEGAEQIISEIQNQLQNLK"
FT   gene            45633..47627
FT                   /gene="metS"
FT                   /locus_tag="BSU_00380"
FT                   /old_locus_tag="BSU00380"
FT   CDS_pept        45633..47627
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metS"
FT                   /locus_tag="BSU_00380"
FT                   /old_locus_tag="BSU00380"
FT                   /product="methionyl-tRNA synthetase"
FT                   /function="16.2: Construct biomass (Anabolism)"
FT                   /EC_number="6.1.1.10"
FT                   /note="Evidence 1c: Function from experimental evidences in
FT                   the studied genus; PubMedId: 11233169, 12682299, 12792655;
FT                   Product type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU00380"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11814"
FT                   /db_xref="GOA:P37465"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002547"
FT                   /db_xref="InterPro:IPR004495"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014758"
FT                   /db_xref="InterPro:IPR015413"
FT                   /db_xref="InterPro:IPR023457"
FT                   /db_xref="InterPro:IPR033911"
FT                   /db_xref="InterPro:IPR041872"
FT                   /db_xref="SubtiList:BG10101"
FT                   /db_xref="UniProtKB/Swiss-Prot:P37465"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB11814.1"
FT                   /translation="MPQENNTFYITTPIYYPSGKLHIGHAYTTVAGDAMARYKRLKGFD
FT                   VRYLTGTDEHGQKIQQKAEQENITPQEYVDRAAADIQKLWKQLEISNDDFIRTTEKRHK
FT                   VVIEKVFQKLLDNGDIYLDEYEGWYSIPDETFYTETQLVDIERNEKGEVIGGKSPDSGH
FT                   PVELIKEESYFFRMGKYADRLLKYYEENPTFIQPESRKNEMINNFIKPGLEDLAVSRTT
FT                   FDWGVKVPENPKHVVYVWIDALFNYLTALGYDTENDELYQKYWPADVHLVGKEIVRFHT
FT                   IYWPIMLMALDLPLPKQVFAHGWLLMKDGKMSKSKGNVVDPVTLIERYGLDELRYYLLR
FT                   EVPFGSDGVFTPEGFVERINYDLANDLGNLLNRTVAMINKYFDGQIGSYKGAVTEFDHT
FT                   LTSVAEETVKAYEKAMENMEFSVALSTLWQLISRTNKYIDETAPWVLAKDPAKEEELRS
FT                   VMYHLAESLRISAVLLQPFLTKTPEKMFEQLGITDESLKAWDSITAFGQLKDTKVQKGE
FT                   PLFPRLEAEEEIAYIKGKMQGSAPAKEETKEEEPQEVDRLPEITIDQFMDVELRVAEVI
FT                   EAEPVKKADRLLKLQLDLGFEKRQVVSGIAKHYTPEELVGKKLVCVTNLKPVKLRGELS
FT                   QGMILAGEADGVLKVVSIDQSLPKGTRIK"
FT   gene            47706..48473
FT                   /gene="dayD"
FT                   /locus_tag="BSU_00390"
FT                   /old_locus_tag="BSU00390"
FT   CDS_pept        47706..48473
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dayD"
FT                   /locus_tag="BSU_00390"
FT                   /old_locus_tag="BSU00390"
FT                   /product="D-amino acyl-tRNA deacylase"
FT                   /function="16.11: Scavenge (Catabolism)"
FT                   /function="16.6: Maintain"
FT                   /EC_number="3.1.-.-"
FT                   /note="Evidence 2a: Function from experimental evidences in
FT                   other organisms; PubMedId: 10747959, 16014871, 16461678,
FT                   19332551; Product type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU00390"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11815"
FT                   /db_xref="GOA:P37545"
FT                   /db_xref="InterPro:IPR001130"
FT                   /db_xref="InterPro:IPR015991"
FT                   /db_xref="InterPro:IPR018228"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="SubtiList:BG10102"
FT                   /db_xref="UniProtKB/Swiss-Prot:P37545"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB11815.1"
FT                   /translation="MLFDTHAHLNAEQYDTDLEEVIERAKAEKVERIVVVGFDRPTITR
FT                   AMEMIEEYDFIYAAIGWHPVDAIDMTEEDLAWIKELSAHEKVVAIGEMGLDYHWDKSPK
FT                   DIQKEVFRNQIALAKEVNLPIIIHNRDATEDVVTILKEEGAEAVGGIMHCFTGSAEVAR
FT                   ECMKMNFYLSFGGPVTFKNAKKPKEVVKEIPNDRLLIETDCPFLTPHPFRGKRNEPSYV
FT                   KYVAEQIAELKEMTFEEIASITTENAKRLFRIN"
FT   gene            48629..49942
FT                   /gene="yabE"
FT                   /locus_tag="BSU_00400"
FT                   /old_locus_tag="BSU00400"
FT   CDS_pept        48629..49942
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yabE"
FT                   /locus_tag="BSU_00400"
FT                   /old_locus_tag="BSU00400"
FT                   /product="putative cell wall shaping enzyme"
FT                   /function="16.13: Shape"
FT                   /note="Evidence 3: Putative function from multiple
FT                   computational evidences; PubMedId: 15774001, 19047346;
FT                   Product type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU00400"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11816"
FT                   /db_xref="GOA:P37546"
FT                   /db_xref="InterPro:IPR007137"
FT                   /db_xref="InterPro:IPR010611"
FT                   /db_xref="InterPro:IPR011098"
FT                   /db_xref="InterPro:IPR036908"
FT                   /db_xref="SubtiList:BG10103"
FT                   /db_xref="UniProtKB/Swiss-Prot:P37546"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB11816.1"
FT                   /translation="MGEREGRVDSLLDTLYNLSEEKEAFFITQKMKKLFSVKLSKSKVI
FT                   LVAACLLLAGSGTAYAAHELTKQSVSVSINGKKKHIRTHANTVGDLLETLDIKTRDEDK
FT                   ITPAKQTKITADMDVVYEAAKPVKLTINGEEKTLWSTAKTVGALLDEQDVDVKEQDQID
FT                   PAIDTDISKDMKINIEPAFQVTVNDAGKQKKIWTTSTTVADFLKQQKMNIKDEDKIKPA
FT                   LDAKLTKGKADITITRIEKVTDVVEEKIAFDVKKQEDASLEKGKEKVVQKGKEGKLKKH
FT                   FEVVKENGKEVSRELVKEETAEQSKDKVIAVGTKQSSPKFETVSASGDSKTVVSRSNES
FT                   TGKVMTVSSTAYTASCSGCSGHTATGVNLKNNPNAKVIAVDPNVIPLGSKVHVEGYGYA
FT                   IAADTGSAIKGNKIDVFFPEKSSAYRWGNKTVKIKILN"
FT   gene            50087..50647
FT                   /gene="rnmV"
FT                   /locus_tag="BSU_00410"
FT                   /old_locus_tag="BSU00410"
FT   CDS_pept        50087..50647
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rnmV"
FT                   /locus_tag="BSU_00410"
FT                   /old_locus_tag="BSU00410"
FT                   /product="ribonuclease M5"
FT                   /function="16.6: Maintain"
FT                   /EC_number="3.1.26.8"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 11233981, 11976317, 12794188,
FT                   16077031; Product type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU00410"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11817"
FT                   /db_xref="GOA:P37547"
FT                   /db_xref="InterPro:IPR004466"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR025156"
FT                   /db_xref="InterPro:IPR034141"
FT                   /db_xref="SubtiList:BG10104"
FT                   /db_xref="UniProtKB/Swiss-Prot:P37547"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:11233981, 11976317, 12794188, 16077031"
FT                   /protein_id="CAB11817.1"
FT                   /translation="MKIKEIIVVEGRDDTARIKLAVDADTIETNGSAIDDHVIDQIRLA
FT                   QKTRGVIILTDPDFPGEKIRKTISEAVPGCKHAFLPKHLAKPKNKRGIGVEHASVESIR
FT                   ACLENVHEEMEAQPSDISAEDLIHAGLIGGPAAKCRRERLGDLLKIGYTNGKQLQKRLQ
FT                   MFQIKKSDFMSALDTVMREEQNE"
FT   gene            50640..51518
FT                   /gene="rsmA"
FT                   /locus_tag="BSU_00420"
FT                   /old_locus_tag="BSU00420"
FT   CDS_pept        50640..51518
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rsmA"
FT                   /locus_tag="BSU_00420"
FT                   /old_locus_tag="BSU00420"
FT                   /product="dimethyladenosine 16S ribosomal RNA transferase"
FT                   /function="16.6: Maintain"
FT                   /function="16.8: Protect"
FT                   /EC_number="2.1.1.-"
FT                   /note="Evidence 1c: Function from experimental evidences in
FT                   the studied genus; PubMedId: 99430, 6801425, 11327780,
FT                   1690648, 22391551; Product type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU00420"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11818"
FT                   /db_xref="GOA:P37468"
FT                   /db_xref="InterPro:IPR001737"
FT                   /db_xref="InterPro:IPR011530"
FT                   /db_xref="InterPro:IPR020596"
FT                   /db_xref="InterPro:IPR020598"
FT                   /db_xref="InterPro:IPR023165"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="PDB:6IFS"
FT                   /db_xref="PDB:6IFT"
FT                   /db_xref="PDB:6IFV"
FT                   /db_xref="PDB:6IFW"
FT                   /db_xref="SubtiList:BG10105"
FT                   /db_xref="UniProtKB/Swiss-Prot:P37468"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB11818.1"
FT                   /translation="MNKDIATPIRTKEILKKYGFSFKKSLGQNFLIDTNILNRIVDHAE
FT                   VTEKTGVIEIGPGIGALTEQLAKRAKKVVAFEIDQRLLPILKDTLSPYENVTVIHQDVL
FT                   KADVKSVIEEQFQDCDEIMVVANLPYYVTTPIIMKLLEEHLPLKGIVVMLQKEVAERMA
FT                   ADPSSKEYGSLSIAVQFYTEAKTVMIVPKTVFVPQPNVDSAVIRLILRDGPAVDVENES
FT                   FFFQLIKASFAQRRKTLLNNLVNNLPEGKAQKSTIEQVLEETNIDGKRRGESLSIEEFA
FT                   ALSNGLYKALF"
FT   gene            51680..52552
FT                   /gene="prtG"
FT                   /locus_tag="BSU_00430"
FT                   /old_locus_tag="BSU00430"
FT   CDS_pept        51680..52552
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prtG"
FT                   /locus_tag="BSU_00430"
FT                   /old_locus_tag="BSU00430"
FT                   /product="sporulation-specific protease"
FT                   /function="16.5: Explore"
FT                   /function="16.13: Shape"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 10714992, 11040425, 16751597,
FT                   19060142, 19833771; Product type cp: cell process"
FT                   /db_xref="EnsemblGenomes-Gn:BSU00430"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11819"
FT                   /db_xref="GOA:P37548"
FT                   /db_xref="InterPro:IPR008764"
FT                   /db_xref="SubtiList:BG10106"
FT                   /db_xref="UniProtKB/Swiss-Prot:P37548"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:10714992, 11040425, 16751597, 19060142, 19833771"
FT                   /protein_id="CAB11819.1"
FT                   /translation="MQFQIGDMVARKSYQMDVLFRIIGIEQTSKGNSIAILHGDEVRLI
FT                   ADSDFSDLVAVKKDEQMMRKKKDESRMNESLELLRQDYKLLREKQEYYATSQYQHQEHY
FT                   FHMPGKVLHLDGDEAYLKKCLNVYKKIGVPVYGIHCHEKKMSASIEVLLDKYRPDILVI
FT                   TGHDAYSKQKGGIDDLNAYRHSKHFVETVQTARKKIPHLDQLVIFAGACQSHFESLIRA
FT                   GANFASSPSRVNIHALDPVYIVAKISFTPFMERINVWEVLRNTLTREKGLGGIETRGVL
FT                   RIGMPYKSN"
FT   gene            52763..53023
FT                   /gene="veg"
FT                   /locus_tag="BSU_00440"
FT                   /old_locus_tag="BSU00440"
FT   CDS_pept        52763..53023
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="veg"
FT                   /locus_tag="BSU_00440"
FT                   /old_locus_tag="BSU00440"
FT                   /product="conserved hypothetical protein"
FT                   /function="16.11: Scavenge (Catabolism)"
FT                   /note="Evidence 4: Unknown function but conserved in other
FT                   organisms; PubMedId: 12761295, 22720735, 23378512; Product
FT                   type ph: phenotype"
FT                   /db_xref="EnsemblGenomes-Gn:BSU00440"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11820"
FT                   /db_xref="GOA:P37466"
FT                   /db_xref="InterPro:IPR009366"
FT                   /db_xref="SubtiList:BG10107"
FT                   /db_xref="UniProtKB/Swiss-Prot:P37466"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB11820.1"
FT                   /translation="MAKTLSDIKRSLDGNLGKRLTLKANGGRRKTIERSGILAETYPSV
FT                   FVIQLDQDENSFERVSYSYADILTETVELTFNDDAASSVAF"
FT   gene            53183..53368
FT                   /gene="sspF"
FT                   /locus_tag="BSU_00450"
FT                   /old_locus_tag="BSU00450"
FT   CDS_pept        53183..53368
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sspF"
FT                   /locus_tag="BSU_00450"
FT                   /old_locus_tag="BSU00450"
FT                   /product="small acid-soluble spore protein (alpha/beta-type
FT                   SASP)"
FT                   /function="16.5: Explore"
FT                   /function="16.8: Protect"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 7959056, 8982008, 11092849;
FT                   Product type cp: cell process"
FT                   /db_xref="EnsemblGenomes-Gn:BSU00450"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11821"
FT                   /db_xref="GOA:P37549"
FT                   /db_xref="InterPro:IPR001448"
FT                   /db_xref="InterPro:IPR018126"
FT                   /db_xref="InterPro:IPR038300"
FT                   /db_xref="SubtiList:BG10108"
FT                   /db_xref="UniProtKB/Swiss-Prot:P37549"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:7959056, 8982008, 11092849"
FT                   /protein_id="CAB11821.1"
FT                   /translation="MGRRRGVMSDEFKYELAKDLGFYDTVKNGGWGEIRARDAGNMVKR
FT                   AIEIAEQQMAQNQNNR"
FT   gene            53516..54385
FT                   /gene="ispE"
FT                   /locus_tag="BSU_00460"
FT                   /old_locus_tag="BSU00460"
FT   CDS_pept        53516..54385
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ispE"
FT                   /locus_tag="BSU_00460"
FT                   /old_locus_tag="BSU00460"
FT                   /product="4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol
FT                   kinase"
FT                   /function="16.2: Construct biomass (Anabolism)"
FT                   /EC_number="2.7.1.148"
FT                   /note="Evidence 2a: Function from experimental evidences in
FT                   other organisms; PubMedId: 11361082, 12682299, 12771135,
FT                   17458547, 23840410; Product type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU00460"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11822"
FT                   /db_xref="GOA:P37550"
FT                   /db_xref="InterPro:IPR004424"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR013750"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036554"
FT                   /db_xref="SubtiList:BG10109"
FT                   /db_xref="UniProtKB/Swiss-Prot:P37550"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB11822.1"
FT                   /translation="MRILEKAPAKINLSLDVTRKRPDGYHEVEMIMTTIDLADRIELTE
FT                   LAEDEVRVSSHNRFVPDDQRNLAYQAAKLIKDRYNVKKGVSIMITKVIPVAAGLAGGSS
FT                   DAAATLRGLNRLWNLNLSAETLAELGAEIGSDVSFCVYGGTALATGRGEKIKHISTPPH
FT                   CWVILAKPTIGVSTAEVYRALKLDGIEHPDVQGMIEAIEEKSFQKMCSRLGNVLESVTL
FT                   DMHPEVAMIKNQMKRFGADAVLMSGSGPTVFGLVQYESKVQRIYNGLRGFCDQVYAVRM
FT                   IGEQNALD"
FT   gene            54441..55298
FT                   /gene="purR"
FT                   /locus_tag="BSU_00470"
FT                   /old_locus_tag="BSU00470"
FT   CDS_pept        54441..55298
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purR"
FT                   /locus_tag="BSU_00470"
FT                   /old_locus_tag="BSU00470"
FT                   /product="transcriptional regulator of the purine
FT                   biosynthesis operon (PurR-pRpp)"
FT                   /function="16.3: Control"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 11591660, 12837783, 12837784,
FT                   15629952, 16163456, 27329548; Product type r : regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BSU00470"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11823"
FT                   /db_xref="GOA:P37551"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR010078"
FT                   /db_xref="InterPro:IPR015265"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="PDB:1O57"
FT                   /db_xref="PDB:1P4A"
FT                   /db_xref="SubtiList:BG10110"
FT                   /db_xref="UniProtKB/Swiss-Prot:P37551"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:11591660, 12837783, 12837784, 15629952, 16163456,
FT                   27329548"
FT                   /protein_id="CAB11823.1"
FT                   /translation="MKFRRSGRLVDLTNYLLTHPHELIPLTFFSERYESAKSSISEDLT
FT                   IIKQTFEQQGIGTLLTVPGAAGGVKYIPKMKQAEAEEFVQTLGQSLANPERILPGGYVY
FT                   LTDILGKPSVLSKVGKLFASVFAEREIDVVMTVATKGIPLAYAAASYLNVPVVIVRKDN
FT                   KVTEGSTVSINYVSGSSNRIQTMSLAKRSMKTGSNVLIIDDFMKAGGTINGMINLLDEF
FT                   NANVAGIGVLVEAEGVDERLVDEYMSLLTLSTINMKEKSIEIQNGNFLRFFKDNLLKNG
FT                   ETES"
FT   gene            55295..55672
FT                   /gene="ridA"
FT                   /locus_tag="BSU_00480"
FT                   /old_locus_tag="BSU00480"
FT   CDS_pept        55295..55672
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ridA"
FT                   /locus_tag="BSU_00480"
FT                   /old_locus_tag="BSU00480"
FT                   /product="aminoacrylate/iminopropionate
FT                   hydrolase/deaminase"
FT                   /function="16.3: Control"
FT                   /function="16.6: Maintain"
FT                   /EC_number="3.5.99.10"
FT                   /note="Evidence 2a: Function from experimental evidences in
FT                   other organisms; PubMedId: 2113912, 12515541, 14729707,
FT                   10557275, 10919400, 10368157, 20562306, 23815688; Product
FT                   type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU00480"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11824"
FT                   /db_xref="GOA:P37552"
FT                   /db_xref="InterPro:IPR006056"
FT                   /db_xref="InterPro:IPR006175"
FT                   /db_xref="InterPro:IPR019897"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="PDB:1QD9"
FT                   /db_xref="SubtiList:BG10111"
FT                   /db_xref="UniProtKB/Swiss-Prot:P37552"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB11824.1"
FT                   /translation="MTKAVHTKHAPAAIGPYSQGIIVNNMFYSSGQIPLTPSGEMVNGD
FT                   IKEQTHQVFSNLKAVLEEAGASFETVVKATVFIADMEQFAEVNEVYGQYFDTHKPARSC
FT                   VEVARLPKDALVEIEVIALVK"
FT   gene            55866..56159
FT                   /gene="spoVG"
FT                   /locus_tag="BSU_00490"
FT                   /old_locus_tag="BSU00490"
FT   CDS_pept        55866..56159
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="spoVG"
FT                   /locus_tag="BSU_00490"
FT                   /old_locus_tag="BSU00490"
FT                   /product="regulator required for spore cortex synthesis
FT                   (stage V sporulation)"
FT                   /function="16.13: Shape"
FT                   /function="16.3: Control"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 9733708, 10348850, 10648512,
FT                   16428420, 27048798; Product type r: regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BSU00490"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11825"
FT                   /db_xref="GOA:P28015"
FT                   /db_xref="InterPro:IPR007170"
FT                   /db_xref="InterPro:IPR036751"
FT                   /db_xref="PDB:2IA9"
FT                   /db_xref="SubtiList:BG10112"
FT                   /db_xref="UniProtKB/Swiss-Prot:P28015"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:9733708, 10348850, 10648512, 16428420, 27048798"
FT                   /protein_id="CAB11825.1"
FT                   /translation="MEVTDVRLRRVNTDGRMRAIASITLDHEFVVHDIRVIDGNNGLFV
FT                   AMPSKRTPDGEFRDITHPINSSTRGKIQDAVLNEYHRLGDTEALEFEEAGAS"
FT   gene            56352..57722
FT                   /gene="glmU"
FT                   /locus_tag="BSU_00500"
FT                   /old_locus_tag="BSU00500"
FT   CDS_pept        56352..57722
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glmU"
FT                   /locus_tag="BSU_00500"
FT                   /old_locus_tag="BSU00500"
FT                   /product="bifunctional glucosamine-1-phosphate
FT                   N-acetyltransferase/UDP-N-acetylglucosamine
FT                   pyrophosphorylase"
FT                   /function="16.2: Construct biomass (Anabolism)"
FT                   /EC_number="2.7.7.23"
FT                   /EC_number="2.3.1.157"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 1328164, 8522540, 9648743,
FT                   11124906, 20495944, 23485416, 24915076; Product type e:
FT                   enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU00500"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11826"
FT                   /db_xref="GOA:P14192"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR005882"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR038009"
FT                   /db_xref="SubtiList:BG10113"
FT                   /db_xref="UniProtKB/Swiss-Prot:P14192"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:1328164, 8522540, 9648743, 11124906, 20495944,
FT                   23485416, 24915076"
FT                   /protein_id="CAB11826.1"
FT                   /translation="MDKRFAVVLAAGQGTRMKSKLYKVLHPVCGKPMVEHVVDEALKLS
FT                   LSKLVTIVGHGAEEVKKQLGDKSEYALQAKQLGTAHAVKQAQPFLADEKGVTIVICGDT
FT                   PLLTAETMEQMLKEHTQREAKATILTAVAEDPTGYGRIIRSENGAVQKIVEHKDASEEE
FT                   RLVTEINTGTYCFDNEALFRAIDQVSNDNAQGEYYLPDVIEILKNEGETVAAYQTGNFQ
FT                   ETLGVNDRVALSQAEQFMKERINKRHMQNGVTLIDPMNTYISPDAVIGSDTVIYPGTVI
FT                   KGEVQIGEDTIIGPHTEIMNSAIGSRTVIKQSVVNHSKVGNDVNIGPFAHIRPDSVIGN
FT                   EVKIGNFVEIKKTQFGDRSKASHLSYVGDAEVGTDVNLGCGSITVNYDGKNKYLTKIED
FT                   GAFIGCNSNLVAPVTVGEGAYVAAGSTVTEDVPGKALAIARARQVNKDDYVKNIHKK"
FT   gene            57745..58698
FT                   /gene="prs"
FT                   /locus_tag="BSU_00510"
FT                   /old_locus_tag="BSU00510"
FT   CDS_pept        57745..58698
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prs"
FT                   /locus_tag="BSU_00510"
FT                   /old_locus_tag="BSU00510"
FT                   /product="phosphoribosylpyrophosphate synthetase"
FT                   /function="16.2: Construct biomass (Anabolism)"
FT                   /EC_number="2.7.6.1"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 2169413, 3038693, 8522540,
FT                   22083279, 25890046; Product type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU00510"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11827"
FT                   /db_xref="GOA:P14193"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR000842"
FT                   /db_xref="InterPro:IPR005946"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR029099"
FT                   /db_xref="InterPro:IPR037515"
FT                   /db_xref="PDB:1DKR"
FT                   /db_xref="PDB:1DKU"
FT                   /db_xref="PDB:1IBS"
FT                   /db_xref="SubtiList:BG10114"
FT                   /db_xref="UniProtKB/Swiss-Prot:P14193"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:2169413, 3038693, 8522540, 22083279, 25890046"
FT                   /protein_id="CAB11827.1"
FT                   /translation="MSNQYGDKNLKIFSLNSNPELAKEIADIVGVQLGKCSVTRFSDGE
FT                   VQINIEESIRGCDCYIIQSTSDPVNEHIMELLIMVDALKRASAKTINIVIPYYGYARQD
FT                   RKARSREPITAKLFANLLETAGATRVIALDLHAPQIQGFFDIPIDHLMGVPILGEYFEG
FT                   KNLEDIVIVSPDHGGVTRARKLADRLKAPIAIIDKRRPRPNVAEVMNIVGNIEGKTAIL
FT                   IDDIIDTAGTITLAANALVENGAKEVYACCTHPVLSGPAVERINNSTIKELVVTNSIKL
FT                   PEEKKIERFKQLSVGPLLAEAIIRVHEQQSVSYLFS"
FT   gene            58783..59397
FT                   /gene="ctc"
FT                   /locus_tag="BSU_00520"
FT                   /old_locus_tag="BSU00520"
FT   CDS_pept        58783..59397
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ctc"
FT                   /locus_tag="BSU_00520"
FT                   /old_locus_tag="BSU00520"
FT                   /product="ribosomal protein BL25 (Ctc), binding 5S RNA"
FT                   /function="16.2: Construct biomass (Anabolism)"
FT                   /function="16.6: Maintain"
FT                   /function="16.8: Protect"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 8522540, 9669336, 10369900,
FT                   12432960, 17198710; Product type f: factor"
FT                   /db_xref="EnsemblGenomes-Gn:BSU00520"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11828"
FT                   /db_xref="GOA:P14194"
FT                   /db_xref="InterPro:IPR001021"
FT                   /db_xref="InterPro:IPR011035"
FT                   /db_xref="InterPro:IPR020056"
FT                   /db_xref="InterPro:IPR020057"
FT                   /db_xref="InterPro:IPR029751"
FT                   /db_xref="InterPro:IPR037121"
FT                   /db_xref="SubtiList:BG10115"
FT                   /db_xref="UniProtKB/Swiss-Prot:P14194"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:8522540, 9669336, 10369900, 12432960, 17198710"
FT                   /protein_id="CAB11828.1"
FT                   /translation="MATLTAKERTDFTRSSLRNIRTSGHVPGIIYGKDTGNKPVSLDSV
FT                   ELIKTLRDEGKNAVITLEVSGEKHSVMVTDLQTDPLKNEITHADFQVVNMSEDIEVEVP
FT                   IHLTGEAIGVKNGGVLQQPLYALTVKAKPKAIPQTIEADISSLDVNEVLTIADLPAGGD
FT                   YSFNHESDEVVASILPPQQQEAAEVDEEESADAQPEGENEQ"
FT   gene            59504..60070
FT                   /gene="pth"
FT                   /locus_tag="BSU_00530"
FT                   /old_locus_tag="BSU00530"
FT   CDS_pept        59504..60070
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pth"
FT                   /locus_tag="BSU_00530"
FT                   /old_locus_tag="BSU00530"
FT                   /product="peptidyl-tRNA hydrolase"
FT                   /function="16.6: Maintain"
FT                   /function="16.8: Protect"
FT                   /function="16.11: Scavenge (Catabolism)"
FT                   /EC_number="3.1.1.29"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 8635758, 12100553, 12682299;
FT                   Product type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU00530"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11829"
FT                   /db_xref="GOA:P37470"
FT                   /db_xref="InterPro:IPR001328"
FT                   /db_xref="InterPro:IPR018171"
FT                   /db_xref="InterPro:IPR036416"
FT                   /db_xref="SubtiList:BG10116"
FT                   /db_xref="UniProtKB/Swiss-Prot:P37470"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:8635758, 12100553, 12682299"
FT                   /protein_id="CAB11829.1"
FT                   /translation="MLVIAGLGNPGKNYENTRHNVGFMVIDQLAKEWNIELNQNKFNGL
FT                   YGTGFVSGKKVLLVKPLTYMNLSGECLRPLMDYYDVDNEDLTVIYDDLDLPTGKIRLRT
FT                   KGSAGGHNGIKSLIQHLGTSEFDRIRIGIGRPVNGMKVVDYVLGSFTKEEAPEIEEAVD
FT                   KSVKACEASLSKPFLEVMNEFNAKV"
FT   gene            60130..60360
FT                   /gene="fin"
FT                   /locus_tag="BSU_00540"
FT                   /old_locus_tag="BSU00540"
FT   CDS_pept        60130..60360
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fin"
FT                   /locus_tag="BSU_00540"
FT                   /old_locus_tag="BSU00540"
FT                   /product="protein required for the switch from F to G
FT                   during sporulation (anti sigma F)"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 21037003, 28598017; Product
FT                   type f: factor"
FT                   /db_xref="EnsemblGenomes-Gn:BSU00540"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11830"
FT                   /db_xref="GOA:P37553"
FT                   /db_xref="InterPro:IPR020115"
FT                   /db_xref="PDB:5MSL"
FT                   /db_xref="SubtiList:BG10117"
FT                   /db_xref="UniProtKB/Swiss-Prot:P37553"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:21037003, 28598017"
FT                   /protein_id="CAB11830.1"
FT                   /translation="MALHYYCRHCGVKVGSLESSMVSTDSLGFQHLTNEERNDMISYKE
FT                   NGDVHVLTICEDCQEALDRNPHYHEYHTFIQ"
FT   gene            60430..63963
FT                   /gene="mfd"
FT                   /locus_tag="BSU_00550"
FT                   /old_locus_tag="BSU00550"
FT   CDS_pept        60430..63963
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mfd"
FT                   /locus_tag="BSU_00550"
FT                   /old_locus_tag="BSU00550"
FT                   /product="transcription-repair coupling factor"
FT                   /function="16.6: Maintain"
FT                   /function="16.8: Protect"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 8594198, 9535092, 11065368,
FT                   16950921, 22248542, 25713353, 27399782, 27435260; Product
FT                   type f: factor"
FT                   /db_xref="EnsemblGenomes-Gn:BSU00550"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11831"
FT                   /db_xref="GOA:P37474"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR003711"
FT                   /db_xref="InterPro:IPR004576"
FT                   /db_xref="InterPro:IPR005118"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036101"
FT                   /db_xref="InterPro:IPR037235"
FT                   /db_xref="InterPro:IPR041471"
FT                   /db_xref="SubtiList:BG10118"
FT                   /db_xref="UniProtKB/Swiss-Prot:P37474"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:8594198, 9535092, 11065368, 16950921, 22248542,
FT                   25713353, 27399782, 27435260"
FT                   /protein_id="CAB11831.1"
FT                   /translation="MDNIQTFIKESDDFKSIINGLHEGLKEQLLAGLSGSARSVFTSAL
FT                   ANETNKPIFLITHNLYQAQKVTDDLTSLLEDRSVLLYPVNELISSEIAVASPELRAQRL
FT                   DVINRLTNGEAPIVVAPVAAIRRMLPPVEVWKSSQMLIQVGHDIEPDQLASRLVEVGYE
FT                   RSDMVSAPGEFSIRGGIIDIYPLTSENPVRIELFDTEVDSIRSFNSDDQRSIETLTSIN
FT                   IGPAKELIIRPEEKARAMEKIDSGLAASLKKLKADKQKEILHANISHDKERLSEGQTDQ
FT                   ELVKYLSYFYEKPASLLDYTPDNTLLILDEVSRIHEMEEQLQKEEAEFITNLLEEGKIL
FT                   HDIRLSFSFQKIVAEQKRPLLYYSLFLRHVHHTSPQNIVNVSGRQMQSFHGQMNVLAGE
FT                   MERFKKSNFTVVFLGANKERTQKLSSVLADYDIEAAMTDSKKALVQGQVYIMEGELQSG
FT                   FELPLMKLAVITEEELFKNRVKKKPRKQKLTNAERIKSYSELQIGDYVVHINHGIGKYL
FT                   GIETLEINGIHKDYLNIHYQGSDKLYVPVEQIDQVQKYVGSEGKEPKLYKLGGSEWKRV
FT                   KKKVETSVQDIADDLIKLYAEREASKGYAFSPDHEMQREFESAFPYQETEDQLRSIHEI
FT                   KKDMERERPMDRLLCGDVGYGKTEVAIRAAFKAIGDGKQVALLVPTTILAQQHYETIKE
FT                   RFQDYPINIGLLSRFRTRKEANETIKGLKNGTVDIVIGTHRLLSKDVVYKDLGLLIIDE
FT                   EQRFGVTHKEKIKQIKANVDVLTLTATPIPRTLHMSMLGVRDLSVIETPPENRFPVQTY
FT                   VVEYNGALVREAIERELARGGQVYFLYNRVEDIERKADEISMLVPDAKVAYAHGKMTEN
FT                   ELETVMLSFLEGESDVLVSTTIIETGVDIPNVNTLIVFDADKMGLSQLYQLRGRVGRSN
FT                   RVAYAYFTYRRDKVLTEVAEKRLQAIKEFTELGSGFKIAMRDLTIRGAGNLLGAQQHGF
FT                   IDSVGFDLYSQMLKEAIEERKGDTAKTEQFETEIDVELDAYIPETYIQDGKQKIDMYKR
FT                   FRSVATIEEKNELQDEMIDRFGNYPKEVEYLFTVAEMKVYARQERVELIKQDKDAVRLT
FT                   ISEEASAEIDGQKLFELGNQYGRQIGLGMEGKKLKISIQTKGRSADEWLDTVLGMLKGL
FT                   KDVKKQTISST"
FT   gene            64099..64635
FT                   /gene="spoVT"
FT                   /locus_tag="BSU_00560"
FT                   /old_locus_tag="BSU00560"
FT   CDS_pept        64099..64635
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="spoVT"
FT                   /locus_tag="BSU_00560"
FT                   /old_locus_tag="BSU00560"
FT                   /product="transcriptional regulator of sporulation /
FT                   germination"
FT                   /function="16.3: Control"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 8755877, 15063493, 15939023,
FT                   16159768, 18996130, 22522895, 27790204; Product type r:
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BSU00560"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11832"
FT                   /db_xref="GOA:P37554"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="InterPro:IPR014213"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR037914"
FT                   /db_xref="InterPro:IPR039472"
FT                   /db_xref="PDB:2RO5"
FT                   /db_xref="PDB:2W1R"
FT                   /db_xref="PDB:2W1T"
FT                   /db_xref="SubtiList:BG10119"
FT                   /db_xref="UniProtKB/Swiss-Prot:P37554"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:8755877, 15063493, 15939023, 16159768, 18996130,
FT                   22522895, 27790204"
FT                   /protein_id="CAB11832.1"
FT                   /translation="MKATGIVRRIDDLGRVVIPKEIRRTLRIREGDPLEIFVDRDGEVI
FT                   LKKYSPISELGDFAKEYADALYDSLGHSVLICDRDVYIAVSGSSKKDYLNKSISEMLER
FT                   TMDQRSSVLESDAKSVQLVNGIDEDMNSYTVGPIVANGDPIGAVVIFSKDQTMGEVEHK
FT                   AVETAAGFLARQMEQ"
FT   gene            64817..66415
FT                   /gene="yabM"
FT                   /locus_tag="BSU_00570"
FT                   /old_locus_tag="BSU00570"
FT   CDS_pept        64817..66415
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yabM"
FT                   /locus_tag="BSU_00570"
FT                   /old_locus_tag="BSU00570"
FT                   /product="putative exporter"
FT                   /function="16.1: Circulate"
FT                   /note="Evidence 3: Putative function from multiple
FT                   computational evidences; PubMedId: 15849754, 16850406;
FT                   Product type t: transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BSU00570"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11833"
FT                   /db_xref="GOA:P37555"
FT                   /db_xref="InterPro:IPR002797"
FT                   /db_xref="InterPro:IPR024923"
FT                   /db_xref="InterPro:IPR029303"
FT                   /db_xref="SubtiList:BG10120"
FT                   /db_xref="UniProtKB/Swiss-Prot:P37555"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB11833.1"
FT                   /translation="MDDSIGVKRHWIWQGAFVLILAGVITKILSAVYRVPFQNIVGDVG
FT                   FYIYQQVYPFLGIAVMLSTSGFPVIISKLMNDYSEKNHHTILKISALFLSLIGILLFLC
FT                   LYLGAVPIALFMGDSHLAVLIQVAAYAFLLFPFVALLRGGFQGRHEMLPSALSQMTEQF
FT                   LRVAVLLGLSFWLVKKGASLYTAGAAAASGSLAGSLVALIILGFFWFKTKRDNQTDRQN
FT                   ENVITTKELTKKLLLYSVTICVSSLLLLFIQLVDALNLYALLSGGEASEEAKCLKGIYD
FT                   RGQPLLQLGSVFAVSIATSLVPYISMAVKNKELKIMKEKITSSLKLCLVLGTGASAGLI
FT                   CILKPVNIMLFQNGEGTGALQVFSCSILFASLAVTAAAVLQGAGYTVFPAIAVGAGVAV
FT                   KWVLNTLLVPRYGIEGASLATAASFAAVAGLNLYQLRQKEWLDKLRGVLIPIIGSALLM
FT                   SAVLLAYTRLWTFLFPATGRGAAVIESLSAVAIGGAVFIYCMMRLGIFTDEELNSVPFG
FT                   SKLSKFMRRREQNGG"
FT   gene            66405..67874
FT                   /gene="yabN"
FT                   /locus_tag="BSU_00580"
FT                   /old_locus_tag="BSU00580"
FT   CDS_pept        66405..67874
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yabN"
FT                   /locus_tag="BSU_00580"
FT                   /old_locus_tag="BSU00580"
FT                   /product="putative fusion methylase and nucleotide
FT                   pyrophosphohydrolase"
FT                   /function="16.6: Maintain"
FT                   /function="16.8: Protect"
FT                   /note="Evidence 3: Putative function from multiple
FT                   computational evidences; PubMedId: 11178267; Product type
FT                   e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU00580"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11834"
FT                   /db_xref="GOA:P37556"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR004518"
FT                   /db_xref="InterPro:IPR011551"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR024180"
FT                   /db_xref="InterPro:IPR035013"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="SubtiList:BG10121"
FT                   /db_xref="UniProtKB/Swiss-Prot:P37556"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB11834.1"
FT                   /translation="MAGKITVVGLGAGDMDQLTIGIHKLLTKADTLYVRTKDHPLIEEL
FT                   EKETKNIRFFDDIYEKHDQFEAVYEEIADILFEAARREDVVYAVPGHPFVAEKTVQLLT
FT                   ERQEKENVQVKVAGGQSFLDATFNVLQIDPIEGFQFVDAGTLSADELELRHHLIICQVY
FT                   DQMTASEVKLTLMEKLPDDYEVVIVTAAGSRGEEIRTVPLFELDRNVALNNLTSVYIPP
FT                   IKEEKLLYHEFSTFRSIIRELRGPNGCPWDKKQTHQSLKQYMIEECYELLEAIDEEDTD
FT                   HMIEELGDVLLQVLLHAQIGEDEGYFTIDDVIKGISEKMVRRHPHVFKDVKVQDENDVL
FT                   ANWEDIKKAEKNTSESSLLDSVPKTLPALSKAAKLQKKAAKVGFDWEDVSDIWEKVSEE
FT                   MKEFSSEVSEAPHEHNLKAEFGDILFALVNVARFYKIEPEEALTMTNDKFRRRFSYIEE
FT                   TAKEEGVELADMSLEDMDKLWNEAKETERRS"
FT   gene            67877..68137
FT                   /gene="hslR"
FT                   /locus_tag="BSU_00590"
FT                   /old_locus_tag="BSU00590"
FT   CDS_pept        67877..68137
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hslR"
FT                   /locus_tag="BSU_00590"
FT                   /old_locus_tag="BSU00590"
FT                   /product="ribosomal RNA binding protein involved in 50S
FT                   recycling; heat shock protein"
FT                   /function="16.2: Construct biomass (Anabolism)"
FT                   /note="Evidence 2a: Function from experimental evidences in
FT                   other organisms; PubMedId: 10675343, 10675344, 19013177;
FT                   Product type f: factor"
FT                   /db_xref="EnsemblGenomes-Gn:BSU00590"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11835"
FT                   /db_xref="GOA:P37557"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR025490"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="SubtiList:BG10122"
FT                   /db_xref="UniProtKB/Swiss-Prot:P37557"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB11835.1"
FT                   /translation="MRLDKFLKVSRLIKRRTLAKEVADQGRISINGNQAKASSDVKPGD
FT                   ELTVRFGQKLVTVQVNELKDTTKKEEAANMYTILKEEKLGE"
FT   gene            68216..68518
FT                   /gene="spcP"
FT                   /locus_tag="BSU_00600"
FT                   /old_locus_tag="BSU00600"
FT   CDS_pept        68216..68518
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="spcP"
FT                   /locus_tag="BSU_00600"
FT                   /old_locus_tag="BSU00600"
FT                   /product="spore protein involved in the shaping of the
FT                   spore coat"
FT                   /function="16.13: Shape"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 10869437, 11283287, 15231775,
FT                   21904870, 22720735; Product type f: factor"
FT                   /db_xref="EnsemblGenomes-Gn:BSU00600"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11836"
FT                   /db_xref="GOA:P37558"
FT                   /db_xref="InterPro:IPR012504"
FT                   /db_xref="InterPro:IPR022476"
FT                   /db_xref="InterPro:IPR038705"
FT                   /db_xref="SubtiList:BG10123"
FT                   /db_xref="UniProtKB/Swiss-Prot:P37558"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:10869437, 11283287, 15231775, 21904870, 22720735"
FT                   /protein_id="CAB11836.1"
FT                   /translation="MNSYYDQKGSSSVPEQHDVTMKGRKHLDISGVKHVESFDNEEFLL
FT                   ETVMGMLSVRGQNLQMKNLDVEKGIVSIKGRVFDLVYLDEQQGDKAKGFFSKLFK"
FT   gene            68515..69150
FT                   /gene="spcQ"
FT                   /locus_tag="BSU_00610"
FT                   /old_locus_tag="BSU00610"
FT   CDS_pept        68515..69150
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="spcQ"
FT                   /locus_tag="BSU_00610"
FT                   /old_locus_tag="BSU00610"
FT                   /product="membrane protein of the forespore"
FT                   /function="16.13: Shape"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 10869437, 11283287, 15849754,
FT                   16850406; Product type f: factor"
FT                   /db_xref="EnsemblGenomes-Gn:BSU00610"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11837"
FT                   /db_xref="GOA:P37559"
FT                   /db_xref="InterPro:IPR014242"
FT                   /db_xref="InterPro:IPR019074"
FT                   /db_xref="SubtiList:BG10124"
FT                   /db_xref="UniProtKB/Swiss-Prot:P37559"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:10869437, 11283287, 15849754, 16850406"
FT                   /protein_id="CAB11837.1"
FT                   /translation="MTLTTQFYTMLAMSGMGLWLGASLDTYRLFVIRAKTARWLLFIHD
FT                   ILFWIMQGLLFFYVLLHVNEGEFRIYIFLAVLLGVATYQSLCKRIYIKILKFVIYLVVS
FT                   VYQFFKKLIQHVLFRPIVWTCGAIIWLAAFLFKKTYSLIGFLLLCLYKIVMVLCFPIRF
FT                   IAKQCLKLLPVKMRLTFRRYFEKGAGFLKKKKKLLITIRTTITRFLKR"
FT   gene            69168..69545
FT                   /gene="divIC"
FT                   /locus_tag="BSU_00620"
FT                   /old_locus_tag="BSU00620"
FT   CDS_pept        69168..69545
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="divIC"
FT                   /locus_tag="BSU_00620"
FT                   /old_locus_tag="BSU00620"
FT                   /product="cell-division initiation protein"
FT                   /function="16.9: Replicate"
FT                   /function="16.13: Shape"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 10844672, 11283287, 11994149,
FT                   12682299, 16936019, 20870765, 22720735; Product type f:
FT                   factor"
FT                   /db_xref="EnsemblGenomes-Gn:BSU00620"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11838"
FT                   /db_xref="GOA:P37471"
FT                   /db_xref="InterPro:IPR007060"
FT                   /db_xref="InterPro:IPR039076"
FT                   /db_xref="SubtiList:BG10125"
FT                   /db_xref="UniProtKB/Swiss-Prot:P37471"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:10844672, 11283287, 11994149, 12682299, 16936019,
FT                   20870765, 22720735"
FT                   /protein_id="CAB11838.1"
FT                   /translation="MNFSRERTITEIQNDYKEQVERQNQLKKRRRKGLYRRLTVFGALV
FT                   FLTAIVLASSVWSQTSSLSAKEEKKEQLEKELKSLKTKQTDLKEEISKLKDEDYVTELA
FT                   RRDLFMSGDGEIIFNVEKKSK"
FT   gene            69626..70012
FT                   /gene="yabR"
FT                   /locus_tag="BSU_00630"
FT                   /old_locus_tag="BSU00630"
FT   CDS_pept        69626..70012
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yabR"
FT                   /locus_tag="BSU_00630"
FT                   /old_locus_tag="BSU00630"
FT                   /product="putative RNA degradation protein;
FT                   polyribonucleotide nucleotidyltransferase or phosphorylase"
FT                   /function="16.11: Scavenge (Catabolism)"
FT                   /function="16.6: Maintain"
FT                   /function="16.3: Control"
FT                   /EC_number="2.7.-.-"
FT                   /note="Evidence 3: Putative function from multiple
FT                   computational evidences; PubMedId: 9862121, 15066026,
FT                   16014871, 22720735; Product type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU00630"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11839"
FT                   /db_xref="GOA:P37560"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="SubtiList:BG10126"
FT                   /db_xref="UniProtKB/Swiss-Prot:P37560"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB11839.1"
FT                   /translation="MSIEVGSKLQGKITGITNFGAFVELPGGSTGLVHISEVADNYVKD
FT                   INDHLKVGDQVEVKVINVEKDGKIGLSIKKAKDRPQARPRNDFRPKESFEQKMNKFLKD
FT                   SEDRLSSLKRNTESKRGGRGARRG"
FT   gene            70181..70257
FT                   /gene="trnSL-Met1"
FT                   /locus_tag="BSU_tRNA_10"
FT   tRNA            70181..70257
FT                   /gene="trnSL-Met1"
FT                   /locus_tag="BSU_tRNA_10"
FT                   /product="tRNA-Met"
FT                   /function="16.2: Construct biomass (Anabolism)"
FT                   /note="methionine transfer RNA (CAU); Evidence 2a: Function
FT                   from experimental evidences in other organisms; Product
FT                   type n: RNA"
FT                   /inference="profile:tRNAscan:1.23"
FT   gene            70267..70338
FT                   /gene="trnSL-Glu1"
FT                   /locus_tag="BSU_tRNA_11"
FT   tRNA            70267..70338
FT                   /gene="trnSL-Glu1"
FT                   /locus_tag="BSU_tRNA_11"
FT                   /product="tRNA-Glu"
FT                   /function="16.2: Construct biomass (Anabolism)"
FT                   /note="glutamate transfer RNA (UUC); Evidence 2a: Function
FT                   from experimental evidences in other organisms; Product
FT                   type n: RNA"
FT                   /inference="profile:tRNAscan:1.23"
FT   gene            70538..73021
FT                   /gene="spoIIE"
FT                   /locus_tag="BSU_00640"
FT                   /old_locus_tag="BSU00640"
FT   CDS_pept        70538..73021
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="spoIIE"
FT                   /locus_tag="BSU_00640"
FT                   /old_locus_tag="BSU00640"
FT                   /product="SpoIIAA-phosphate serine phosphatase"
FT                   /function="16.13: Shape"
FT                   /function="16.3: Control"
FT                   /EC_number="3.1.3.16"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 10747015, 12180929, 15126482,
FT                   15866939, 15978076, 28358838; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU00640"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11840"
FT                   /db_xref="GOA:P37475"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR014221"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="PDB:3T91"
FT                   /db_xref="PDB:3T9Q"
FT                   /db_xref="PDB:5MQH"
FT                   /db_xref="PDB:5UCG"
FT                   /db_xref="SubtiList:BG10127"
FT                   /db_xref="UniProtKB/Swiss-Prot:P37475"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:10747015, 12180929, 15126482, 15866939, 15978076,
FT                   28358838"
FT                   /protein_id="CAB11840.1"
FT                   /translation="MEKAERRVNGPMAGQALEKLQSFFNRGTKLVTHHLHSLFFYKGFI
FT                   YVVIGFLLGRAFILSEVLPFALPFFGAMLLIRRDKAFYAVLAVLAGALTISPKHSLLIL
FT                   AALLAFFVFSKVAAFITDDRVKALPIVVFFSMAAARAGFVYAQNGVFTTYDYVMAIVEA
FT                   GLSFILTLIFLQSLPIFTVKKVKQSLKIEEIICFMILIASVLTGLAGLSYQGMQAEHIL
FT                   ARYVVLSFSFIGGASIGCTVGVVTGLILGLANIGNLYQMSLLAFSGLLGGLLKEGKKAG
FT                   AAIGLIVGSLLISLYGEGSAGLMTTLYESLIAVCLFLLTPQSITRKVARYIPGTVEHLQ
FT                   EQQQYARKIRDVTAQKVDQFSNVFHALSESFATFYQASDEQTDDSEVDLFLSKITEHSC
FT                   QTCYKKNRCWVQNFDKTYDLMKQVMLETEEKEYASNRRLKKEFQQYCSKSKQVEELIED
FT                   ELAHHHAHLTLKKKVQDSRRLVAEQLLGVSEVMADFSREIKREREQHFLQEEQIIEALQ
FT                   HFGIEIQHVEIYSLEQGNIDIEMTIPFSGHGESEKIIAPMLSDILEEQILVKAEQHSPH
FT                   PNGYSHVAFGSTKSYRVSTGAAHAAKGGGLVSGDSYSMMELGARKYAAAISDGMGNGAR
FT                   AHFESNETIKLLEKILESGIDEKIAIKTINSILSLRTTDEIYSTLDLSIIDLQDASCKF
FT                   LKVGSTPSFIKRGDQVMKVQASNLPIGIINEFDVEVVSEQLKAGDLLIMMSDGIFEGPK
FT                   HVENHDLWMKRKMKGLKTNDPQEIADLLMEEVIRTRSGQIEDDMTVVVVRIDHNTPKWA
FT                   SIPVPAIFQNKQEIS"
FT   gene            73106..73843
FT                   /gene="yabS"
FT                   /locus_tag="BSU_00650"
FT                   /old_locus_tag="BSU00650"
FT   CDS_pept        73106..73843
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yabS"
FT                   /locus_tag="BSU_00650"
FT                   /old_locus_tag="BSU00650"
FT                   /product="conserved protein of unknown function"
FT                   /note="Evidence 4: Unknown function but conserved in other
FT                   organisms"
FT                   /db_xref="EnsemblGenomes-Gn:BSU00650"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11841"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="SubtiList:BG10128"
FT                   /db_xref="UniProtKB/Swiss-Prot:P37561"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB11841.1"
FT                   /translation="MNNGHLNQILLITDGCSNHGEDPLAMAAFAKEQGITVNVIGIMEE
FT                   NQIDPEAMKEVEGIALAGGGVHQVVYASQLSQTVQMVTKKAMTQTLQGVVNQELKQILG
FT                   KNVEMEELSPEKRGEVMEVVDELGETVHLQVLVLVDTSASMAPKLPTVKEALIDLSVSL
FT                   NSRIGNNEFAMCIFPGKKQEVELVLNWTPKLQSLSTLFAKLSTGGITPTGPAIREATLQ
FT                   FEKIRSRRGMLADDERRFDEFGM"
FT   gene            73809..74825
FT                   /gene="prkT"
FT                   /locus_tag="BSU_00660"
FT                   /old_locus_tag="BSU00660"
FT   CDS_pept        73809..74825
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prkT"
FT                   /locus_tag="BSU_00660"
FT                   /old_locus_tag="BSU00660"
FT                   /product="serine/threonine-protein kinase"
FT                   /function="16.3: Control"
FT                   /EC_number="2.7.11.1"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 23634894, 24731262, 25278935;
FT                   Product type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU00660"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11842"
FT                   /db_xref="GOA:P37562"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="PDB:6G4J"
FT                   /db_xref="SubtiList:BG10129"
FT                   /db_xref="UniProtKB/Swiss-Prot:P37562"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:23634894, 24731262, 25278935"
FT                   /protein_id="CAB11842.2"
FT                   /translation="MMNDALTSLACSLKPGTTIKGKWNGNTYTLRKQLGKGANGIVYLA
FT                   ETSDGHVALKVSDDSLSITSEVNVLKSFSKAQSVTMGPSFFDTDDAYIPSANTKVSFYA
FT                   MEYIKGPLLLKYVSDKGAEWIPVLMIQLLSSLSVLHQQGWIFGDLKPDNLIVTGPPARI
FT                   RCIDVGGTTKEGRAIKEYTEFYDRGYWGYGTRKAEPSYDLFAVAMIMINSVHKKEFKKT
FT                   NQPKEQLRSLIEGNPLLQKYKKALFSALNGDYQSADEMKKDMLDAGQKAAQRKQPIKAS
FT                   PQPATRQRQQKPRQGKITKTRYTPKQKPAKSGGLFETTLIVISVLALYFAYIIFFLI"
FT   gene            74929..76347
FT                   /gene="tilS"
FT                   /locus_tag="BSU_00670"
FT                   /old_locus_tag="BSU00670"
FT   CDS_pept        74929..76347
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tilS"
FT                   /locus_tag="BSU_00670"
FT                   /old_locus_tag="BSU00670"
FT                   /product="tRNA(ile2) lysidine synthetase"
FT                   /function="16.2: Construct biomass (Anabolism)"
FT                   /EC_number="6.3.4.19"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 12682299, 14527414, 16039592,
FT                   17005971, 22720735, 24001521; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU00670"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11843"
FT                   /db_xref="GOA:P37563"
FT                   /db_xref="InterPro:IPR011063"
FT                   /db_xref="InterPro:IPR012094"
FT                   /db_xref="InterPro:IPR012795"
FT                   /db_xref="InterPro:IPR012796"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015262"
FT                   /db_xref="SubtiList:BG10130"
FT                   /db_xref="UniProtKB/Swiss-Prot:P37563"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:12682299, 14527414, 16039592, 17005971, 22720735,
FT                   24001521"
FT                   /protein_id="CAB11843.1"
FT                   /translation="MKSVKDFLNKHNLTLKGATIIVGVSGGPDSMALLHALHTLCGRSA
FT                   NVIAAHVDHRFRGAESEEDMRFVQAYCKAEQLVCETAQINVTAYAQEKGLNKQAAARDC
FT                   RYQFFEEIMSKHQADYLALAHHGDDQVETMLMKLAKGTLGTGLAGMQPVRRFGTGRIIR
FT                   PFLTITKEEILHYCHENGLSYRTDESNAKDDYTRNRFRKTVLPFLKQESPDVHKRFQKV
FT                   SEALTEDEQFLQSLTKDEMNKVITSQSNTSVEINSSQLLALPMPLQRRGVQLILNYLYE
FT                   NVPSSFSAHHIQQFLDWAENGGPSGVLDFPKGLKVVKSYQTCLFTFEQWQCKNVPFEYQ
FT                   ISGAADETAVLPNGYLIEARHYADSPEEHGNAVFITSEKKVRFPLTIRTRKAGDRIKLK
FT                   GMNGSKKVKDIFIDKKLPLQERDNWPIVTDASGEIIWIPGLKKSIFEDLVIPNSDRIVL
FT                   QYRQHEKCRGQAKS"
FT   gene            76344..76886
FT                   /gene="hprT"
FT                   /locus_tag="BSU_00680"
FT                   /old_locus_tag="BSU00680"
FT   CDS_pept        76344..76886
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hprT"
FT                   /locus_tag="BSU_00680"
FT                   /old_locus_tag="BSU00680"
FT                   /product="hypoxanthine-guanine phosphoribosyltransferase"
FT                   /function="16.11: Scavenge (Catabolism)"
FT                   /EC_number="2.4.2.8"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 3110131, 6408059, 24001521;
FT                   Product type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU00680"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11844"
FT                   /db_xref="GOA:P37472"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005904"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="SubtiList:BG10131"
FT                   /db_xref="UniProtKB/Swiss-Prot:P37472"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:3110131, 6408059, 24001521"
FT                   /protein_id="CAB11844.1"
FT                   /translation="MMKHDIEKVLISEEEIQKKVKELGAELTSEYQDTFPLAIGVLKGA
FT                   LPFMADLIKHIDTYLEMDFMDVSSYGNSTVSSGEVKIIKDLDTSVEGRDILIIEDIIDS
FT                   GLTLSYLVELFRYRKAKSIKIVTLLDKPSGRKADIKADFVGFEVPDAFVVGYGLDYAER
FT                   YRNLPYIGVLKPAVYES"
FT   gene            76984..78897
FT                   /gene="ftsH"
FT                   /locus_tag="BSU_00690"
FT                   /old_locus_tag="BSU00690"
FT   CDS_pept        76984..78897
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsH"
FT                   /locus_tag="BSU_00690"
FT                   /old_locus_tag="BSU00690"
FT                   /product="ATP-dependent cytoplasmic membrane protease"
FT                   /function="16.13: Shape"
FT                   /function="16.9: Replicate"
FT                   /EC_number="3.4.24.-"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 9076729, 9084181, 9287010,
FT                   9352926, 10851010, 10913836, 12533473, 24001521, 22720735;
FT                   Product type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU00690"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11845"
FT                   /db_xref="GOA:P37476"
FT                   /db_xref="InterPro:IPR000642"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR005936"
FT                   /db_xref="InterPro:IPR011546"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037219"
FT                   /db_xref="InterPro:IPR041569"
FT                   /db_xref="SubtiList:BG10132"
FT                   /db_xref="UniProtKB/Swiss-Prot:P37476"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:9076729, 9084181, 9287010, 9352926, 10851010,
FT                   10913836, 12533473, 24001521, 22720735"
FT                   /protein_id="CAB11845.1"
FT                   /translation="MNRVFRNTIFYLLILLVVIGVVSYFQTSNPKTENMSYSTFIKNLD
FT                   DGKVDSVSVQPVRGVYEVKGQLKNYDKDQYFLTHVPEGKGADQIFNALKKTDVKVEPAQ
FT                   ETSGWVTFLTTIIPFVIIFILFFFLLNQAQGGGSRVMNFGKSKAKLYTEEKKRVKFKDV
FT                   AGADEEKQELVEVVEFLKDPRKFAELGARIPKGVLLVGPPGTGKTLLAKACAGEAGVPF
FT                   FSISGSDFVEMFVGVGASRVRDLFENAKKNAPCLIFIDEIDAVGRQRGAGLGGGHDERE
FT                   QTLNQLLVEMDGFSANEGIIIIAATNRADILDPALLRPGRFDRQITVDRPDVIGREAVL
FT                   KVHARNKPLDETVNLKSIAMRTPGFSGADLENLLNEAALVAARQNKKKIDARDIDEATD
FT                   RVIAGPAKKSRVISKKERNIVAYHEGGHTVIGLVLDEADMVHKVTIVPRGQAGGYAVML
FT                   PREDRYFQTKPELLDKIVGLLGGRVAEEIIFGEVSTGAHNDFQRATNIARRMVTEFGMS
FT                   EKLGPLQFGQSQGGQVFLGRDFNNEQNYSDQIAYEIDQEIQRIIKECYERAKQILTENR
FT                   DKLELIAQTLLKVETLDAEQIKHLIDHGTLPERNFSDDEKNDDVKVNILTKTEEKKDDT
FT                   KE"
FT   gene            79092..79868
FT                   /gene="coaX"
FT                   /locus_tag="BSU_00700"
FT                   /old_locus_tag="BSU00700"
FT   CDS_pept        79092..79868
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="coaX"
FT                   /locus_tag="BSU_00700"
FT                   /old_locus_tag="BSU00700"
FT                   /product="pantothenate kinase type III"
FT                   /function="16.2: Construct biomass (Anabolism)"
FT                   /EC_number="2.7.1.33"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 15795230, 16905099, 24784177;
FT                   Product type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU00700"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11846"
FT                   /db_xref="GOA:P37564"
FT                   /db_xref="InterPro:IPR004619"
FT                   /db_xref="SubtiList:BG10133"
FT                   /db_xref="UniProtKB/Swiss-Prot:P37564"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:15795230, 16905099, 24784177"
FT                   /protein_id="CAB11846.2"
FT                   /translation="MLLVIDVGNTNTVLGVYHDGKLEYHWRIETSRHKTEDEFGMILRS
FT                   LFDHSGLMFEQIDGIIISSVVPPIMFALERMCTKYFHIEPQIVGPGMKTGLNIKYDNPK
FT                   EVGADRIVNAVAAIHLYGNPLIVVDFGTATTYCYIDENKQYMGGAIAPGITISTEALYS
FT                   RAAKLPRIEITRPDNIIGKNTVSAMQSGILFGYVGQVEGIVKRMKWQAKQEPKVIATGG
FT                   LAPLIANESDCIDIVDPFLTLKGLELIYERNRVGSV"
FT   gene            79880..80755
FT                   /gene="hslO"
FT                   /locus_tag="BSU_00710"
FT                   /old_locus_tag="BSU00710"
FT   CDS_pept        79880..80755
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hslO"
FT                   /locus_tag="BSU_00710"
FT                   /old_locus_tag="BSU00710"
FT                   /product="disulfide bond chaperone (heat shock protein
FT                   HSP33)"
FT                   /function="16.6: Maintain"
FT                   /note="Evidence 2a: Function from experimental evidences in
FT                   other organisms; PubMedId: 11323724, 15023991; Product type
FT                   f: factor"
FT                   /db_xref="EnsemblGenomes-Gn:BSU00710"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11847"
FT                   /db_xref="GOA:P37565"
FT                   /db_xref="InterPro:IPR000397"
FT                   /db_xref="InterPro:IPR016153"
FT                   /db_xref="InterPro:IPR016154"
FT                   /db_xref="PDB:1VZY"
FT                   /db_xref="SubtiList:BG10134"
FT                   /db_xref="UniProtKB/Swiss-Prot:P37565"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB11847.1"
FT                   /translation="MDYLVKALAYDGKVRAYAARTTDMVNEGQRRHGTWPTASAALGRT
FT                   MTASLMLGAMLKGDDKLTVKIEGGGPIGAIVADANAKGEVRAYVSNPQVHFDLNEQGKL
FT                   DVRRAVGTNGTLSVVKDLGLREFFTGQVEIVSGELGDDFTYYLVSSEQVPSSVGVGVLV
FT                   NPDNTILAAGGFIIQLMPGTDDETITKIEQRLSQVEPISKLIQKGLTPEEILEEVLGEK
FT                   PEILETMPVRFHCPCSKERFETAILGLGKKEIQDMIEEDGQAEAVCHFCNEKYLFTKEE
FT                   LEGLRDQTTR"
FT   gene            80802..81695
FT                   /gene="yacD"
FT                   /locus_tag="BSU_00720"
FT                   /old_locus_tag="BSU00720"
FT   CDS_pept        80802..81695
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yacD"
FT                   /locus_tag="BSU_00720"
FT                   /old_locus_tag="BSU00720"
FT                   /product="putative protein chaperone accessory lipoprotein
FT                   factor"
FT                   /function="16.1: Circulate"
FT                   /note="Evidence 3: Putative function from multiple
FT                   computational evidences; PubMedId: 15187182, 15856219;
FT                   Product type f: factor"
FT                   /db_xref="EnsemblGenomes-Gn:BSU00720"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11848"
FT                   /db_xref="GOA:P37566"
FT                   /db_xref="InterPro:IPR000297"
FT                   /db_xref="InterPro:IPR023058"
FT                   /db_xref="InterPro:IPR027304"
FT                   /db_xref="SubtiList:BG10135"
FT                   /db_xref="UniProtKB/Swiss-Prot:P37566"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB11848.1"
FT                   /translation="MKSRTIWTIILGALLVCCIAVAYTLTKSQAGASSSGESIATIGGK
FT                   SVTREEWLKEMEDQYGKSTLEDMINVRVVEQLAKKNKLKISKSEVDREFLLIKAVNNSF
FT                   YEDEHTTEKEWKDQIRYNILLEDLLTRDIDISNKELESFYNKNKELYQFDDSYRIRHIV
FT                   VKDEEEAREVLKELKGGSSFEAVAAERSTDRYTSPYGGDLGFVTEASDNIPSAYIEEAK
FT                   TLKEDEWSQEPIKVSNGYAIIQLKEKLKARTFSFDEVKDQIRRQIAMDQLGDKATVKTL
FT                   WKEADVSWFYGEKSTK"
FT   gene            81771..82697
FT                   /gene="cysK"
FT                   /locus_tag="BSU_00730"
FT                   /old_locus_tag="BSU00730"
FT   CDS_pept        81771..82697
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysK"
FT                   /locus_tag="BSU_00730"
FT                   /old_locus_tag="BSU00730"
FT                   /product="cysteine synthase"
FT                   /function="16.2: Construct biomass (Anabolism)"
FT                   /function="16.3: Control"
FT                   /EC_number="2.5.1.47"
FT                   /EC_number="4.4.1.1"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 11390694, 15760717, 16267287,
FT                   16513748, 17056751, 18974048; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU00730"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11849"
FT                   /db_xref="GOA:P37887"
FT                   /db_xref="InterPro:IPR001216"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR005856"
FT                   /db_xref="InterPro:IPR005859"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="SubtiList:BG10136"
FT                   /db_xref="UniProtKB/Swiss-Prot:P37887"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:11390694, 15760717, 16267287, 16513748, 17056751,
FT                   18974048"
FT                   /protein_id="CAB11849.1"
FT                   /translation="MVRVANSITELIGNTPIVKLNRLADENSADVYLKLEYMNPGSSVK
FT                   DRIGLAMIEAAEKEGKLKAGNTIIEPTSGNTGIGLAMVAAAKGLKAILVMPDTMSMERR
FT                   NLLRAYGAELVLTPGAEGMKGAIKKAEELAEKHGYFVPQQFNNPSNPEIHRQTTGKEIV
FT                   EQFGDDQLDAFVAGIGTGGTITGAGEVLKEAYPSIKIYAVEPSDSPVLSGGKPGPHKIQ
FT                   GIGAGFVPDILNTEVYDEIFPVKNEEAFEYARRAAREEGILGGISSGAAIYAALQVAKK
FT                   LGKGKKVLAIIPSNGERYLSTPLYQFD"
FT   gene            82864..84276
FT                   /gene="pabB"
FT                   /locus_tag="BSU_00740"
FT                   /old_locus_tag="BSU00740"
FT   CDS_pept        82864..84276
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pabB"
FT                   /locus_tag="BSU_00740"
FT                   /old_locus_tag="BSU00740"
FT                   /product="4-amino-4-deoxychorismate synthase
FT                   (para-aminobenzoate synthase)"
FT                   /function="16.2: Construct biomass (Anabolism)"
FT                   /EC_number="2.6.1.85"
FT                   /note="Evidence 2a: Function from experimental evidences in
FT                   other organisms; PubMedId: 2123867, 9084182, 16605270,
FT                   17114263, 25288929; Product type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU00740"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11850"
FT                   /db_xref="GOA:P28820"
FT                   /db_xref="InterPro:IPR005801"
FT                   /db_xref="InterPro:IPR006805"
FT                   /db_xref="InterPro:IPR015890"
FT                   /db_xref="InterPro:IPR019999"
FT                   /db_xref="SubtiList:BG10137"
FT                   /db_xref="UniProtKB/Swiss-Prot:P28820"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB11850.1"
FT                   /translation="MAQRRPAGKKIPFQKDSFLQQFEKLAQSRKHHVLLESARGGRYSI
FT                   AGLDPIATVKGKDGITTIKHGDEMLFKEGDPLRAFHSWFKTLETETNHEFPDFQGGAIG
FT                   FLSYDYARYIENFKMLSLDDLETPDIYFLVFDDIAVYDHQEESLWLITHVNGSDQETAD
FT                   VKLSELEQMWLTELPAVTSREMKPETAGSFAAPFTEDGFSQAVEKIKQYIASGDVFQVN
FT                   LSIRQSQSLSVHPYQIYKTLREVNPSPYMAYLETPDFQIICGSPELLVSKKGKLLETRP
FT                   IAGTRSRGKTNEEDEALANELIHNEKERAEHVMLVDLERNDLGRVSRYGSVRVNEFMAI
FT                   EKYSHVMHIVSNVQGELQDGYDAVDIIHAVFPGGTITGAPKVRTMEIIEELEPTRRGLY
FT                   TGSIGWFGYNHDLQFNIVIRTIYATGGQAFMQSGAGVVIDSVPKHEYKESFKKAFAMQR
FT                   ALELSEEETKIR"
FT   gene            84290..84874
FT                   /gene="pabA"
FT                   /locus_tag="BSU_00750"
FT                   /old_locus_tag="BSU00750"
FT   CDS_pept        84290..84874
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pabA"
FT                   /locus_tag="BSU_00750"
FT                   /old_locus_tag="BSU00750"
FT                   /product="4-amino-4-deoxychorismate synthase; anthranilate
FT                   synthase (subunit II)"
FT                   /function="16.2: Construct biomass (Anabolism)"
FT                   /EC_number="4.1.3.27"
FT                   /EC_number="2.6.1.85"
FT                   /note="Evidence 2a: Function from experimental evidences in
FT                   other organisms; PubMedId: 9098056, 16605270, 17114263,
FT                   24847778; Product type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU00750"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11851"
FT                   /db_xref="GOA:P28819"
FT                   /db_xref="InterPro:IPR006221"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="SubtiList:BG10138"
FT                   /db_xref="UniProtKB/Swiss-Prot:P28819"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB11851.1"
FT                   /translation="MILMIDNYDSFTYNLVQYLGELGEELVVKRNDSITIDEIEELSPD
FT                   FLMISPGPCSPDEAGISLEAIKHFAGKIPIFGVCLGHQSIAQVFGGDVVRAERLMHGKT
FT                   SDIEHDGKTIFEGLKNPLVATRYHSLIVKPETLPSCFTVTAQTKEGEIMAIRHNDLPIE
FT                   GVQFHPESIMTSFGKEMLRNFIETYRKEVIA"
FT   gene            84874..85755
FT                   /gene="pabC"
FT                   /locus_tag="BSU_00760"
FT                   /old_locus_tag="BSU00760"
FT   CDS_pept        84874..85755
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pabC"
FT                   /locus_tag="BSU_00760"
FT                   /old_locus_tag="BSU00760"
FT                   /product="4-amino-4-deoxychorismate pyruvate-lyase"
FT                   /function="16.2: Construct biomass (Anabolism)"
FT                   /EC_number="4.1.3.38"
FT                   /note="Evidence 2a: Function from experimental evidences in
FT                   other organisms; PubMedId: 10876155, 1644759, 22720735;
FT                   Product type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU00760"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11852"
FT                   /db_xref="GOA:P28821"
FT                   /db_xref="InterPro:IPR001544"
FT                   /db_xref="InterPro:IPR017824"
FT                   /db_xref="InterPro:IPR018300"
FT                   /db_xref="InterPro:IPR036038"
FT                   /db_xref="SubtiList:BG10139"
FT                   /db_xref="UniProtKB/Swiss-Prot:P28821"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB11852.1"
FT                   /translation="MIYVNGRYMEEKDAVLSPFDHGFLYGIGVFETFRLYEGCPFLLDW
FT                   HIERLERALKDLQIEYTVSKHEILEMLDKLLKLNDIKDGNARVRLNISAGISDKGFVAQ
FT                   TYDKPTVLCFVNQLKPESLPLQKEGKVLSIRRNTPEGSFRLKSHHYLNNMYAKREIGND
FT                   PRVEGIFLTEDGAVAEGIISNVFWRKGRCIYTPSLDTGILDGVTRRFIIENAKDIGLEL
FT                   KTGRYELEALLTADEAWMTNSVLEIIPFTKIEEVNYGSQSGEATSALQLLYKKEIKNMI
FT                   HEKGGRAWRSTQ"
FT   gene            85737..86594
FT                   /gene="folP"
FT                   /locus_tag="BSU_00770"
FT                   /old_locus_tag="BSU00770"
FT   CDS_pept        85737..86594
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="folP"
FT                   /locus_tag="BSU_00770"
FT                   /old_locus_tag="BSU00770"
FT                   /product="dihydropteroate synthase"
FT                   /function="16.2: Construct biomass (Anabolism)"
FT                   /EC_number="2.5.1.15"
FT                   /note="Evidence 2a: Function from experimental evidences in
FT                   other organisms; PubMedId: 2123867, 11007651; Product type
FT                   e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU00770"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11853"
FT                   /db_xref="GOA:P28822"
FT                   /db_xref="InterPro:IPR000489"
FT                   /db_xref="InterPro:IPR006390"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="SubtiList:BG10140"
FT                   /db_xref="UniProtKB/Swiss-Prot:P28822"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB11853.1"
FT                   /translation="MAQHTIDQTQVIHTKPSALSYKEKTLVMGILNVTPDSFSDGGKYD
FT                   SLDKALLHAKEMIDDGAHIIDIGGESTRPGAECVSEDEEMSRVIPVIERITKELGVPIS
FT                   VDTYKASVADEAVKAGASIINDIWGAKHDPKMASVAAEHNVPIVLMHNRPERNYNDLLP
FT                   DMLSDLMESVKIAVEAGVDEKNIILDPGIGFAKTYHDNLAVMNKLEIFSGLGYPVLLAT
FT                   SRKRFIGRVLDLPPEERAEGTGATVCLGIQKGCDIVRVHDVKQIARMAKMMDAMLNKGG
FT                   VHHG"
FT   gene            86587..86949
FT                   /gene="folB"
FT                   /locus_tag="BSU_00780"
FT                   /old_locus_tag="BSU00780"
FT   CDS_pept        86587..86949
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="folB"
FT                   /locus_tag="BSU_00780"
FT                   /old_locus_tag="BSU00780"
FT                   /product="dihydroneopterin aldolase"
FT                   /function="16.2: Construct biomass (Anabolism)"
FT                   /EC_number="4.1.2.25"
FT                   /note="Evidence 2a: Function from experimental evidences in
FT                   other organisms; PubMedId: 16188473, 17176045, 17388809;
FT                   Product type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU00780"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11854"
FT                   /db_xref="GOA:P28823"
FT                   /db_xref="InterPro:IPR006156"
FT                   /db_xref="InterPro:IPR006157"
FT                   /db_xref="SubtiList:BG10141"
FT                   /db_xref="UniProtKB/Swiss-Prot:P28823"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB11854.1"
FT                   /translation="MDKVYVEGMEFYGYHGVFTEENKLGQRFKVDLTAELDLSKAGQTD
FT                   DLEQTINYAELYHVCKDIVEGEPVKLVETLAERIAGTVLGKFQPVQQCTVKVIKPDPPI
FT                   PGHYKSVAIEITRKKS"
FT   gene            86946..87449
FT                   /gene="folK"
FT                   /locus_tag="BSU_00790"
FT                   /old_locus_tag="BSU00790"
FT   CDS_pept        86946..87449
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="folK"
FT                   /locus_tag="BSU_00790"
FT                   /old_locus_tag="BSU00790"
FT                   /product="7,8-dihydro-6-hydroxymethylpterin
FT                   pyrophosphokinase"
FT                   /function="16.2: Construct biomass (Anabolism)"
FT                   /EC_number="2.7.6.3"
FT                   /note="Evidence 2a: Function from experimental evidences in
FT                   other organisms; PubMedId: 17029412; Product type e :
FT                   enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU00790"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11855"
FT                   /db_xref="GOA:P29252"
FT                   /db_xref="InterPro:IPR000550"
FT                   /db_xref="InterPro:IPR035907"
FT                   /db_xref="SubtiList:BG10142"
FT                   /db_xref="UniProtKB/Swiss-Prot:P29252"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB11855.1"
FT                   /translation="MNNIAYIALGSNIGDRETYLRQAVALLHQHAAVTVTKVSSIYETD
FT                   PVGYEDQAQFLNMAVEIKTSLNPFELLELTQQIENELGRTREVRWGPRTADLDILLFNR
FT                   ENIETEQLIVPHPRMYERLFVLAPLAEICQQVEKEATSAETDQEGVRVWKQKSGVDEFV
FT                   HSES"
FT   gene            87401..87610
FT                   /gene="yazB"
FT                   /locus_tag="BSU_00800"
FT                   /old_locus_tag="BSU00800"
FT   CDS_pept        87401..87610
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yazB"
FT                   /locus_tag="BSU_00800"
FT                   /old_locus_tag="BSU00800"
FT                   /product="putative transcriptional regulator"
FT                   /function="16.3: Control"
FT                   /note="Evidence 3: Putative function from multiple
FT                   computational evidences; Product type r: regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BSU00800"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11856"
FT                   /db_xref="GOA:O31417"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="SubtiList:BG12701"
FT                   /db_xref="UniProtKB/Swiss-Prot:O31417"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB11856.1"
FT                   /translation="MEAEIWGRRIRAFRKLKGYTQEGFAKALGISVSILGEIERGNRLP
FT                   SAAIIQDAADVLNISADELAPPEK"
FT   gene            87634..88635
FT                   /gene="dusB"
FT                   /locus_tag="BSU_00810"
FT                   /old_locus_tag="BSU00810"
FT   CDS_pept        87634..88635
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dusB"
FT                   /locus_tag="BSU_00810"
FT                   /old_locus_tag="BSU00810"
FT                   /product="tRNA-dihydrouridine synthase B"
FT                   /function="16.6: Maintain"
FT                   /function="16.2: Construct biomass (Anabolism)"
FT                   /function="16.3: Control"
FT                   /EC_number="1.-.-.-"
FT                   /note="Evidence 2a: Function from experimental evidences in
FT                   other organisms; PubMedId: 11983710, 15698474, 26112661;
FT                   Product type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU00810"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11857"
FT                   /db_xref="GOA:P37567"
FT                   /db_xref="InterPro:IPR001269"
FT                   /db_xref="InterPro:IPR004652"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018517"
FT                   /db_xref="InterPro:IPR024036"
FT                   /db_xref="InterPro:IPR035587"
FT                   /db_xref="SubtiList:BG10143"
FT                   /db_xref="UniProtKB/Swiss-Prot:P37567"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB11857.1"
FT                   /translation="MFKIGDIQLKNRVVLAPMAGVCNSAFRLTVKEFGAGLVCAEMVSD
FT                   KAILYNNARTMGMLYIDEREKPLSLQIFGGKKETLVEAAKFVDQNTTADIIDINMGCPV
FT                   PKITKCDAGAKWLLDPDKIYEMVSAVVDAVNKPVTVKMRMGWDEDHIFAVKNAQAVERA
FT                   GGKAVALHGRTRVQMYEGTANWDIIKEVKQSVSIPVIGNGDVKTPQDAKRMLDETGVDG
FT                   VMIGRAALGNPWMIYRTVQYLETGKLKEEPQVREKMAVCKLHLDRLIDLKGENVAVREM
FT                   RKHAAWYLKGVKGNANVRNEINHCETREEFVQLLDAFTVEVEAKELQNAKVG"
FT   gene            88727..90226
FT                   /gene="lysS"
FT                   /locus_tag="BSU_00820"
FT                   /old_locus_tag="BSU00820"
FT   CDS_pept        88727..90226
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lysS"
FT                   /locus_tag="BSU_00820"
FT                   /old_locus_tag="BSU00820"
FT                   /product="lysyl-tRNA synthetase"
FT                   /function="16.2: Construct biomass (Anabolism)"
FT                   /EC_number="6.1.1.6"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 12682299, 14623972, 20649968;
FT                   Product type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU00820"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11858"
FT                   /db_xref="GOA:P37477"
FT                   /db_xref="InterPro:IPR002313"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR018149"
FT                   /db_xref="InterPro:IPR034762"
FT                   /db_xref="SubtiList:BG10144"
FT                   /db_xref="UniProtKB/Swiss-Prot:P37477"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:12682299, 14623972, 20649968"
FT                   /protein_id="CAB11858.1"
FT                   /translation="MSQEEHNHEELNDQLQVRRDKMNQLRDNGIDPFGARFERTHQSQE
FT                   VISAYQDLTKEELEEKAIEVTIAGRMMTKRGKGKAGFAHLQDLEGQIQIYVRKDSVGDD
FT                   QYEIFKSSDLGDLIGVTGKVFKTNVGELSVKATSFELLTKALRPLPDKYHGLKDVEQRY
FT                   RQRYLDLIVNPDSKHTFITRSKIIQAMRRYLDDHGYLEVETPTMHSIPGGASARPFITH
FT                   HNALDIPLYMRIAIELHLKRLIVGGLEKVYEIGRVFRNEGVSTRHNPEFTMIELYEAYA
FT                   DYKDIMSLTENLVAHIAQEVLGTTTIQYGEEQIDLKPEWKRIHMVDAVKEATGVDFWEE
FT                   VTVEQAREYAKEHEVEIKDSMTVGHIINEFFEQKIEETLIQPTFIYGHPVEISPLAKKN
FT                   PEDPRFTDRFELFIVGREHANAFTELNDPIDQRERFEAQLKEREAGNDEAHLMDEDFVE
FT                   ALEYGMPPTGGLGIGIDRLVMLLTNAPSIRDVLLFPQMRQR"
FT   gene            90536..92089
FT                   /gene="rrnJ-16S"
FT                   /locus_tag="BSU_rRNA_6"
FT   rRNA            90536..92089
FT                   /gene="rrnJ-16S"
FT                   /locus_tag="BSU_rRNA_6"
FT                   /product="ribosomal RNA-16S"
FT                   /function="16.2: Construct biomass (Anabolism)"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; Product type n: RNA"
FT   gene            92254..95181
FT                   /gene="rrnJ-23S"
FT                   /locus_tag="BSU_rRNA_7"
FT   rRNA            92254..95181
FT                   /gene="rrnJ-23S"
FT                   /locus_tag="BSU_rRNA_7"
FT                   /product="ribosomal RNA-23S"
FT                   /function="16.2: Construct biomass (Anabolism)"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; Product type n: RNA"
FT   gene            95237..95354
FT                   /gene="rrnJ-5S"
FT                   /locus_tag="BSU_rRNA_8"
FT   rRNA            95237..95354
FT                   /gene="rrnJ-5S"
FT                   /locus_tag="BSU_rRNA_8"
FT                   /product="ribosomal RNA-5S"
FT                   /function="16.2: Construct biomass (Anabolism)"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; Product type n: RNA"
FT   gene            95375..95450
FT                   /gene="trnJ-Val"
FT                   /locus_tag="BSU_tRNA_12"
FT   tRNA            95375..95450
FT                   /gene="trnJ-Val"
FT                   /locus_tag="BSU_tRNA_12"
FT                   /product="tRNA-Val"
FT                   /function="16.2: Construct biomass (Anabolism)"
FT                   /note="transfer RNA-Val(UAC); Evidence 2a: Function from
FT                   experimental evidences in other organisms; Product type n:
FT                   RNA"
FT                   /inference="profile:tRNAscan:1.23"
FT   gene            95455..95530
FT                   /gene="trnJ-Thr"
FT                   /locus_tag="BSU_tRNA_13"
FT   tRNA            95455..95530
FT                   /gene="trnJ-Thr"
FT                   /locus_tag="BSU_tRNA_13"
FT                   /product="tRNA-Thr"
FT                   /function="16.2: Construct biomass (Anabolism)"
FT                   /note="transfer RNA-Thr(UGU); Evidence 2a: Function from
FT                   experimental evidences in other organisms; Product type n:
FT                   RNA"
FT                   /inference="profile:tRNAscan:1.23"
FT   gene            95567..95642
FT                   /gene="trnJ-Lys"
FT                   /locus_tag="BSU_tRNA_14"
FT   tRNA            95567..95642
FT                   /gene="trnJ-Lys"
FT                   /locus_tag="BSU_tRNA_14"
FT                   /product="tRNA-Lys"
FT                   /function="16.2: Construct biomass (Anabolism)"
FT                   /note="transfer RNA-Lys(UUU); Evidence 2a: Function from
FT                   experimental evidences in other organisms; Product type n:
FT                   RNA"
FT                   /inference="profile:tRNAscan:1.23"
FT   gene            95649..95731
FT                   /gene="trnJ-Leu1"
FT                   /locus_tag="BSU_tRNA_15"
FT   tRNA            95649..95731
FT                   /gene="trnJ-Leu1"
FT                   /locus_tag="BSU_tRNA_15"
FT                   /product="tRNA-Leu"
FT                   /function="16.2: Construct biomass (Anabolism)"
FT                   /note="transfer RNA-Leu(UAG); Evidence 2a: Function from
FT                   experimental evidences in other organisms; Product type n:
FT                   RNA"
FT                   /inference="profile:tRNAscan:1.23"
FT   gene            95772..95846
FT                   /gene="trnJ-Gly"
FT                   /locus_tag="BSU_tRNA_16"
FT   tRNA            95772..95846
FT                   /gene="trnJ-Gly"
FT                   /locus_tag="BSU_tRNA_16"
FT                   /product="tRNA-Gly"
FT                   /function="16.2: Construct biomass (Anabolism)"
FT                   /note="transfer RNA-Gly(GCC); Evidence 2a: Function from
FT                   experimental evidences in other organisms; Product type n:
FT                   RNA"
FT                   /inference="profile:tRNAscan:1.23"
FT   gene            95861..95946
FT                   /gene="trnJ-Leu2"
FT                   /locus_tag="BSU_tRNA_17"
FT   tRNA            95861..95946
FT                   /gene="trnJ-Leu2"
FT                   /locus_tag="BSU_tRNA_17"
FT                   /product="tRNA-Leu"
FT                   /function="16.2: Construct biomass (Anabolism)"
FT                   /note="transfer RNA-Leu(UAA); Evidence 2a: Function from
FT                   experimental evidences in other organisms; Product type n:
FT                   RNA"
FT                   /inference="profile:tRNAscan:1.23"
FT   gene            95956..96032
FT                   /gene="trnJ-Arg"
FT                   /locus_tag="BSU_tRNA_18"
FT   tRNA            95956..96032
FT                   /gene="trnJ-Arg"
FT                   /locus_tag="BSU_tRNA_18"
FT                   /product="tRNA-Arg"
FT                   /function="16.2: Construct biomass (Anabolism)"
FT                   /note="arginine transfer RNA(ACG); Evidence 2a: Function
FT                   from experimental evidences in other organisms; PubMedId:
FT                   27749819; Product type n : RNA"
FT                   /inference="profile:tRNAscan:1.23"
FT   gene            96060..96136
FT                   /gene="trnJ-Pro"
FT                   /locus_tag="BSU_tRNA_19"
FT   tRNA            96060..96136
FT                   /gene="trnJ-Pro"
FT                   /locus_tag="BSU_tRNA_19"
FT                   /product="tRNA-Pro"
FT                   /function="16.2: Construct biomass (Anabolism)"
FT                   /note="transfer RNA-Pro(UGG); Evidence 2a: Function from
FT                   experimental evidences in other organisms; Product type n:
FT                   RNA"
FT                   /inference="profile:tRNAscan:1.23"
FT   gene            96146..96221
FT                   /gene="trnJ-Ala"
FT                   /locus_tag="BSU_tRNA_20"
FT   tRNA            96146..96221
FT                   /gene="trnJ-Ala"
FT                   /locus_tag="BSU_tRNA_20"
FT                   /product="tRNA-Ala"
FT                   /function="16.2: Construct biomass (Anabolism)"
FT                   /note="transfer RNA-Ala(UGC); Evidence 2a: Function from
FT                   experimental evidences in other organisms; Product type n:
FT                   RNA"
FT                   /inference="profile:tRNAscan:1.23"
FT   gene            96392..97945
FT                   /gene="rrnW-16S"
FT                   /locus_tag="BSU_rRNA_9"
FT   rRNA            96392..97945
FT                   /gene="rrnW-16S"
FT                   /locus_tag="BSU_rRNA_9"
FT                   /product="ribosomal RNA-16S"
FT                   /function="16.2: Construct biomass (Anabolism)"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; Product type n: RNA"
FT   gene            98110..101037
FT                   /gene="rrnW-23S"
FT                   /locus_tag="BSU_rRNA_10"
FT   rRNA            98110..101037
FT                   /gene="rrnW-23S"
FT                   /locus_tag="BSU_rRNA_10"
FT                   /product="ribosomal RNA-23S"
FT                   /function="16.2: Construct biomass (Anabolism)"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; Product type n: RNA"
FT   gene            101093..101211
FT                   /gene="rrnW-5S"
FT                   /locus_tag="BSU_rRNA_11"
FT   rRNA            101093..101211
FT                   /gene="rrnW-5S"
FT                   /locus_tag="BSU_rRNA_11"
FT                   /product="ribosomal RNA-5S"
FT                   /function="16.2: Construct biomass (Anabolism)"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; Product type n: RNA"
FT   gene            101449..101913
FT                   /gene="ctsR"
FT                   /locus_tag="BSU_00830"
FT                   /old_locus_tag="BSU00830"
FT   CDS_pept        101449..101913
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ctsR"
FT                   /locus_tag="BSU_00830"
FT                   /old_locus_tag="BSU00830"
FT                   /product="transcriptional regulator of class III stress
FT                   genes"
FT                   /function="16.3: Control"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 2120829, 9852015, 11069659,
FT                   12618461, 16163393, 20852588, 24465625, 27388279; Product
FT                   type r: regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BSU00830"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11859"
FT                   /db_xref="GOA:P37568"
FT                   /db_xref="InterPro:IPR008463"
FT                   /db_xref="InterPro:IPR040465"
FT                   /db_xref="InterPro:IPR041473"
FT                   /db_xref="InterPro:IPR041902"
FT                   /db_xref="InterPro:IPR041908"
FT                   /db_xref="SubtiList:BG10145"
FT                   /db_xref="UniProtKB/Swiss-Prot:P37568"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:2120829, 9852015, 11069659, 12618461, 16163393,
FT                   20852588, 24465625, 27388279"
FT                   /protein_id="CAB11859.1"
FT                   /translation="MGHNISDIIEQYLKRVLDQNGKEILEIKRSEIADKFQCVPSQINY
FT                   VINTRFTSERGYIVESKRGGGGYIRIIKIKMNNEVVLINNIISQINTHLSQAASDDIIL
FT                   RLLEDKVISEREAKMMVSVMDRSVLHIDLPERDELRARMMKAMLTSLKLK"
FT   gene            101927..102484
FT                   /gene="mcsA"
FT                   /locus_tag="BSU_00840"
FT                   /old_locus_tag="BSU00840"
FT   CDS_pept        101927..102484
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mcsA"
FT                   /locus_tag="BSU_00840"
FT                   /old_locus_tag="BSU00840"
FT                   /product="activator of protein kinase McsB"
FT                   /function="16.3: Control"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 16163393, 19189946, 24947607;
FT                   Product type f: factor"
FT                   /db_xref="EnsemblGenomes-Gn:BSU00840"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11860"
FT                   /db_xref="GOA:P37569"
FT                   /db_xref="InterPro:IPR001943"
FT                   /db_xref="InterPro:IPR025542"
FT                   /db_xref="InterPro:IPR036876"
FT                   /db_xref="SubtiList:BG10146"
FT                   /db_xref="UniProtKB/Swiss-Prot:P37569"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:16163393, 19189946, 24947607"
FT                   /protein_id="CAB11860.1"
FT                   /translation="MICQECHERPATFHFTKVVNGEKIEVHICEQCAKENSDSYGISAN
FT                   QGFSIHNLLSGLLNMDSSFQNAGTQMFSHSEQISACPKCGMTFQQFRKIGRFGCSECYK
FT                   TFHSNITPILRKVHSGNTVHAGKIPKRIGGNLHVRRQIDMLKKELESLIHQEEFENAAH
FT                   VRDQIRLLEQSLKSTDSEEEQE"
FT   gene            102484..103575
FT                   /gene="mcsB"
FT                   /locus_tag="BSU_00850"
FT                   /old_locus_tag="BSU00850"
FT   CDS_pept        102484..103575
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mcsB"
FT                   /locus_tag="BSU_00850"
FT                   /old_locus_tag="BSU00850"
FT                   /product="protein arginine kinase"
FT                   /function="16.3: Control"
FT                   /EC_number="2.7.3.3"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 16163393, 17380125, 19189946,
FT                   21622759, 25610436, 27749819; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU00850"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11861"
FT                   /db_xref="GOA:P37570"
FT                   /db_xref="InterPro:IPR000749"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR022414"
FT                   /db_xref="InterPro:IPR022415"
FT                   /db_xref="InterPro:IPR023660"
FT                   /db_xref="SubtiList:BG10147"
FT                   /db_xref="UniProtKB/Swiss-Prot:P37570"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:16163393, 17380125, 19189946, 21622759, 25610436,
FT                   27749819"
FT                   /protein_id="CAB11861.1"
FT                   /translation="MSLKHFIQDALSSWMKQKGPESDIVLSSRIRLARNFEHIRFPTRY
FT                   SNEEASSIIQQFEDQFSEQEIPGIGKFVLIRMNDAQPLEKRVLVEKHLISPNLTESPFG
FT                   GCLLSENEEVSVMLNEEDHIRIQCLFPGFQLLEAMKAANQVDDWIEEKVDYAFNEQRGY
FT                   LTSCPTNVGTGLRASVMMHLPALVLTRQINRIIPAINQLGLVVRGIYGEGSEAVGNIFQ
FT                   ISNQITLGKSEQDIVEDLNSVAAQLIEQERSAREAIYQTSKIELEDRVYRSYGVLSNCR
FT                   MIESKETAKCLSDVRLGIDLGIIKGLSSNILNELMILTQPGFLQQYSGGALRPNERDIR
FT                   RAALIRERLHLEMNGKRQEDESI"
FT   gene            103572..106004
FT                   /gene="clpC"
FT                   /locus_tag="BSU_00860"
FT                   /old_locus_tag="BSU00860"
FT   CDS_pept        103572..106004
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="clpC"
FT                   /locus_tag="BSU_00860"
FT                   /old_locus_tag="BSU00860"
FT                   /product="class III stress response-related ATPase, AAA+
FT                   superfamily"
FT                   /function="16.6: Maintain"
FT                   /function="16.3: Control"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 12354604, 15529410, 16525504,
FT                   26735940, 27749819; Product type f: factor"
FT                   /db_xref="EnsemblGenomes-Gn:BSU00860"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11862"
FT                   /db_xref="GOA:P37571"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR001943"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004176"
FT                   /db_xref="InterPro:IPR018368"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028299"
FT                   /db_xref="InterPro:IPR036628"
FT                   /db_xref="InterPro:IPR041546"
FT                   /db_xref="PDB:2K77"
FT                   /db_xref="PDB:2Y1Q"
FT                   /db_xref="PDB:2Y1R"
FT                   /db_xref="PDB:3J3R"
FT                   /db_xref="PDB:3J3S"
FT                   /db_xref="PDB:3J3T"
FT                   /db_xref="PDB:3J3U"
FT                   /db_xref="PDB:3PXG"
FT                   /db_xref="PDB:3PXI"
FT                   /db_xref="PDB:5HBN"
FT                   /db_xref="SubtiList:BG10148"
FT                   /db_xref="UniProtKB/Swiss-Prot:P37571"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:12354604, 15529410, 16525504, 26735940, 27749819"
FT                   /protein_id="CAB11862.1"
FT                   /translation="MMFGRFTERAQKVLALAQEEALRLGHNNIGTEHILLGLVREGEGI
FT                   AAKALQALGLGSEKIQKEVESLIGRGQEMSQTIHYTPRAKKVIELSMDEARKLGHSYVG
FT                   TEHILLGLIREGEGVAARVLNNLGVSLNKARQQVLQLLGSNETGSSAAGTNSNANTPTL
FT                   DSLARDLTAIAKEDSLDPVIGRSKEIQRVIEVLSRRTKNNPVLIGEPGVGKTAIAEGLA
FT                   QQIINNEVPEILRDKRVMTLDMGTVVAGTKYRGEFEDRLKKVMDEIRQAGNIILFIDEL
FT                   HTLIGAGGAEGAIDASNILKPSLARGELQCIGATTLDEYRKYIEKDAALERRFQPIQVD
FT                   QPSVDESIQILQGLRDRYEAHHRVSITDDAIEAAVKLSDRYISDRFLPDKAIDLIDEAG
FT                   SKVRLRSFTTPPNLKELEQKLDEVRKEKDAAVQSQEFEKAASLRDTEQRLREQVEDTKK
FT                   SWKEKQGQENSEVTVDDIAMVVSSWTGVPVSKIAQTETDKLLNMENILHSRVIGQDEAV
FT                   VAVAKAVRRARAGLKDPKRPIGSFIFLGPTGVGKTELARALAESIFGDEESMIRIDMSE
FT                   YMEKHSTSRLVGSPPGYVGYDEGGQLTEKVRRKPYSVVLLDEIEKAHPDVFNILLQVLE
FT                   DGRLTDSKGRTVDFRNTILIMTSNVGASELKRNKYVGFNVQDETQNHKDMKDKVMGELK
FT                   RAFRPEFINRIDEIIVFHSLEKKHLTEIVSLMSDQLTKRLKEQDLSIELTDAAKAKVAE
FT                   EGVDLEYGARPLRRAIQKHVEDRLSEELLRGNIHKGQHIVLDVEDGEFVVKTTAKTN"
FT   gene            106096..107472
FT                   /gene="radA"
FT                   /locus_tag="BSU_00870"
FT                   /old_locus_tag="BSU00870"
FT   CDS_pept        106096..107472
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="radA"
FT                   /locus_tag="BSU_00870"
FT                   /old_locus_tag="BSU00870"
FT                   /product="DNA repair protein; 6-O-methylguanine-DNA
FT                   methyltransferase"
FT                   /function="16.6: Maintain"
FT                   /EC_number="2.1.1.63"
FT                   /note="Evidence 2b: Function from indirect experimental
FT                   evidences (e.g. phenotypes); PubMedId: 10931349, 11810266,
FT                   15317759, 25616256; Product type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU00870"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11863"
FT                   /db_xref="GOA:P37572"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004504"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020588"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041166"
FT                   /db_xref="SubtiList:BG10149"
FT                   /db_xref="UniProtKB/Swiss-Prot:P37572"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB11863.1"
FT                   /translation="MAKTKSKFICQSCGYESPKWMGKCPGCGAWNTMVEEMIKKAPANR
FT                   RAAFSHSVQTVQKPSPITSIETSEEPRVKTQLGEFNRVLGGGVVKGSLVLIGGDPGIGK
FT                   STLLLQVSAQLSGSSNSVLYISGEESVKQTKLRADRLGINNPSLHVLSETDMEYISSAI
FT                   QEMNPSFVVVDSIQTVYQSDITSAPGSVSQVRECTAELMKIAKTKGIPIFIVGHVTKEG
FT                   SIAGPRLLEHMVDTVLYFEGERHHTFRILRAVKNRFGSTNEMGIFEMREEGLTEVLNPS
FT                   EIFLEERSAGSAGSSITASMEGTRPILVEIQALISPTSFGNPRRMATGIDHNRVSLLMA
FT                   VLEKRVGLLLQNQDAYLKVAGGVKLDEPAIDLAIVISIASSFRDTPPNPADCFIGEVGL
FT                   TGEVRRVSRIEQRVKEAAKLGFKRMIIPAANLDGWTKPKGIEVIGVANVAEALRTSLGG
FT                   "
FT   gene            107476..108558
FT                   /gene="disA"
FT                   /locus_tag="BSU_00880"
FT                   /old_locus_tag="BSU00880"
FT   CDS_pept        107476..108558
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="disA"
FT                   /locus_tag="BSU_00880"
FT                   /old_locus_tag="BSU00880"
FT                   /product="diadenylate cyclase; DNA integrity scanning
FT                   protein; cell cycle checkpoint DNA scanning protein"
FT                   /function="16.6: Maintain"
FT                   /function="16.3: Control"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 16713562, 21566650, 24939848,
FT                   25616256, 27074767, 27150552, 28511132, 28961460; Product
FT                   type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU00880"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11864"
FT                   /db_xref="GOA:P37573"
FT                   /db_xref="InterPro:IPR003390"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR018906"
FT                   /db_xref="InterPro:IPR023763"
FT                   /db_xref="InterPro:IPR036888"
FT                   /db_xref="InterPro:IPR038331"
FT                   /db_xref="SubtiList:BG10150"
FT                   /db_xref="UniProtKB/Swiss-Prot:P37573"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:16713562, 21566650, 24939848, 25616256, 27074767,
FT                   27150552, 28511132, 28961460"
FT                   /protein_id="CAB11864.1"
FT                   /translation="MEKEKKGAKHELDLSSILQFVAPGTPLRAGMENVLRANTGGLIVV
FT                   GYNDKVKEVVDGGFHINTAFSPAHLYELAKMDGAIILSDSGQKILYANTQLMPDATISS
FT                   SETGMRHRTAERVAKQTGCLVIAISERRNVITLYQENMKYTLKDIGFILTKANQAIQTL
FT                   EKYKTILDKTINALNALEFEELVTFSDVLSVMHRYEMVLRIKNEINMYIKELGTEGHLI
FT                   KLQVIELITDMEEEAALFIKDYVKEKIKDPFVLLKELQDMSSYDLLDDSIVYKLLGYPA
FT                   STNLDDYVLPRGYRLLNKIPRLPMPIVENVVEAFGVLPRIIEASAEELDEVEGIGEVRA
FT                   QKIKKGLKRLQEKHYLDRQL"
FT   gene            108674..109774
FT                   /gene="yacL"
FT                   /locus_tag="BSU_00890"
FT                   /old_locus_tag="BSU00890"
FT   CDS_pept        108674..109774
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yacL"
FT                   /locus_tag="BSU_00890"
FT                   /old_locus_tag="BSU00890"
FT                   /product="putative membrane protein possibly involved in
FT                   RNA binding"
FT                   /note="Evidence 3: Putative function from multiple
FT                   computational evidences; PubMedId: 26999498; Product type
FT                   m: membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:BSU00890"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11865"
FT                   /db_xref="GOA:Q06754"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR002792"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="SubtiList:BG10151"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q06754"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB11865.1"
FT                   /translation="MLKRIVQAFFIIFGGVVGIFLIPELFVLLNIQDIPLITNAYTSAA
FT                   IGAIIFFLISIWGTEYVVNWVKWIEDSLLKAPVPDLLFGSLGLVFGLIIAYLIVNVIPL
FT                   DNIPYRIFSTIIPVFLAFFLGYLGFQVGFKKKDELISLFSISARMQKKKGTADEEHEVQ
FT                   DKKLKILDTSVIIDGRIADICQTGFLEGVIVIPQFVLEELQHIADSSDVLKRNRGRRGL
FT                   DILNRIQKELDIEVEIYEGDFEDIQEVDSKLVKLAKLTSGVVVTNDFNLNKVCELQKVA
FT                   VLNINDLANAVKPVVLPGEEMNVQVIKDGKEHNQGVAYLDDGTMIVVEEGRNYIGKHID
FT                   VLVTSVLQTAAGRMIFAKPKLLEKAL"
FT   gene            109789..110487
FT                   /gene="ispD"
FT                   /locus_tag="BSU_00900"
FT                   /old_locus_tag="BSU00900"
FT   CDS_pept        109789..110487
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ispD"
FT                   /locus_tag="BSU_00900"
FT                   /old_locus_tag="BSU00900"
FT                   /product="2-C-methyl-D-erythritol 4-phosphate
FT                   cytidylyltransferase, nonmevalonate isoprenoid pathway"
FT                   /function="16.2: Construct biomass (Anabolism)"
FT                   /EC_number="2.7.7.60"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 12682299, 15044829, 15379557,
FT                   16533036, 17081012, 17458547, 23840410, 27821871; Product
FT                   type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU00900"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11866"
FT                   /db_xref="GOA:Q06755"
FT                   /db_xref="InterPro:IPR001228"
FT                   /db_xref="InterPro:IPR018294"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR034683"
FT                   /db_xref="PDB:5DDT"
FT                   /db_xref="PDB:5DDV"
FT                   /db_xref="PDB:5HS2"
FT                   /db_xref="SubtiList:BG10152"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q06755"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:12682299, 15044829, 15379557, 16533036, 17081012,
FT                   17458547, 23840410, 27821871"
FT                   /protein_id="CAB11866.1"
FT                   /translation="MSYDVVIPAAGQGKRMKAGRNKLFIELKGDPVIIHTLRVFDSHRQ
FT                   CDKIILVINEQEREHFQQLLSDYPFQTSIELVAGGDERQHSVYKGLKAVKQEKIVLVHD
FT                   GARPFIKHEQIDELIAEAEQTGAAILAVPVKDTIKRVQDLQVSETIERSSLWAVQTPQA
FT                   FRLSLLMKAHAEAERKGFLGTDDASLVEQMEGGSVRVVEGSYTNIKLTTPDDLTSAEAI
FT                   MESESGNKHV"
FT   gene            110480..110956
FT                   /gene="ispF"
FT                   /locus_tag="BSU_00910"
FT                   /old_locus_tag="BSU00910"
FT   CDS_pept        110480..110956
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ispF"
FT                   /locus_tag="BSU_00910"
FT                   /old_locus_tag="BSU00910"
FT                   /product="2-C-methyl-D-erythritol-2,4-cyclodiphosphate
FT                   synthase"
FT                   /function="16.2: Construct biomass (Anabolism)"
FT                   /EC_number="4.6.1.12"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 9622350, 11997478, 12270818,
FT                   12682299, 17458547, 23840410; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU00910"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11867"
FT                   /db_xref="GOA:Q06756"
FT                   /db_xref="InterPro:IPR003526"
FT                   /db_xref="InterPro:IPR020555"
FT                   /db_xref="InterPro:IPR036571"
FT                   /db_xref="PDB:5IWX"
FT                   /db_xref="PDB:5IWY"
FT                   /db_xref="SubtiList:BG10153"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q06756"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:9622350, 11997478, 12270818, 12682299, 17458547,
FT                   23840410"
FT                   /protein_id="CAB11867.1"
FT                   /translation="MFRIGQGFDVHQLVEGRPLIIGGIEIPYEKGLLGHSDADVLLHTV
FT                   ADACLGAVGEGDIGKHFPDTDPEFKDADSFKLLQHVWGIVKQKGYVLGNIDCTIIAQKP
FT                   KMLPYIEDMRKRIAEGLEADVSQVNVKATTTEKLGFTGRAEGIAAQATVLIQKG"
FT   gene            111047..112498
FT                   /gene="gltX"
FT                   /locus_tag="BSU_00920"
FT                   /old_locus_tag="BSU00920"
FT   CDS_pept        111047..112498
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gltX"
FT                   /locus_tag="BSU_00920"
FT                   /old_locus_tag="BSU00920"
FT                   /product="glutamyl-tRNA synthetase"
FT                   /function="16.2: Construct biomass (Anabolism)"
FT                   /EC_number="6.1.1.17"
FT                   /EC_number="6.1.1.24"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 2120226, 3079749, 9342321,
FT                   10024179, 10546897, 12682299, 14741355; Product type e:
FT                   enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU00920"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11868"
FT                   /db_xref="GOA:P22250"
FT                   /db_xref="InterPro:IPR000924"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR004527"
FT                   /db_xref="InterPro:IPR008925"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020058"
FT                   /db_xref="InterPro:IPR020751"
FT                   /db_xref="InterPro:IPR033910"
FT                   /db_xref="SubtiList:BG10154"
FT                   /db_xref="UniProtKB/Swiss-Prot:P22250"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:2120226, 3079749, 9342321, 10024179, 10546897,
FT                   12682299, 14741355"
FT                   /protein_id="CAB11868.1"
FT                   /translation="MGNEVRVRYAPSPTGHLHIGNARTALFNYLFARNQGGKFIIRVED
FT                   TDKKRNIEGGEQSQLNYLKWLGIDWDESVDVGGEYGPYRQSERNDIYKVYYEELLEKGL
FT                   AYKCYCTEEELEKEREEQIARGEMPRYSGKHRDLTQEEQEKFIAEGRKPSIRFRVPEGK
FT                   VIAFNDIVKGEISFESDGIGDFVIVKKDGTPTYNFAVAIDDYLMKMTHVLRGEDHISNT
FT                   PKQIMIYQAFGWDIPQFGHMTLIVNESRKKLSKRDESIIQFIEQYKELGYLPEALFNFI
FT                   GLLGWSPVGEEELFTKEQFIEIFDVNRLSKSPALFDMHKLKWVNNQYVKKLDLDQVVEL
FT                   TLPHLQKAGKVGTELSAEEQEWVRKLISLYHEQLSYGAEIVELTDLFFTDEIEYNQEAK
FT                   AVLEEEQVPEVLSTFAAKLEELEEFTPDNIKASIKAVQKETGHKGKKLFMPIRVAVTGQ
FT                   THGPELPQSIELIGKETAIQRLKNI"
FT   gene            112800..113453
FT                   /gene="cysE"
FT                   /locus_tag="BSU_00930"
FT                   /old_locus_tag="BSU00930"
FT   CDS_pept        112800..113453
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysE"
FT                   /locus_tag="BSU_00930"
FT                   /old_locus_tag="BSU00930"
FT                   /product="serine O-acetyltransferase"
FT                   /function="16.2: Construct biomass (Anabolism)"
FT                   /function="16.3: Control"
FT                   /EC_number="2.3.1.30"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 7510287, 10737181, 10939241,
FT                   17056751, 18974048, 25731080; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU00930"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11869"
FT                   /db_xref="GOA:Q06750"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005881"
FT                   /db_xref="InterPro:IPR010493"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR042122"
FT                   /db_xref="SubtiList:BG10155"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q06750"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:7510287, 10737181, 10939241, 17056751, 18974048,
FT                   25731080"
FT                   /protein_id="CAB11869.1"
FT                   /translation="MFFRMLKEDIDTVFDQDPAARSYFEVILTYSGLHAIWAHRIAHAL
FT                   YKRKFYFLARLISQVSRFFTGIEIHPGATIGRRFFIDHGMGVVIGETCEIGNNVTVFQG
FT                   VTLGGTGKEKGKRHPTIKDDALIATGAKVLGSITVGEGSKIGAGSVVLHDVPDFSTVVG
FT                   IPGRVVVQNGKKVRRDLNHQDLPDPVADRFKSLEQQILELKAELEDRKERINQK"
FT   gene            113450..114850
FT                   /gene="cysS"
FT                   /locus_tag="BSU_00940"
FT                   /old_locus_tag="BSU00940"
FT   CDS_pept        113450..114850
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysS"
FT                   /locus_tag="BSU_00940"
FT                   /old_locus_tag="BSU00940"
FT                   /product="dual cysteinyl-tRNA synthetase; cysteine
FT                   persulfide synthase"
FT                   /function="16.2: Construct biomass (Anabolism)"
FT                   /EC_number="6.1.1.16"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 10024179, 10546897, 10931887,
FT                   12682299, 29079736; Product type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU00940"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11870"
FT                   /db_xref="GOA:Q06752"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015273"
FT                   /db_xref="InterPro:IPR015803"
FT                   /db_xref="InterPro:IPR024909"
FT                   /db_xref="InterPro:IPR032678"
FT                   /db_xref="SubtiList:BG10156"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q06752"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:10024179, 10546897, 10931887, 12682299, 29079736"
FT                   /protein_id="CAB11870.1"
FT                   /translation="MTITLYNTLTRQKETFVPLEEGKVKMYVCGPTVYNYIHIGNARPA
FT                   IVYDTVRNYLEYKGYDVQYVSNFTDVDDKLIKAANELGEDVPTISERFIKAYFEDVGAL
FT                   GCRKADLHPRVMENMDAIIEFVDQLVKKGYAYESEGDVYFKTRAFEGYGKLSQQSIDEL
FT                   RSGARIRVGEKKEDALDFALWKAAKEGEISWDSPWGKGRPGWHIECSAMVKKYLGDQID
FT                   IHAGGQDLTFPHHENEIAQSEALTGKTFAKYWLHNGYINIDNEKMSKSLGNFVLVHDII
FT                   KQHDPQLLRFFMLSVHYRHPINYSEELLENTKSAFSRLKTAYSNLQHRLNSSTNLTEDD
FT                   DQWLEKVEEHRKAFEEEMDDDFNTANAISVLFDLAKHANYYLQKDHTADHVITAFIEMF
FT                   DRIVSVLGFSLGEQELLDQEIEDLIEKRNEARRNRDFALSDQIRDQLKSMNIILEDTAQ
FT                   GTRWKRGE"
FT   gene            114854..115285
FT                   /gene="mrnC"
FT                   /locus_tag="BSU_00950"
FT                   /old_locus_tag="BSU00950"
FT   CDS_pept        114854..115285
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mrnC"
FT                   /locus_tag="BSU_00950"
FT                   /old_locus_tag="BSU00950"
FT                   /product="ribonuclease for 23S RNA maturation, mini-RNase
FT                   III"
FT                   /function="16.6: Maintain"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 16014871, 25634891, 27924926;
FT                   Product type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU00950"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11871"
FT                   /db_xref="GOA:O31418"
FT                   /db_xref="InterPro:IPR000999"
FT                   /db_xref="InterPro:IPR008226"
FT                   /db_xref="InterPro:IPR036389"
FT                   /db_xref="PDB:4OUN"
FT                   /db_xref="SubtiList:BG12702"
FT                   /db_xref="UniProtKB/Swiss-Prot:O31418"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:16014871, 25634891, 27924926"
FT                   /protein_id="CAB11871.1"
FT                   /translation="MLEFDTIKDSKQLNGLALAYIGDAIFEVYVRHHLLKQGFTKPNDL
FT                   HKKSSRIVSAKSQAEILFFLQNQSFFTEEEEAVLKRGRNAKSGTTPKNTDVQTYRYSTA
FT                   FEALLGYLFLEKKEERLSQLVAEAIQFGTSGRKTNESAT"
FT   gene            115269..116018
FT                   /gene="rlmB"
FT                   /locus_tag="BSU_00960"
FT                   /old_locus_tag="BSU00960"
FT   CDS_pept        115269..116018
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rlmB"
FT                   /locus_tag="BSU_00960"
FT                   /old_locus_tag="BSU00960"
FT                   /product="23S rRNA (Gm2251)-methyltransferase"
FT                   /function="16.2: Construct biomass (Anabolism)"
FT                   /EC_number="2.1.1.185"
FT                   /note="Evidence 2a: Function from experimental evidences in
FT                   other organisms; PubMedId: 11698387, 12377117, 16014871;
FT                   Product type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU00960"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11872"
FT                   /db_xref="GOA:Q06753"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR004441"
FT                   /db_xref="InterPro:IPR013123"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="SubtiList:BG10157"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q06753"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB11872.1"
FT                   /translation="MSQQHDYVIGKNAVIETLKSDRKLYKLWMAENTVKGQAQQVIELA
FT                   KKQGITIQYVPRKKLDQMVTGQHQGVVAQVAAYEYAELDDLYKAAEEKNEQPFFLILDE
FT                   LEDPHNLGSIMRTADAVGAHGIVIPKRRAVGLTTTVAKASTGAIEHIPVARVTNLARTL
FT                   EEMKERGIWVVGTDASAREDFRNMDGNMPLALVIGSEGKGMGRLVKEKCDFLIKLPMAG
FT                   KVTSLNASVAAGLLMYEVYRKRNPVGE"
FT   gene            116025..116537
FT                   /gene="raeA"
FT                   /locus_tag="BSU_00970"
FT                   /old_locus_tag="BSU00970"
FT   CDS_pept        116025..116537
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="raeA"
FT                   /locus_tag="BSU_00970"
FT                   /old_locus_tag="BSU00970"
FT                   /product="ribosome-dependent mRNA endonuclease"
FT                   /function="16.11: Scavenge (Catabolism)"
FT                   /function="16.6: Maintain"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 17114934, 23355615, 28363943;
FT                   Product type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU00970"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11873"
FT                   /db_xref="InterPro:IPR010298"
FT                   /db_xref="PDB:5MQ8"
FT                   /db_xref="PDB:5MQ9"
FT                   /db_xref="SubtiList:BG10158"
FT                   /db_xref="UniProtKB/Swiss-Prot:P37574"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:17114934, 23355615, 28363943"
FT                   /protein_id="CAB11873.1"
FT                   /translation="MDILLVDGYNMIGAWPQLKDLKANSFEEARDVLIQKMAEYQSYTG
FT                   NRVIVVFDAHLVKGLEKKQTNHRVEVIFTKENETADERIEKLAQALNNIATQIHVATSD
FT                   YTEQWAIFGQGALRKSARELLREVETIERRIERRVRKITSEKPAGKIALSEEVLKTFEK
FT                   WRRGDLD"
FT   gene            116600..117256
FT                   /gene="sigH"
FT                   /locus_tag="BSU_00980"
FT                   /old_locus_tag="BSU00980"
FT   CDS_pept        116600..117256
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sigH"
FT                   /locus_tag="BSU_00980"
FT                   /old_locus_tag="BSU00980"
FT                   /product="RNA polymerase sigma-30 factor (sigma(H))"
FT                   /function="16.3: Control"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 12169614, 16339734, 25288929,
FT                   26712348; Product type f: factor"
FT                   /db_xref="EnsemblGenomes-Gn:BSU00980"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11874"
FT                   /db_xref="GOA:P17869"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014218"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR016371"
FT                   /db_xref="SubtiList:BG10159"
FT                   /db_xref="UniProtKB/Swiss-Prot:P17869"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:12169614, 16339734, 25288929, 26712348"
FT                   /protein_id="CAB11874.1"
FT                   /translation="MNLQNNKGKFNKEQFCQLEDEQVIEKVHVGDSDALDYLITKYRNF
FT                   VRAKARSYFLIGADREDIVQEGMIGLYKSIRDFKEDKLTSFKAFAELCITRQIITAIKT
FT                   ATRQKHIPLNSYASLDKPIFDEESDRTLLDVISGAKTLNPEEMIINQEEFDDIEMKMGE
FT                   LLSDLERKVLVLYLDGRSYQEISDELNRHVKSIDNALQRVKRKLEKYLEIREISL"
FT   gene            117349..117498
FT                   /gene="rpmGB"
FT                   /locus_tag="BSU_00990"
FT                   /old_locus_tag="BSU00990"
FT   CDS_pept        117349..117498
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmGB"
FT                   /locus_tag="BSU_00990"
FT                   /old_locus_tag="BSU00990"
FT                   /product="ribosomal protein L33"
FT                   /function="16.2: Construct biomass (Anabolism)"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 12682299, 14586115, 19648245,
FT                   23002217, 27561249; Product type f: factor"
FT                   /db_xref="EnsemblGenomes-Gn:BSU00990"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11875"
FT                   /db_xref="GOA:Q06798"
FT                   /db_xref="InterPro:IPR001705"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="InterPro:IPR018264"
FT                   /db_xref="InterPro:IPR038584"
FT                   /db_xref="SubtiList:BG10160"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q06798"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:12682299, 14586115, 19648245, 23002217, 27561249"
FT                   /protein_id="CAB11875.1"
FT                   /translation="MRKKITLACKTCGNRNYTTMKSSASAAERLEVKKYCSTCNSHTAH
FT                   LETK"
FT   gene            117532..117711
FT                   /gene="secE"
FT                   /locus_tag="BSU_01000"
FT                   /old_locus_tag="BSU01000"
FT   CDS_pept        117532..117711
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secE"
FT                   /locus_tag="BSU_01000"
FT                   /old_locus_tag="BSU01000"
FT                   /product="preprotein translocase subunit"
FT                   /function="16.1: Circulate"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 11976315, 12682299, 16242710,
FT                   22304380, 22720735; Product type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BSU01000"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11876"
FT                   /db_xref="GOA:Q06799"
FT                   /db_xref="InterPro:IPR001901"
FT                   /db_xref="InterPro:IPR005807"
FT                   /db_xref="InterPro:IPR038379"
FT                   /db_xref="SubtiList:BG10161"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q06799"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:11976315, 12682299, 16242710, 22304380, 22720735"
FT                   /protein_id="CAB11876.1"
FT                   /translation="MRIMKFFKDVGKEMKKVSWPKGKELTRYTITVISTVIFFVIFFAL
FT                   LDTGISQLIRLIVE"
FT   gene            117890..118423
FT                   /gene="nusG"
FT                   /locus_tag="BSU_01010"
FT                   /old_locus_tag="BSU01010"
FT   CDS_pept        117890..118423
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nusG"
FT                   /locus_tag="BSU_01010"
FT                   /old_locus_tag="BSU01010"
FT                   /product="RNA polymerase elongation pause factor"
FT                   /function="16.2: Construct biomass (Anabolism)"
FT                   /function="16.3: Control"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 11101662, 16014871, 16707701,
FT                   18852477, 26742846, 28507243; Product type f : factor"
FT                   /db_xref="EnsemblGenomes-Gn:BSU01010"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11877"
FT                   /db_xref="GOA:Q06795"
FT                   /db_xref="InterPro:IPR001062"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR006645"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR015869"
FT                   /db_xref="InterPro:IPR036735"
FT                   /db_xref="SubtiList:BG10162"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q06795"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:11101662, 16014871, 16707701, 18852477, 26742846,
FT                   28507243"
FT                   /protein_id="CAB11877.1"
FT                   /translation="MEKNWYVVHTYSGYENKVKANLEKRVESMGMQDKIFRVVVPEEEE
FT                   TDIKNGKKKVVKKKVFPGYVLVEIVMTDDSWYVVRNTPGVTGFVGSAGSGSKPTPLLPG
FT                   EAETILKRMGMDERKTDIDFELKETVKVIDGPFANFTGSIEEIDYDKSKVKVFVNMFGR
FT                   ETPVELEFTQIDKL"
FT   gene            118591..119016
FT                   /gene="rplK"
FT                   /locus_tag="BSU_01020"
FT                   /old_locus_tag="BSU01020"
FT   CDS_pept        118591..119016
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplK"
FT                   /locus_tag="BSU_01020"
FT                   /old_locus_tag="BSU01020"
FT                   /product="ribosomal protein L11 (BL11)"
FT                   /function="16.2: Construct biomass (Anabolism)"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 11244072, 19653700, 20441189;
FT                   Product type s: structure"
FT                   /db_xref="EnsemblGenomes-Gn:BSU01020"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11878"
FT                   /db_xref="GOA:Q06796"
FT                   /db_xref="InterPro:IPR000911"
FT                   /db_xref="InterPro:IPR006519"
FT                   /db_xref="InterPro:IPR020783"
FT                   /db_xref="InterPro:IPR020784"
FT                   /db_xref="InterPro:IPR020785"
FT                   /db_xref="InterPro:IPR036769"
FT                   /db_xref="InterPro:IPR036796"
FT                   /db_xref="PDB:3J3V"
FT                   /db_xref="PDB:3J3W"
FT                   /db_xref="PDB:3J9W"
FT                   /db_xref="SubtiList:BG10163"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q06796"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:11244072, 19653700, 20441189"
FT                   /protein_id="CAB11878.2"
FT                   /translation="MAKKVVKVVKLQIPAGKANPAPPVGPALGQAGVNIMGFCKEFNAR
FT                   TADQAGLIIPVEISVYEDRSFTFITKTPPAAVLLKKAAGIESGSGEPNRNKVATVKRDK
FT                   VREIAETKMPDLNAADVEAAMRMVEGTARSMGIVIED"
FT   gene            119111..119809
FT                   /gene="rplA"
FT                   /locus_tag="BSU_01030"
FT                   /old_locus_tag="BSU01030"
FT   CDS_pept        119111..119809
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplA"
FT                   /locus_tag="BSU_01030"
FT                   /old_locus_tag="BSU01030"
FT                   /product="ribosomal protein L1 (BL1)"
FT                   /function="16.2: Construct biomass (Anabolism)"
FT                   /note="Evidence 2a: Function from experimental evidences in
FT                   other organisms; PubMedId: 12682299, 16352840, 17981968,
FT                   22720735; Product type s: structure"
FT                   /db_xref="EnsemblGenomes-Gn:BSU01030"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11879"
FT                   /db_xref="GOA:Q06797"
FT                   /db_xref="InterPro:IPR002143"
FT                   /db_xref="InterPro:IPR005878"
FT                   /db_xref="InterPro:IPR016095"
FT                   /db_xref="InterPro:IPR023673"
FT                   /db_xref="InterPro:IPR023674"
FT                   /db_xref="InterPro:IPR028364"
FT                   /db_xref="PDB:3J3V"
FT                   /db_xref="PDB:3J3W"
FT                   /db_xref="PDB:6HA8"
FT                   /db_xref="SubtiList:BG10164"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q06797"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB11879.2"
FT                   /translation="MAKKGKKYVEAAKLVDRSKAYDVSEAVALVKKTNTAKFDATVEVA
FT                   FRLGVDPRKNDQQIRGAVVLPNGTGKTQRVLVFAKGEKAKEAEAAGADFVGDTDYINKI
FT                   QQGWFDFDVIVATPDMMGEVGKIGRVLGPKGLMPNPKTGTVTFEVEKAIGEIKAGKVEY
FT                   RVDKAGNIHVPIGKVSFEDEKLVENFTTMYDTILKAKPAAAKGVYVKNVAVTSTMGPGV
FT                   KVDSSTFNVK"
FT   gene            119855..119995
FT                   /gene="ldlJ"
FT                   /locus_tag="BSU_misc_RNA_3"
FT   misc_RNA        119855..119995
FT                   /gene="ldlJ"
FT                   /locus_tag="BSU_misc_RNA_3"
FT                   /product="L10_leader"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 26101249; Product type n:
FT                   RNA"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:26101249"
FT   gene            120061..120561
FT                   /gene="rplJ"
FT                   /locus_tag="BSU_01040"
FT                   /old_locus_tag="BSU01040"
FT   CDS_pept        120061..120561
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplJ"
FT                   /locus_tag="BSU_01040"
FT                   /old_locus_tag="BSU01040"
FT                   /product="ribosomal protein L10 (BL5)"
FT                   /function="16.2: Construct biomass (Anabolism)"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 9810686, 11341315, 12682299,
FT                   18247578, 26101249, 22720735; Product type s : structure"
FT                   /db_xref="EnsemblGenomes-Gn:BSU01040"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11880"
FT                   /db_xref="GOA:P42923"
FT                   /db_xref="InterPro:IPR001790"
FT                   /db_xref="InterPro:IPR002363"
FT                   /db_xref="InterPro:IPR022973"
FT                   /db_xref="PDB:3J9W"
FT                   /db_xref="PDB:5NJT"
FT                   /db_xref="SubtiList:BG11220"
FT                   /db_xref="UniProtKB/Swiss-Prot:P42923"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:9810686, 11341315, 12682299, 18247578, 26101249,
FT                   22720735"
FT                   /protein_id="CAB11880.2"
FT                   /translation="MSSAIETKKVVVEEIASKLKESKSTIIVDYRGLNVSEVTELRKQL
FT                   REANVEFKVYKNTMTRRAVEQAELNGLNDFLTGPNAIAFSTEDVVAPAKVLNDFAKNHE
FT                   ALEIKAGVIEGKVSTVEEVKALAELPSREGLLSMLLSVLQAPVRNLALAAKAVAEQKEE
FT                   QGA"
FT   gene            120607..120978
FT                   /gene="rplL"
FT                   /locus_tag="BSU_01050"
FT                   /old_locus_tag="BSU01050"
FT   CDS_pept        120607..120978
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplL"
FT                   /locus_tag="BSU_01050"
FT                   /old_locus_tag="BSU01050"
FT                   /product="ribosomal protein L12 (BL9)"
FT                   /function="16.2: Construct biomass (Anabolism)"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 12682299, 6771249, 8755892,
FT                   26101249; Product type s: structure"
FT                   /db_xref="EnsemblGenomes-Gn:BSU01050"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11881"
FT                   /db_xref="GOA:P02394"
FT                   /db_xref="InterPro:IPR000206"
FT                   /db_xref="InterPro:IPR008932"
FT                   /db_xref="InterPro:IPR013823"
FT                   /db_xref="InterPro:IPR014719"
FT                   /db_xref="InterPro:IPR036235"
FT                   /db_xref="SubtiList:BG10726"
FT                   /db_xref="UniProtKB/Swiss-Prot:P02394"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:12682299, 6771249, 8755892, 26101249"
FT                   /protein_id="CAB11881.1"
FT                   /translation="MALNIEEIIASVKEATVLELNDLVKAIEEEFGVTAAAPVAVAGGA
FT                   AAGGAAEEQSEFDLILAGAGSQKIKVIKVVREITGLGLKEAKELVDNTPKPLKEGIAKE
FT                   EAEELKAKLEEVGASVEVK"
FT   gene            121068..121673
FT                   /gene="rlmG"
FT                   /locus_tag="BSU_01060"
FT                   /old_locus_tag="BSU01060"
FT   CDS_pept        121068..121673
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rlmG"
FT                   /locus_tag="BSU_01060"
FT                   /old_locus_tag="BSU01060"
FT                   /product="23S rRNA m2G1835 methyltransferase"
FT                   /function="16.6: Maintain"
FT                   /function="16.8: Protect"
FT                   /EC_number="2.1.1.174"
FT                   /note="Evidence 2a: Function from experimental evidences in
FT                   other organisms; PubMedId: 17010380; Product type e :
FT                   enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU01060"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11882"
FT                   /db_xref="GOA:P37872"
FT                   /db_xref="InterPro:IPR007848"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="SubtiList:BG10727"
FT                   /db_xref="UniProtKB/Swiss-Prot:P37872"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB11882.1"
FT                   /translation="MSEHYYSEKPSVKSNKQTWSFRLRNKDFTFTSDSGVFSKKEVDFG
FT                   SRLLIDSFEEPEVEGGILDVGCGYGPIGLSLASDFKDRTIHMIDVNERAVELSNENAEQ
FT                   NGITNVKIYQSDLFSNVDSAQTFASILTNPPIRAGKKVVHAIFEKSAEHLKASGELWIV
FT                   IQKKQGAPSAIEKLEELFDEVSVVQKKKGYYIIKAKKV"
FT   gene            121919..125500
FT                   /gene="rpoB"
FT                   /locus_tag="BSU_01070"
FT                   /old_locus_tag="BSU01070"
FT   CDS_pept        121919..125500
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoB"
FT                   /locus_tag="BSU_01070"
FT                   /old_locus_tag="BSU01070"
FT                   /product="RNA polymerase (beta subunit)"
FT                   /function="16.2: Construct biomass (Anabolism)"
FT                   /EC_number="2.7.7.6"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 10049799, 10744988, 12455702,
FT                   12682299, 15060052, 28163698; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU01070"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11883"
FT                   /db_xref="GOA:P37870"
FT                   /db_xref="InterPro:IPR007120"
FT                   /db_xref="InterPro:IPR007121"
FT                   /db_xref="InterPro:IPR007641"
FT                   /db_xref="InterPro:IPR007642"
FT                   /db_xref="InterPro:IPR007644"
FT                   /db_xref="InterPro:IPR007645"
FT                   /db_xref="InterPro:IPR010243"
FT                   /db_xref="InterPro:IPR014724"
FT                   /db_xref="InterPro:IPR015712"
FT                   /db_xref="InterPro:IPR019462"
FT                   /db_xref="InterPro:IPR037033"
FT                   /db_xref="InterPro:IPR037034"
FT                   /db_xref="InterPro:IPR042107"
FT                   /db_xref="PDB:2LY7"
FT                   /db_xref="SubtiList:BG10728"
FT                   /db_xref="UniProtKB/Swiss-Prot:P37870"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:10049799, 10744988, 12455702, 12682299, 15060052,
FT                   28163698"
FT                   /protein_id="CAB11883.2"
FT                   /translation="MTGQLVQYGRHRQRRSYARISEVLELPNLIEIQTSSYQWFLDEGL
FT                   REMFQDISPIEDFTGNLSLEFIDYSLGEPKYPVEESKERDVTYSAPLRVKVRLINKETG
FT                   EVKDQDVFMGDFPIMTDTGTFIINGAERVIVSQLVRSPSVYFSGKVDKNGKKGFTATVI
FT                   PNRGAWLEYETDAKDVVYVRIDRTRKLPVTVLLRALGFGSDQEILDLIGENEYLRNTLD
FT                   KDNTENSDKALLEIYERLRPGEPPTVENAKSLLDSRFFDPKRYDLANVGRYKINKKLHI
FT                   KNRLFNQRLAETLVDPETGEILAEKGQILDRRTLDKVLPYLENGIGFRKLYPNGGVVED
FT                   EVTLQSIKIFAPTDQEGEQVINVIGNAYIEEEIKNITPADIISSISYFFNLLHGVGDTD
FT                   DIDHLGNRRLRSVGELLQNQFRIGLSRMERVVRERMSIQDTNTITPQQLINIRPVIASI
FT                   KEFFGSSQLSQFMDQTNPLAELTHKRRLSALGPGGLTRERAGMEVRDVHYSHYGRMCPI
FT                   ETPEGPNIGLINSLSSYAKVNRFGFIETPYRRVDPETGKVTGRIDYLTADEEDNYVVAQ
FT                   ANARLDDEGAFIDDSIVARFRGENTVVSRNRVDYMDVSPKQVVSAATACIPFLENDDSN
FT                   RALMGANMQRQAVPLMQPEAPFVGTGMEYVSGKDSGAAVICKHPGIVERVEAKNVWVRR
FT                   YEEVDGQKVKGNLDKYSLLKFVRSNQGTCYNQRPIVSVGDEVVKGEILADGPSMELGEL
FT                   ALGRNVMVGFMTWDGYNYEDAIIMSERLVKDDVYTSIHIEEYESEARDTKLGPEEITRD
FT                   IPNVGEDALRNLDDRGIIRIGAEVKDGDLLVGKVTPKGVTELTAEERLLHAIFGEKARE
FT                   VRDTSLRVPHGGGGIIHDVKVFNREDGDELPPGVNQLVRVYIVQKRKISEGDKMAGRHG
FT                   NKGVISKILPEEDMPYLPDGTPIDIMLNPLGVPSRMNIGQVLELHMGMAARYLGIHIAS
FT                   PVFDGAREEDVWETLEEAGMSRDAKTVLYDGRTGEPFDNRVSVGIMYMIKLAHMVDDKL
FT                   HARSTGPYSLVTQQPLGGKAQFGGQRFGEMEVWALEAYGAAYTLQEILTVKSDDVVGRV
FT                   KTYEAIVKGDNVPEPGVPESFKVLIKELQSLGMDVKILSGDEEEIEMRDLEDEEDAKQA
FT                   DGLALSGDEEPEETASADVERDVVTKE"
FT   gene            125562..129161
FT                   /gene="rpoC"
FT                   /locus_tag="BSU_01080"
FT                   /old_locus_tag="BSU01080"
FT   CDS_pept        125562..129161
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoC"
FT                   /locus_tag="BSU_01080"
FT                   /old_locus_tag="BSU01080"
FT                   /product="RNA polymerase (beta' subunit)"
FT                   /function="16.2: Construct biomass (Anabolism)"
FT                   /EC_number="2.7.7.6"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 10672039, 10675340, 10910724,
FT                   11029421, 9795209, 10438769, 23070162, 22720735; Product
FT                   type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU01080"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11884"
FT                   /db_xref="GOA:P37871"
FT                   /db_xref="InterPro:IPR000722"
FT                   /db_xref="InterPro:IPR006592"
FT                   /db_xref="InterPro:IPR007066"
FT                   /db_xref="InterPro:IPR007080"
FT                   /db_xref="InterPro:IPR007081"
FT                   /db_xref="InterPro:IPR007083"
FT                   /db_xref="InterPro:IPR012754"
FT                   /db_xref="InterPro:IPR038120"
FT                   /db_xref="InterPro:IPR042102"
FT                   /db_xref="SubtiList:BG10729"
FT                   /db_xref="UniProtKB/Swiss-Prot:P37871"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:10672039, 10675340, 10910724, 11029421, 9795209,
FT                   10438769, 23070162, 22720735"
FT                   /protein_id="CAB11884.2"
FT                   /translation="MLDVNNFEYMNIGLASPDKIRSWSFGEVKKPETINYRTLKPEKDG
FT                   LFCERIFGPTKDWECHCGKYKRVRYKGVVCDRCGVEVTRAKVRRERMGHIELAAPVSHI
FT                   WYFKGIPSRMGLVLDMSPRALEEVIYFASYVVTDPANTPLEKKQLLSEKEYRAYLDKYG
FT                   NKFQASMGAEAIHKLLQDIDLVKEVDMLKEELKTSQGQRRTRAIKRLEVLEAFRNSGNK
FT                   PSWMILDVLPVIPPELRPMVQLDGGRFATSDLNDLYRRVINRNNRLKRLLDLGAPSIIV
FT                   QNEKRMLQEAVDALIDNGRRGRPVTGPGNRPLKSLSHMLKGKQGRFRQNLLGKRVDYSG
FT                   RSVIVVGPHLKMYQCGLPKEMALELFKPFVMKELVEKGLAHNIKSAKRKIERVQPEVWD
FT                   VLESVIKEHPVLLNRAPTLHRLGIQAFEPTLVEGRAIRLHPLVCTAYNADFDGDQMAVH
FT                   VPLSAEAQAEARILMLAAQNILNPKDGKPVVTPSQDMVLGNYYLTLERAGAVGEGMVFK
FT                   NTDEALLAYQNGYVHLHTRVAVAANSLKNVTFTEEQRSKLLITTVGKLVFNEILPESFP
FT                   YMNEPTKSNIEEKTPDRFFLEKGADVKAVIAQQPINAPFKKGILGKIIAEIFKRFHITE
FT                   TSKMLDRMKNLGFKYSTKAGITVGVSDIVVLDDKQEILEEAQSKVDNVMKQFRRGLITE
FT                   EERYERVISIWSAAKDVIQGKLMKSLDELNPIYMMSDSGARGNASNFTQLAGMRGLMAN
FT                   PAGRIIELPIKSSFREGLTVLEYFISTHGARKGLADTALKTADSGYLTRRLVDVAQDVI
FT                   IRETDCGTDRGILAKPLKEGTETIERLEERLIGRFARKQVKHPETGEVLVNENELIDED
FT                   KALEIVEAGIEEVWIRSAFTCNTPHGVCKRCYGRNLATGSDVEVGEAVGIIAAQSIGEP
FT                   GTQLTMRTFHTGGVAGDDITQGLPRIQELFEARNPKGQATITEIDGTVVEINEVRDKQQ
FT                   EIVVQGAVETRSYTAPYNSRLKVAEGDKITRGQVLTEGSIDPKELLKVTDLTTVQEYLL
FT                   HEVQKVYRMQGVEIGDKHVEVMVRQMLRKVRVIDAGDTDVLPGTLLDIHQFTEANKKVL
FT                   LEGNRPATGRPVLLGITKASLETDSFLSAASFQETTRVLTDAAIKGKRDELLGLKENVI
FT                   IGKLVPAGTGMMKYRKVKPVSNVQPTDDMVPVE"
FT   gene            129340..129588
FT                   /gene="rulS"
FT                   /locus_tag="BSU_01090"
FT                   /old_locus_tag="BSU01090"
FT   CDS_pept        129340..129588
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rulS"
FT                   /locus_tag="BSU_01090"
FT                   /old_locus_tag="BSU01090"
FT                   /product="K-turn RNA binding protein; alternative ribosomal
FT                   protein L7A"
FT                   /function="16.2: Construct biomass (Anabolism)"
FT                   /function="16.8: Protect"
FT                   /function="16.13: Shape"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 11574053, 11948165, 17468242,
FT                   7657605, 22355167, 23249744, 24204571, 22720735; Product
FT                   type s: structure"
FT                   /db_xref="EnsemblGenomes-Gn:BSU01090"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11885"
FT                   /db_xref="GOA:P46350"
FT                   /db_xref="InterPro:IPR000948"
FT                   /db_xref="InterPro:IPR004038"
FT                   /db_xref="InterPro:IPR023460"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="PDB:3V7E"
FT                   /db_xref="PDB:4LCK"
FT                   /db_xref="PDB:4TZP"
FT                   /db_xref="PDB:4TZV"
FT                   /db_xref="PDB:4TZW"
FT                   /db_xref="PDB:4TZZ"
FT                   /db_xref="SubtiList:BG11365"
FT                   /db_xref="UniProtKB/Swiss-Prot:P46350"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:11574053, 11948165, 17468242, 7657605, 22355167,
FT                   23249744, 24204571, 22720735"
FT                   /protein_id="CAB11885.1"
FT                   /translation="MSYDKVSQAKSIIIGTKQTVKALKRGSVKEVVVAKDADPILTSSV
FT                   VSLAEDQGISVSMVESMKKLGKACGIEVGAAAVAIIL"
FT   gene            129702..130118
FT                   /gene="rpsL"
FT                   /locus_tag="BSU_01100"
FT                   /old_locus_tag="BSU01100"
FT   CDS_pept        129702..130118
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsL"
FT                   /locus_tag="BSU_01100"
FT                   /old_locus_tag="BSU01100"
FT                   /product="ribosomal protein S12 (BS12)"
FT                   /function="16.2: Construct biomass (Anabolism)"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 11489846, 12682299, 16484214,
FT                   18252828, 19383706, 20007320; Product type s : structure"
FT                   /db_xref="EnsemblGenomes-Gn:BSU01100"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11886"
FT                   /db_xref="GOA:P21472"
FT                   /db_xref="InterPro:IPR005679"
FT                   /db_xref="InterPro:IPR006032"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="PDB:3J9W"
FT                   /db_xref="PDB:5NJT"
FT                   /db_xref="PDB:6HA1"
FT                   /db_xref="PDB:6HA8"
FT                   /db_xref="SubtiList:BG19009"
FT                   /db_xref="UniProtKB/Swiss-Prot:P21472"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:11489846, 12682299, 16484214, 18252828, 19383706,
FT                   20007320"
FT                   /protein_id="CAB11886.2"
FT                   /translation="MPTINQLIRKGRVSKVENSKSPALNKGYNSFKKEHTNVSSPQKRG
FT                   VCTRVGTMTPKKPNSALRKYARVRLTNGIEVTAYIPGIGHNLQEHSVVLIRGGRVKDLP
FT                   GVRYHIVRGALDTAGVENRAQGRSKYGTKKPKAK"
FT   gene            130160..130630
FT                   /gene="rpsG"
FT                   /locus_tag="BSU_01110"
FT                   /old_locus_tag="BSU01110"
FT   CDS_pept        130160..130630
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsG"
FT                   /locus_tag="BSU_01110"
FT                   /old_locus_tag="BSU01110"
FT                   /product="ribosomal protein S7 (BS7)"
FT                   /function="16.2: Construct biomass (Anabolism)"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 8722036, 12682299, 19653700;
FT                   Product type s: structure"
FT                   /db_xref="EnsemblGenomes-Gn:BSU01110"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11887"
FT                   /db_xref="GOA:P21469"
FT                   /db_xref="InterPro:IPR000235"
FT                   /db_xref="InterPro:IPR005717"
FT                   /db_xref="InterPro:IPR020606"
FT                   /db_xref="InterPro:IPR023798"
FT                   /db_xref="InterPro:IPR036823"
FT                   /db_xref="PDB:3J9W"
FT                   /db_xref="PDB:5NJT"
FT                   /db_xref="PDB:6HA1"
FT                   /db_xref="PDB:6HA8"
FT                   /db_xref="SubtiList:BG19006"
FT                   /db_xref="UniProtKB/Swiss-Prot:P21469"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:8722036, 12682299, 19653700"
FT                   /protein_id="CAB11887.2"
FT                   /translation="MPRKGPVAKRDVLPDPIYNSKLVSRLINKMMIDGKKGKSQTILYK
FT                   SFDIIKERTGNDAMEVFEQALKNIMPVLEVKARRVGGANYQVPVEVRPERRTTLGLRWL
FT                   VNYARLRGEKTMEERLANEILDAANNTGAAVKKREDTHKMAEANKAFAHYRW"
FT   gene            130684..132762
FT                   /gene="fusA"
FT                   /locus_tag="BSU_01120"
FT                   /old_locus_tag="BSU01120"
FT   CDS_pept        130684..132762
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fusA"
FT                   /locus_tag="BSU_01120"
FT                   /old_locus_tag="BSU01120"
FT                   /product="elongation factor G"
FT                   /function="16.2: Construct biomass (Anabolism)"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 815236, 815243, 1556067,
FT                   4629789, 19366171, 22720735; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU01120"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11888"
FT                   /db_xref="GOA:P80868"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004540"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR005517"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009022"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035649"
FT                   /db_xref="InterPro:IPR041095"
FT                   /db_xref="PDB:5VH6"
FT                   /db_xref="SubtiList:BG11939"
FT                   /db_xref="UniProtKB/Swiss-Prot:P80868"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:815236, 815243, 1556067, 4629789, 19366171, 22720735"
FT                   /protein_id="CAB11888.2"
FT                   /translation="MAREFSLEKTRNIGIMAHIDAGKTTTTERILFYTGRIHKIGETHE
FT                   GASQMDWMEQEQERGITITSAATTAQWKGYRVNIIDTPGHVDFTVEVERSLRVLDGAVA
FT                   VLDAQSGVEPQTETVWRQATTYGVPRIVFVNKMDKIGADFLYSVGTLRDRLQANAHAIQ
FT                   LPIGAEDNFEGIIDLVENVAYFYEDDLGTRSDAKEIPEEYKEQAEELRNSLIEAVCELD
FT                   EELMDKYLEGEEITIDELKAGIRKGTLNVEFYPVLVGSAFKNKGVQLVLDAVLDYLPAP
FT                   TDVAAIKGTRPDTNEEIERHSSDEEPFSALAFKVMTDPYVGKLTFFRVYSGTLDSGSYV
FT                   KNSTKGKRERVGRILQMHANSREEISTVYAGDIAAAVGLKDTTTGDTLCDEKDLVILES
FT                   MEFPEPVIDVAIEPKSKADQDKMGIALAKLAEEDPTFRTQTNPETGQTIISGMGELHLD
FT                   IIVDRMKREFKVEANVGAPQVAYRETFRTGAKVEGKFVRQSGGRGQFGHVWIEFEPNEE
FT                   GAGFEFENAIVGGVVPREYIPAVQAGLEDALENGVLAGFPLIDIKAKLFDGSYHDVDSN
FT                   EMAFKVAASMALKNAVSKCNPVLLEPIMKVEVVIPEEYMGDIMGDITSRRGRVEGMEAR
FT                   GNAQVVRAMVPLAEMFGYATALRSNTQGRGTFTMHMDHYEEVPKSVAEEIIKKNKGE"
FT   gene            132882..134072
FT                   /gene="tufA"
FT                   /locus_tag="BSU_01130"
FT                   /old_locus_tag="BSU01130"
FT   CDS_pept        132882..134072
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tufA"
FT                   /locus_tag="BSU_01130"
FT                   /old_locus_tag="BSU01130"
FT                   /product="elongation factor Tu"
FT                   /function="16.2: Construct biomass (Anabolism)"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 10774755, 12682299, 7706132,
FT                   20133608, 22938038, 22720735; Product type f : factor"
FT                   /db_xref="EnsemblGenomes-Gn:BSU01130"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11889"
FT                   /db_xref="GOA:P33166"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004160"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004541"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR033720"
FT                   /db_xref="InterPro:IPR041709"
FT                   /db_xref="SubtiList:BG11056"
FT                   /db_xref="UniProtKB/Swiss-Prot:P33166"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:10774755, 12682299, 7706132, 20133608, 22938038,
FT                   22720735"
FT                   /protein_id="CAB11889.1"
FT                   /translation="MAKEKFDRSKSHANIGTIGHVDHGKTTLTAAITTVLHKKSGKGTA
FT                   MAYDQIDGAPEERERGITISTAHVEYETETRHYAHVDCPGHADYVKNMITGAAQMDGAI
FT                   LVVSAADGPMPQTREHILLSKNVGVPYIVVFLNKCDMVDDEELLELVEMEVRDLLSEYD
FT                   FPGDDVPVVKGSALKALEGDAEWEAKIFELMDAVDEYIPTPERDTEKPFMMPVEDVFSI
FT                   TGRGTVATGRVERGQVKVGDEVEIIGLQEENKKTTVTGVEMFRKLLDYAEAGDNIGALL
FT                   RGVSREEIQRGQVLAKPGTITPHSKFKAEVYVLSKEEGGRHTPFFSNYRPQFYFRTTDV
FT                   TGIIHLPEGVEMVMPGDNTEMNVELISTIAIEEGTRFSIREGGRTVGSGVVSTITE"
FT   gene            134171..135127
FT                   /gene="ybaC"
FT                   /locus_tag="BSU_01140"
FT                   /old_locus_tag="BSU01140"
FT   CDS_pept        134171..135127
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybaC"
FT                   /locus_tag="BSU_01140"
FT                   /old_locus_tag="BSU01140"
FT                   /product="putative proline iminopeptidase"
FT                   /function="16.6: Maintain"
FT                   /function="16.11: Scavenge (Catabolism)"
FT                   /EC_number="3.4.11.5"
FT                   /note="Evidence 3: Putative function from multiple
FT                   computational evidences; Product type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU01140"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11890"
FT                   /db_xref="GOA:P70981"
FT                   /db_xref="InterPro:IPR002410"
FT                   /db_xref="InterPro:IPR022742"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="SubtiList:BG11988"
FT                   /db_xref="UniProtKB/Swiss-Prot:P70981"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB11890.2"
FT                   /translation="MIPEKKSIAIMKELSIGNTKQMLMINGVDVKNPLLLFLHGGPGTP
FT                   QIGYVRHYQKELEQYFTVVHWDQRGSGLSYSKRISHHSMTINHFIKDTIQVTQWLLAHF
FT                   SKSKLYLAGHSWGSILALHVLQQRPDLFYTYYGISQVVNPQDEESTAYQHIREISESKK
FT                   ASILSFLTRFIGAPPWKQDIQHLIYRFCVELTRGGFTHRHRQSLAVLFQMLTGNEYGVR
FT                   NMHSFLNGLRFSKKHLTDELYRFNAFTSVPSIKVPCVFISGKHDLIVPAEISKQYYQEL
FT                   EAPEKRWFQFENSAHTPHIEEPSLFANTLSRHARHHL"
FT   gene            135364..135672
FT                   /gene="rpsJ"
FT                   /locus_tag="BSU_01150"
FT                   /old_locus_tag="BSU01150"
FT   CDS_pept        135364..135672
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsJ"
FT                   /locus_tag="BSU_01150"
FT                   /old_locus_tag="BSU01150"
FT                   /product="ribosomal protein S10 (BS13); transcription
FT                   antitermination factor"
FT                   /function="16.2: Construct biomass (Anabolism)"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 12682299, 27964882; Product
FT                   type s: structure"
FT                   /db_xref="EnsemblGenomes-Gn:BSU01150"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11891"
FT                   /db_xref="GOA:P21471"
FT                   /db_xref="InterPro:IPR001848"
FT                   /db_xref="InterPro:IPR018268"
FT                   /db_xref="InterPro:IPR027486"
FT                   /db_xref="InterPro:IPR036838"
FT                   /db_xref="PDB:3J9W"
FT                   /db_xref="PDB:5NJT"
FT                   /db_xref="PDB:6HA1"
FT                   /db_xref="PDB:6HA8"
FT                   /db_xref="SubtiList:BG19008"
FT                   /db_xref="UniProtKB/Swiss-Prot:P21471"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:12682299, 27964882"
FT                   /protein_id="CAB11891.1"
FT                   /translation="MAKQKIRIRLKAYDHRILDQSAEKIVETAKRSGASVSGPIPLPTE
FT                   KSVYTILRAVHKYKDSREQFEMRTHKRLIDIVNPTPQTVDALMRLDLPSGVDIEIKL"
FT   gene            135712..136341
FT                   /gene="rplC"
FT                   /locus_tag="BSU_01160"
FT                   /old_locus_tag="BSU01160"
FT   CDS_pept        135712..136341
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplC"
FT                   /locus_tag="BSU_01160"
FT                   /old_locus_tag="BSU01160"
FT                   /product="ribosomal protein L3 (BL3)"
FT                   /function="16.2: Construct biomass (Anabolism)"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 12682299, 17981968, 19154332,
FT                   23759864; Product type s: structure"
FT                   /db_xref="EnsemblGenomes-Gn:BSU01160"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11892"
FT                   /db_xref="GOA:P42920"
FT                   /db_xref="InterPro:IPR000597"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR019926"
FT                   /db_xref="InterPro:IPR019927"
FT                   /db_xref="PDB:3J3V"
FT                   /db_xref="PDB:3J3W"
FT                   /db_xref="PDB:3J9W"
FT                   /db_xref="PDB:5NJT"
FT                   /db_xref="PDB:6HA1"
FT                   /db_xref="PDB:6HA8"
FT                   /db_xref="SubtiList:BG11218"
FT                   /db_xref="UniProtKB/Swiss-Prot:P42920"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:12682299, 17981968, 19154332, 23759864"
FT                   /protein_id="CAB11892.1"
FT                   /translation="MTKGILGRKIGMTQVFAENGDLIPVTVIEAAPNVVLQKKTAENDG
FT                   YEAIQLGFDDKREKLSNKPEKGHVAKAETAPKRFVKELRGVEMDAYEVGQEVKVEIFSA
FT                   GEIVDVTGVSKGKGFQGAIKRHGQSRGPMSHGSRYHRRPGSMGPVDPNRVFKGKLLPGR
FT                   MGGEQITVQNLEIVKVDAERNLLLIKGNVPGAKKSLITVKSAVKSK"
FT   gene            136369..136992
FT                   /gene="rplD"
FT                   /locus_tag="BSU_01170"
FT                   /old_locus_tag="BSU01170"
FT   CDS_pept        136369..136992
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplD"
FT                   /locus_tag="BSU_01170"
FT                   /old_locus_tag="BSU01170"
FT                   /product="ribosomal protein L4"
FT                   /function="16.2: Construct biomass (Anabolism)"
FT                   /note="Evidence 2a: Function from experimental evidences in
FT                   other organisms; PubMedId: 10898684, 12682299, 22720735;
FT                   Product type s: structure"
FT                   /db_xref="EnsemblGenomes-Gn:BSU01170"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11893"
FT                   /db_xref="GOA:P42921"
FT                   /db_xref="InterPro:IPR002136"
FT                   /db_xref="InterPro:IPR013005"
FT                   /db_xref="InterPro:IPR023574"
FT                   /db_xref="PDB:3J3V"
FT                   /db_xref="PDB:3J3W"
FT                   /db_xref="PDB:3J9W"
FT                   /db_xref="PDB:5NJT"
FT                   /db_xref="PDB:6HA1"
FT                   /db_xref="PDB:6HA8"
FT                   /db_xref="SubtiList:BG11219"
FT                   /db_xref="UniProtKB/Swiss-Prot:P42921"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB11893.1"
FT                   /translation="MPKVALYNQNGSTAGDIELNASVFGIEPNESVVFDAILMQRASLR
FT                   QGTHKVKNRSEVRGGGRKPWRQKGTGRARQGSIRSPQWRGGGVVFGPTPRSYSYKLPKK
FT                   VRRLAIKSVLSSKVIDNNIIVLEDLTLDTAKTKEMAAILKGLSVEKKALIVTADANEAV
FT                   ALSARNIPGVTVVEANGINVLDVVNHEKLLITKAAVEKVEEVLA"
FT   gene            136992..137279
FT                   /gene="rplW"
FT                   /locus_tag="BSU_01180"
FT                   /old_locus_tag="BSU01180"
FT   CDS_pept        136992..137279
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplW"
FT                   /locus_tag="BSU_01180"
FT                   /old_locus_tag="BSU01180"
FT                   /product="ribosomal protein L23"
FT                   /function="16.2: Construct biomass (Anabolism)"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 12682299, 17981968, 23002217;
FT                   Product type s: structure"
FT                   /db_xref="EnsemblGenomes-Gn:BSU01180"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11894"
FT                   /db_xref="GOA:P42924"
FT                   /db_xref="InterPro:IPR001014"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR012678"
FT                   /db_xref="InterPro:IPR013025"
FT                   /db_xref="PDB:3J3V"
FT                   /db_xref="PDB:3J3W"
FT                   /db_xref="PDB:3J9W"
FT                   /db_xref="PDB:5NJT"
FT                   /db_xref="PDB:6HA1"
FT                   /db_xref="PDB:6HA8"
FT                   /db_xref="SubtiList:BG11221"
FT                   /db_xref="UniProtKB/Swiss-Prot:P42924"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:12682299, 17981968, 23002217"
FT                   /protein_id="CAB11894.2"
FT                   /translation="MKDPRDVLKRPVITERSADLMTEKKYTFEVDVRANKTEVKDAVES
FT                   IFGVKVDKVNIMNYKGKSKRVGRYTGMTSRRRKAIVKLTADSKEIEIFEA"
FT   gene            137311..138144
FT                   /gene="rplB"
FT                   /locus_tag="BSU_01190"
FT                   /old_locus_tag="BSU01190"
FT   CDS_pept        137311..138144
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplB"
FT                   /locus_tag="BSU_01190"
FT                   /old_locus_tag="BSU01190"
FT                   /product="ribosomal protein L2 (BL2)"
FT                   /function="16.2: Construct biomass (Anabolism)"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 12682299, 23249812, 24637032;
FT                   Product type s: structure"
FT                   /db_xref="EnsemblGenomes-Gn:BSU01190"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11895"
FT                   /db_xref="GOA:P42919"
FT                   /db_xref="InterPro:IPR002171"
FT                   /db_xref="InterPro:IPR005880"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR014726"
FT                   /db_xref="InterPro:IPR022666"
FT                   /db_xref="InterPro:IPR022669"
FT                   /db_xref="InterPro:IPR022671"
FT                   /db_xref="PDB:3J3V"
FT                   /db_xref="PDB:3J3W"
FT                   /db_xref="PDB:3J9W"
FT                   /db_xref="PDB:5NJT"
FT                   /db_xref="PDB:6HA1"
FT                   /db_xref="PDB:6HA8"
FT                   /db_xref="SubtiList:BG11217"
FT                   /db_xref="UniProtKB/Swiss-Prot:P42919"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:12682299, 23249812, 24637032"
FT                   /protein_id="CAB11895.2"
FT                   /translation="MAIKKYKPTSNGRRGMTTSDFAEITTDKPEKSLLAPLHKKGGRNN
FT                   QGKLTVRHQGGGHKRQYRVIDFKRDKDGIPGRVATVEYDPNRSANIALINYADGEKRYI
FT                   LAPKGIQVGTEIMSGPEADIKVGNALPLINIPVGTVVHNIELKPGKGGQLVRSAGTSAQ
FT                   VLGKEGKYVLVRLNSGEVRMILSACRASIGQVGNEQHELINIGKAGRSRWKGIRPTVRG
FT                   SVMNPNDHPHGGGEGRAPIGRKSPMSPWGKPTLGFKTRKKKNKSDKFIVRRRKNK"
FT   gene            138202..138480
FT                   /gene="rpsS"
FT                   /locus_tag="BSU_01200"
FT                   /old_locus_tag="BSU01200"
FT   CDS_pept        138202..138480
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsS"
FT                   /locus_tag="BSU_01200"
FT                   /old_locus_tag="BSU01200"
FT                   /product="ribosomal protein S19 (BS19)"
FT                   /function="16.2: Construct biomass (Anabolism)"
FT                   /note="Evidence 2a: Function from experimental evidences in
FT                   other organisms; PubMedId: 12682299; Product type s :
FT                   structure"
FT                   /db_xref="EnsemblGenomes-Gn:BSU01200"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11896"
FT                   /db_xref="GOA:P21476"
FT                   /db_xref="InterPro:IPR002222"
FT                   /db_xref="InterPro:IPR005732"
FT                   /db_xref="InterPro:IPR020934"
FT                   /db_xref="InterPro:IPR023575"
FT                   /db_xref="PDB:3J9W"
FT                   /db_xref="PDB:5NJT"
FT                   /db_xref="PDB:6HA1"
FT                   /db_xref="PDB:6HA8"
FT                   /db_xref="SubtiList:BG19011"
FT                   /db_xref="UniProtKB/Swiss-Prot:P21476"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB11896.1"
FT                   /translation="MARSLKKGPFVDGHLMTKIEKLNETDKKQVVKTWSRRSTIFPQFI
FT                   GHTIAVYDGRKHVPVFISEDMVGHKLGEFAPTRTYKGHASDDKKTRR"
FT   gene            138497..138838
FT                   /gene="rplV"
FT                   /locus_tag="BSU_01210"
FT                   /old_locus_tag="BSU01210"
FT   CDS_pept        138497..138838
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplV"
FT                   /locus_tag="BSU_01210"
FT                   /old_locus_tag="BSU01210"
FT                   /product="ribosomal protein L22 (BL17)"
FT                   /function="16.2: Construct biomass (Anabolism)"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 7928988, 12682299, 23002217;
FT                   Product type s: structure"
FT                   /db_xref="EnsemblGenomes-Gn:BSU01210"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11897"
FT                   /db_xref="GOA:P42060"
FT                   /db_xref="InterPro:IPR001063"
FT                   /db_xref="InterPro:IPR005727"
FT                   /db_xref="InterPro:IPR018260"
FT                   /db_xref="InterPro:IPR036394"
FT                   /db_xref="PDB:3J3V"
FT                   /db_xref="PDB:3J3W"
FT                   /db_xref="PDB:3J9W"
FT                   /db_xref="PDB:5NJT"
FT                   /db_xref="PDB:6HA1"
FT                   /db_xref="PDB:6HA8"
FT                   /db_xref="SubtiList:BG11078"
FT                   /db_xref="UniProtKB/Swiss-Prot:P42060"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:7928988, 12682299, 23002217"
FT                   /protein_id="CAB11897.1"
FT                   /translation="MQAKAVARTVRIAPRKARLVMDLIRGKQVGEAVSILNLTPRAASP
FT                   IIEKVLKSAIANAEHNYEMDANNLVISQAFVDEGPTLKRFRPRAMGRASQINKRTSHIT
FT                   IVVSEKKEG"
FT   gene            138842..139498
FT                   /gene="rpsC"
FT                   /locus_tag="BSU_01220"
FT                   /old_locus_tag="BSU01220"
FT   CDS_pept        138842..139498
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsC"
FT                   /locus_tag="BSU_01220"
FT                   /old_locus_tag="BSU01220"
FT                   /product="ribosomal protein S3 (BS3)"
FT                   /function="16.2: Construct biomass (Anabolism)"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 12682299; Product type s:
FT                   structure"
FT                   /db_xref="EnsemblGenomes-Gn:BSU01220"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11898"
FT                   /db_xref="GOA:P21465"
FT                   /db_xref="InterPro:IPR001351"
FT                   /db_xref="InterPro:IPR004044"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR005704"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR018280"
FT                   /db_xref="InterPro:IPR036419"
FT                   /db_xref="PDB:3J9W"
FT                   /db_xref="PDB:5NJT"
FT                   /db_xref="PDB:6HA1"
FT                   /db_xref="PDB:6HA8"
FT                   /db_xref="SubtiList:BG19005"
FT                   /db_xref="UniProtKB/Swiss-Prot:P21465"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:12682299"
FT                   /protein_id="CAB11898.2"
FT                   /translation="MGQKVNPVGLRIGVIRDWESKWYAGKDYADFLHEDLKIREYISKR
FT                   LSDASVSKVEIERAANRVNITIHTAKPGMVIGKGGSEVEALRKALNSLTGKRVHINILE
FT                   IKRADLDAQLVADNIARQLENRVSFRRAQKQQIQRTMRAGAQGVKTMVSGRLGGADIAR
FT                   SEYYSEGTVPLHTLRADIDYATSEADTTYGKLGVKVWIYRGEVLPTKKKNEEGGK"
FT   gene            139500..139934
FT                   /gene="rplP"
FT                   /locus_tag="BSU_01230"
FT                   /old_locus_tag="BSU01230"
FT   CDS_pept        139500..139934
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplP"
FT                   /locus_tag="BSU_01230"
FT                   /old_locus_tag="BSU01230"
FT                   /product="ribosomal protein L16"
FT                   /function="16.2: Construct biomass (Anabolism)"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 12682299, 16390447, 24335279;
FT                   Product type s: structure"
FT                   /db_xref="EnsemblGenomes-Gn:BSU01230"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11899"
FT                   /db_xref="GOA:P14577"
FT                   /db_xref="InterPro:IPR000114"
FT                   /db_xref="InterPro:IPR016180"
FT                   /db_xref="InterPro:IPR020798"
FT                   /db_xref="InterPro:IPR036920"
FT                   /db_xref="PDB:3J9W"
FT                   /db_xref="PDB:5NJT"
FT                   /db_xref="PDB:6HA1"
FT                   /db_xref="PDB:6HA8"
FT                   /db_xref="SubtiList:BG10755"
FT                   /db_xref="UniProtKB/Swiss-Prot:P14577"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:12682299, 16390447, 24335279"
FT                   /protein_id="CAB11899.1"
FT                   /translation="MLLPKRVKYRREHRGKMRGRAKGGTEVHFGEFGIQALEASWITNR
FT                   QIEAARIAMTRYMKRGGKVWIKIFPSKPYTAKPLEVRMGSGKGAPEGWVAVVKPGKVLF
FT                   EISGVSEEVAREALRLASHKLPIKTKFVKREEIGGESNES"
FT   gene            139924..140124
FT                   /gene="rpmC"
FT                   /locus_tag="BSU_01240"
FT                   /old_locus_tag="BSU01240"
FT   CDS_pept        139924..140124
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmC"
FT                   /locus_tag="BSU_01240"
FT                   /old_locus_tag="BSU01240"
FT                   /product="ribosomal protein L29"
FT                   /function="16.2: Construct biomass (Anabolism)"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 12682299, 23002217; Product
FT                   type s: structure"
FT                   /db_xref="EnsemblGenomes-Gn:BSU01240"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11900"
FT                   /db_xref="GOA:P12873"
FT                   /db_xref="InterPro:IPR001854"
FT                   /db_xref="InterPro:IPR018254"
FT                   /db_xref="InterPro:IPR036049"
FT                   /db_xref="PDB:3J3V"
FT                   /db_xref="PDB:3J3W"
FT                   /db_xref="PDB:3J9W"
FT                   /db_xref="PDB:5NJT"
FT                   /db_xref="PDB:6HA1"
FT                   /db_xref="PDB:6HA8"
FT                   /db_xref="SubtiList:BG10756"
FT                   /db_xref="UniProtKB/Swiss-Prot:P12873"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:12682299, 23002217"
FT                   /protein_id="CAB11900.1"
FT                   /translation="MKANEIRDLTTAEIEQKVKSLKEELFNLRFQLATGQLENTARIRE
FT                   VRKAIARMKTVIREREIAANK"
FT   gene            140147..140410
FT                   /gene="rpsQ"
FT                   /locus_tag="BSU_01250"
FT                   /old_locus_tag="BSU01250"
FT   CDS_pept        140147..140410
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsQ"
FT                   /locus_tag="BSU_01250"
FT                   /old_locus_tag="BSU01250"
FT                   /product="ribosomal protein S17 (BS16)"
FT                   /function="16.2: Construct biomass (Anabolism)"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 12682299; Product type s:
FT                   structure"
FT                   /db_xref="EnsemblGenomes-Gn:BSU01250"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11901"
FT                   /db_xref="GOA:P12874"
FT                   /db_xref="InterPro:IPR000266"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019979"
FT                   /db_xref="InterPro:IPR019984"
FT                   /db_xref="PDB:3J9W"
FT                   /db_xref="PDB:5NJT"
FT                   /db_xref="PDB:6HA1"
FT                   /db_xref="PDB:6HA8"
FT                   /db_xref="SubtiList:BG10757"
FT                   /db_xref="UniProtKB/Swiss-Prot:P12874"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:12682299"
FT                   /protein_id="CAB11901.1"
FT                   /translation="MSERNQRKVYQGRVVSDKMDKTITVVVETYKKHTLYGKRVKYSKK
FT                   FKAHDENNQAKIGDIVKIMETRPLSATKRFRLVEVVEEAVII"
FT   gene            140451..140819
FT                   /gene="rplNA"
FT                   /locus_tag="BSU_01260"
FT                   /old_locus_tag="BSU01260"
FT   CDS_pept        140451..140819
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplNA"
FT                   /locus_tag="BSU_01260"
FT                   /old_locus_tag="BSU01260"
FT                   /product="ribosomal protein L14"
FT                   /function="16.2: Construct biomass (Anabolism)"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 8722036, 8805509, 12682299,
FT                   22829778; Product type s: structure"
FT                   /db_xref="EnsemblGenomes-Gn:BSU01260"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11902"
FT                   /db_xref="GOA:P12875"
FT                   /db_xref="InterPro:IPR000218"
FT                   /db_xref="InterPro:IPR005745"
FT                   /db_xref="InterPro:IPR019972"
FT                   /db_xref="InterPro:IPR036853"
FT                   /db_xref="PDB:3J3V"
FT                   /db_xref="PDB:3J3W"
FT                   /db_xref="PDB:3J9W"
FT                   /db_xref="PDB:5NJT"
FT                   /db_xref="PDB:6HA1"
FT                   /db_xref="PDB:6HA8"
FT                   /db_xref="SubtiList:BG10758"
FT                   /db_xref="UniProtKB/Swiss-Prot:P12875"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:8722036, 8805509, 12682299, 22829778"
FT                   /protein_id="CAB11902.1"
FT                   /translation="MIQQETRLKVADNSGAREVLTIKVLGGSGRKTANIGDVIVCTVKQ
FT                   ATPGGVVKKGEVVKAVIVRTKSGARRSDGSYISFDENACVIIRDDKSPRGTRIFGPVAR
FT                   ELRENNFMKIVSLAPEVI"
FT   gene            140857..141168
FT                   /gene="rplX"
FT                   /locus_tag="BSU_01270"
FT                   /old_locus_tag="BSU01270"
FT   CDS_pept        140857..141168
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplX"
FT                   /locus_tag="BSU_01270"
FT                   /old_locus_tag="BSU01270"
FT                   /product="ribosomal protein L24 (BL23)"
FT                   /function="16.2: Construct biomass (Anabolism)"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 11278078, 12682299; Product
FT                   type s: structure"
FT                   /db_xref="EnsemblGenomes-Gn:BSU01270"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11903"
FT                   /db_xref="GOA:P0CI78"
FT                   /db_xref="InterPro:IPR003256"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR005825"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR041988"
FT                   /db_xref="PDB:3J3V"
FT                   /db_xref="PDB:3J3W"
FT                   /db_xref="PDB:3J9W"
FT                   /db_xref="PDB:5NJT"
FT                   /db_xref="PDB:6HA1"
FT                   /db_xref="PDB:6HA8"
FT                   /db_xref="SubtiList:BG10759"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0CI78"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:11278078, 12682299"
FT                   /protein_id="CAB11903.1"
FT                   /translation="MHVKKGDKVMVISGKDKGKQGTILAAFPKKDRVLVEGVNMVKKHS
FT                   KPTQANPQGGISNQEAPIHVSNVMPLDPKTGEVTRVGYKVEDGKKVRVAKKSGQVLDK"
FT   gene            141195..141734
FT                   /gene="rplE"
FT                   /locus_tag="BSU_01280"
FT                   /old_locus_tag="BSU01280"
FT   CDS_pept        141195..141734
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplE"
FT                   /locus_tag="BSU_01280"
FT                   /old_locus_tag="BSU01280"
FT                   /product="ribosomal protein L5 (BL6)"
FT                   /function="16.2: Construct biomass (Anabolism)"
FT                   /note="Evidence 2a: Function from experimental evidences in
FT                   other organisms; PubMedId: 12682299; Product type s :
FT                   structure"
FT                   /db_xref="EnsemblGenomes-Gn:BSU01280"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11904"
FT                   /db_xref="GOA:P12877"
FT                   /db_xref="InterPro:IPR002132"
FT                   /db_xref="InterPro:IPR020929"
FT                   /db_xref="InterPro:IPR020930"
FT                   /db_xref="InterPro:IPR022803"
FT                   /db_xref="InterPro:IPR031309"
FT                   /db_xref="InterPro:IPR031310"
FT                   /db_xref="PDB:3J3V"
FT                   /db_xref="PDB:3J9W"
FT                   /db_xref="PDB:5NJT"
FT                   /db_xref="PDB:6HA1"
FT                   /db_xref="PDB:6HA8"
FT                   /db_xref="SubtiList:BG10760"
FT                   /db_xref="UniProtKB/Swiss-Prot:P12877"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB11904.1"
FT                   /translation="MNRLKEKYNKEIAPALMTKFNYDSVMQVPKIEKIVINMGVGDAVQ
FT                   NAKAIDSAVEELTFIAGQKPVVTRAKKSIAGFRLREGMPIGAKVTLRGERMYDFLDKLI
FT                   SVSLPRVRDFRGVSKKSFDGRGNYTLGIKEQLIFPEIDYDKVTKVRGMDIVIVTTANTD
FT                   EEARELLTQVGMPFQK"
FT   gene            141757..141942
FT                   /gene="rpsNA"
FT                   /locus_tag="BSU_01290"
FT                   /old_locus_tag="BSU01290"
FT   CDS_pept        141757..141942
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsNA"
FT                   /locus_tag="BSU_01290"
FT                   /old_locus_tag="BSU01290"
FT                   /product="ribosomal protein S14"
FT                   /function="16.2: Construct biomass (Anabolism)"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 12682299, 17163968, 19648245,
FT                   20208344, 27561249; Product type s: structure"
FT                   /db_xref="EnsemblGenomes-Gn:BSU01290"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11905"
FT                   /db_xref="GOA:P12878"
FT                   /db_xref="InterPro:IPR001209"
FT                   /db_xref="InterPro:IPR018271"
FT                   /db_xref="InterPro:IPR023053"
FT                   /db_xref="PDB:3J9W"
FT                   /db_xref="PDB:5NJT"
FT                   /db_xref="PDB:6HA1"
FT                   /db_xref="PDB:6HA8"
FT                   /db_xref="SubtiList:BG10761"
FT                   /db_xref="UniProtKB/Swiss-Prot:P12878"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:12682299, 17163968, 19648245, 20208344, 27561249"
FT                   /protein_id="CAB11905.1"
FT                   /translation="MAKKSMIAKQQRTPKFKVQEYTRCERCGRPHSVIRKFKLCRICFR
FT                   ELAYKGQIPGVKKASW"
FT   gene            141974..142372
FT                   /gene="rpsH"
FT                   /locus_tag="BSU_01300"
FT                   /old_locus_tag="BSU01300"
FT   CDS_pept        141974..142372
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsH"
FT                   /locus_tag="BSU_01300"
FT                   /old_locus_tag="BSU01300"
FT                   /product="ribosomal protein S8 (BS8)"
FT                   /function="16.2: Construct biomass (Anabolism)"
FT                   /note="Evidence 2a: Function from experimental evidences in
FT                   other organisms; PubMedId: 12682299; Product type s :
FT                   structure"
FT                   /db_xref="EnsemblGenomes-Gn:BSU01300"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11906"
FT                   /db_xref="GOA:P12879"
FT                   /db_xref="InterPro:IPR000630"
FT                   /db_xref="InterPro:IPR035987"
FT                   /db_xref="PDB:3J9W"
FT                   /db_xref="PDB:5NJT"
FT                   /db_xref="PDB:6HA1"
FT                   /db_xref="PDB:6HA8"
FT                   /db_xref="SubtiList:BG10762"
FT                   /db_xref="UniProtKB/Swiss-Prot:P12879"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB11906.2"
FT                   /translation="MVMTDPIADMLTRIRNANMVRHEKLEIPASKLKREIAEILKREGF
FT                   IRDVEFVEDSKQGIIRVFLKYGQNNERVITGLKRISKPGLRVYAKSNEVPRVLNGLGIA
FT                   IISTSQGVLTDKEARAKQAGGEVLAYVW"
FT   gene            142402..142941
FT                   /gene="rplF"
FT                   /locus_tag="BSU_01310"
FT                   /old_locus_tag="BSU01310"
FT   CDS_pept        142402..142941
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplF"
FT                   /locus_tag="BSU_01310"
FT                   /old_locus_tag="BSU01310"
FT                   /product="ribosomal protein L6 (BL8)"
FT                   /function="16.2: Construct biomass (Anabolism)"
FT                   /note="Evidence 2a: Function from experimental evidences in
FT                   other organisms; PubMedId: 12682299, 25330043; Product type
FT                   s: structure"
FT                   /db_xref="EnsemblGenomes-Gn:BSU01310"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11907"
FT                   /db_xref="GOA:P46898"
FT                   /db_xref="InterPro:IPR000702"
FT                   /db_xref="InterPro:IPR002358"
FT                   /db_xref="InterPro:IPR019906"
FT                   /db_xref="InterPro:IPR020040"
FT                   /db_xref="InterPro:IPR036789"
FT                   /db_xref="PDB:3J3V"
FT                   /db_xref="PDB:3J3W"
FT                   /db_xref="PDB:3J9W"
FT                   /db_xref="PDB:5NJT"
FT                   /db_xref="PDB:6HA1"
FT                   /db_xref="PDB:6HA8"
FT                   /db_xref="SubtiList:BG11408"
FT                   /db_xref="UniProtKB/Swiss-Prot:P46898"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB11907.1"
FT                   /translation="MSRVGKKLLEIPSDVTVTLNDNNTVAVKGPKGELTRTFHPDMEIK
FT                   VEDNVLTVARPSDQKEHRALHGTTRSLLGNMVEGVSKGFERGLELVGVGYRASKSGNKL
FT                   VLNVGYSHPVEIVPEEGIEIEVPSQTKVVVKGTDKERVGAIAANIRAVRSPEPYKGKGI
FT                   RYEGEVVRRKEGKSAK"
FT   gene            142974..143336
FT                   /gene="rplR"
FT                   /locus_tag="BSU_01320"
FT                   /old_locus_tag="BSU01320"
FT   CDS_pept        142974..143336
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplR"
FT                   /locus_tag="BSU_01320"
FT                   /old_locus_tag="BSU01320"
FT                   /product="ribosomal protein L18"
FT                   /function="16.2: Construct biomass (Anabolism)"
FT                   /note="Evidence 2a: Function from experimental evidences in
FT                   other organisms; PubMedId: 12682299; Product type s :
FT                   structure"
FT                   /db_xref="EnsemblGenomes-Gn:BSU01320"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11908"
FT                   /db_xref="GOA:P46899"
FT                   /db_xref="InterPro:IPR004389"
FT                   /db_xref="InterPro:IPR005484"
FT                   /db_xref="PDB:3J3V"
FT                   /db_xref="PDB:3J9W"
FT                   /db_xref="PDB:5NJT"
FT                   /db_xref="PDB:6HA1"
FT                   /db_xref="PDB:6HA8"
FT                   /db_xref="SubtiList:BG11409"
FT                   /db_xref="UniProtKB/Swiss-Prot:P46899"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB11908.2"
FT                   /translation="MITKTSKNAARLKRHARVRAKLSGTAERPRLNVFRSNKHIYAQII
FT                   DDVNGVTLASASTLDKDLNVESTGDTSAATKVGELVAKRAAEKGISDVVFDRGGYLYHG
FT                   RVKALADAAREAGLKF"
FT   gene            143361..143861
FT                   /gene="rpsE"
FT                   /locus_tag="BSU_01330"
FT                   /old_locus_tag="BSU01330"
FT   CDS_pept        143361..143861
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsE"
FT                   /locus_tag="BSU_01330"
FT                   /old_locus_tag="BSU01330"
FT                   /product="ribosomal protein S5"
FT                   /function="16.2: Construct biomass (Anabolism)"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 6211592, 12682299; Product
FT                   type s: structure"
FT                   /db_xref="EnsemblGenomes-Gn:BSU01330"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11909"
FT                   /db_xref="GOA:P21467"
FT                   /db_xref="InterPro:IPR000851"
FT                   /db_xref="InterPro:IPR005324"
FT                   /db_xref="InterPro:IPR005712"
FT                   /db_xref="InterPro:IPR013810"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018192"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="PDB:3J9W"
FT                   /db_xref="PDB:5NJT"
FT                   /db_xref="PDB:6HA1"
FT                   /db_xref="PDB:6HA8"
FT                   /db_xref="SubtiList:BG10442"
FT                   /db_xref="UniProtKB/Swiss-Prot:P21467"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:6211592, 12682299"
FT                   /protein_id="CAB11909.1"
FT                   /translation="MRRIDPSKLELEERLVTVNRVAKVVKGGRRFRFAALVVVGDKNGH
FT                   VGFGTGKAQEVPEAIRKAVEDAKKNLIEVPMVGTTIPHEIIGRFGAGNILLKPASEGTG
FT                   VIAGGPVRAVLELAGVADILSKSLGSNTPINMIRATLQGLSELKRAEDVAKLRGKSVEE
FT                   LLG"
FT   gene            143875..144054
FT                   /gene="rpmD"
FT                   /locus_tag="BSU_01340"
FT                   /old_locus_tag="BSU01340"
FT   CDS_pept        143875..144054
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmD"
FT                   /locus_tag="BSU_01340"
FT                   /old_locus_tag="BSU01340"
FT                   /product="ribosomal protein L30 (BL27)"
FT                   /function="16.2: Construct biomass (Anabolism)"
FT                   /note="Evidence 2a: Function from experimental evidences in
FT                   other organisms; PubMedId: 12682299; Product type s :
FT                   structure"
FT                   /db_xref="EnsemblGenomes-Gn:BSU01340"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11910"
FT                   /db_xref="GOA:P19947"
FT                   /db_xref="InterPro:IPR005996"
FT                   /db_xref="InterPro:IPR016082"
FT                   /db_xref="InterPro:IPR018038"
FT                   /db_xref="InterPro:IPR036919"
FT                   /db_xref="PDB:3J3V"
FT                   /db_xref="PDB:3J9W"
FT                   /db_xref="PDB:5NJT"
FT                   /db_xref="PDB:6HA1"
FT                   /db_xref="PDB:6HA8"
FT                   /db_xref="SubtiList:BG10443"
FT                   /db_xref="UniProtKB/Swiss-Prot:P19947"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB11910.1"
FT                   /translation="MAKLEITLKRSVIGRPEDQRVTVRTLGLKKTNQTVVHEDNAAIRG
FT                   MINKVSHLVSVKEQ"
FT   gene            144085..144525
FT                   /gene="rplO"
FT                   /locus_tag="BSU_01350"
FT                   /old_locus_tag="BSU01350"
FT   CDS_pept        144085..144525
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplO"
FT                   /locus_tag="BSU_01350"
FT                   /old_locus_tag="BSU01350"
FT                   /product="ribosomal protein L15"
FT                   /function="16.2: Construct biomass (Anabolism)"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 12682299, 15855514, 23002217;
FT                   Product type s: structure"
FT                   /db_xref="EnsemblGenomes-Gn:BSU01350"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11911"
FT                   /db_xref="GOA:P19946"
FT                   /db_xref="InterPro:IPR001196"
FT                   /db_xref="InterPro:IPR005749"
FT                   /db_xref="InterPro:IPR021131"
FT                   /db_xref="InterPro:IPR030878"
FT                   /db_xref="InterPro:IPR036227"
FT                   /db_xref="PDB:3J3V"
FT                   /db_xref="PDB:3J3W"
FT                   /db_xref="PDB:3J9W"
FT                   /db_xref="PDB:5NJT"
FT                   /db_xref="PDB:6HA1"
FT                   /db_xref="PDB:6HA8"
FT                   /db_xref="SubtiList:BG10444"
FT                   /db_xref="UniProtKB/Swiss-Prot:P19946"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:12682299, 15855514, 23002217"
FT                   /protein_id="CAB11911.1"
FT                   /translation="MKLHELKPSEGSRKTRNRVGRGIGSGNGKTAGKGHKGQNARSGGG
FT                   VRPGFEGGQMPLFQRLPKRGFTNINRKEYAVVNLDKLNGFAEGTEVTPELLLETGVISK
FT                   LNAGVKILGNGKLEKKLTVKANKFSASAKEAVEAAGGTAEVI"
FT   gene            144527..145822
FT                   /gene="secY"
FT                   /locus_tag="BSU_01360"
FT                   /old_locus_tag="BSU01360"
FT   CDS_pept        144527..145822
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secY"
FT                   /locus_tag="BSU_01360"
FT                   /old_locus_tag="BSU01360"
FT                   /product="preprotein translocase subunit"
FT                   /function="16.1: Circulate"
FT                   /function="16.2: Construct biomass (Anabolism)"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 9917412, 15341641, 15849754,
FT                   16850406, 23852076, 22720735, 27336478; Product type t:
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BSU01360"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11912"
FT                   /db_xref="GOA:P16336"
FT                   /db_xref="InterPro:IPR002208"
FT                   /db_xref="InterPro:IPR023201"
FT                   /db_xref="InterPro:IPR026593"
FT                   /db_xref="InterPro:IPR030659"
FT                   /db_xref="SubtiList:BG10445"
FT                   /db_xref="UniProtKB/Swiss-Prot:P16336"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:9917412, 15341641, 15849754, 16850406, 23852076,
FT                   22720735, 27336478"
FT                   /protein_id="CAB11912.1"
FT                   /translation="MFKTISNFMRVSDIRNKIIFTLLMLIVFRIGAFIPVPYVNAEALQ
FT                   AQSQMGVFDLLNTFGGGALYQFSIFAMGITPYITASIIIQLLQMDVVPKFTEWSKQGEV
FT                   GRRKLAQFTRYFTIVLGFIQALGMSYGFNNLANGMLIEKSGVSTYLIIALVLTGGTAFL
FT                   MWLGEQITSHGVGNGISIIIFAGIVSSIPKTIGQIYETQFVGSNDQLFIHIVKVALLVI
FT                   AILAVIVGVIFIQQAVRKIAIQYAKGTGRSPAGGGQSTHLPLKVNPAGVIPVIFAVAFL
FT                   ITPRTIASFFGTNDVTKWIQNNFDNTHPVGMAIYVALIIAFTYFYAFVQVNPEQMADNL
FT                   KKQGGYIPGVRPGKMTQDRITSILYRLTFVGSIFLAVISILPIFFIQFAGLPQSAQIGG
FT                   TSLLIVVGVALETMKQLESQLVKRNYRGFMKN"
FT   gene            145877..146530
FT                   /gene="adk"
FT                   /locus_tag="BSU_01370"
FT                   /old_locus_tag="BSU01370"
FT   CDS_pept        145877..146530
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="adk"
FT                   /locus_tag="BSU_01370"
FT                   /old_locus_tag="BSU01370"
FT                   /product="adenylate kinase"
FT                   /function="16.2: Construct biomass (Anabolism)"
FT                   /function="16.7: Manage energy"
FT                   /EC_number="2.7.4.3"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 8061005, 8288548, 9056261,
FT                   9715904, 11106368, 16452168; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU01370"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11913"
FT                   /db_xref="GOA:P16304"
FT                   /db_xref="InterPro:IPR000850"
FT                   /db_xref="InterPro:IPR006259"
FT                   /db_xref="InterPro:IPR007862"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033690"
FT                   /db_xref="PDB:1P3J"
FT                   /db_xref="PDB:2EU8"
FT                   /db_xref="PDB:2OO7"
FT                   /db_xref="PDB:2ORI"
FT                   /db_xref="PDB:2OSB"
FT                   /db_xref="PDB:2P3S"
FT                   /db_xref="PDB:2QAJ"
FT                   /db_xref="PDB:3DKV"
FT                   /db_xref="PDB:3DL0"
FT                   /db_xref="PDB:4MKF"
FT                   /db_xref="PDB:4MKG"
FT                   /db_xref="PDB:4MKH"
FT                   /db_xref="PDB:4QBF"
FT                   /db_xref="PDB:4QBG"
FT                   /db_xref="PDB:4TYP"
FT                   /db_xref="PDB:4TYQ"
FT                   /db_xref="PDB:5X6I"
FT                   /db_xref="SubtiList:BG10446"
FT                   /db_xref="UniProtKB/Swiss-Prot:P16304"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:8061005, 8288548, 9056261, 9715904, 11106368,
FT                   16452168"
FT                   /protein_id="CAB11913.1"
FT                   /translation="MNLVLMGLPGAGKGTQGERIVEDYGIPHISTGDMFRAAMKEETPL
FT                   GLEAKSYIDKGELVPDEVTIGIVKERLGKDDCERGFLLDGFPRTVAQAEALEEILEEYG
FT                   KPIDYVINIEVDKDVLMERLTGRRICSVCGTTYHLVFNPPKTPGICDKDGGELYQRADD
FT                   NEETVSKRLEVNMKQTQPLLDFYSEKGYLANVNGQQDIQDVYADVKDLLGGLKK"
FT   gene            146527..147273
FT                   /gene="mapA"
FT                   /locus_tag="BSU_01380"
FT                   /old_locus_tag="BSU01380"
FT   CDS_pept        146527..147273
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mapA"
FT                   /locus_tag="BSU_01380"
FT                   /old_locus_tag="BSU01380"
FT                   /product="methionine aminopeptidase"
FT                   /function="16.6: Maintain"
FT                   /function="16.2: Construct biomass (Anabolism)"
FT                   /function="16.11: Scavenge (Catabolism)"
FT                   /EC_number="3.4.11.18"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 16207374, 22720735; Product
FT                   type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU01380"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11914"
FT                   /db_xref="GOA:P19994"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR001714"
FT                   /db_xref="InterPro:IPR002467"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="SubtiList:BG10447"
FT                   /db_xref="UniProtKB/Swiss-Prot:P19994"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:16207374, 22720735"
FT                   /protein_id="CAB11914.1"
FT                   /translation="MIICKTPRELGIMREAGRIVALTHEELKKHIKPGISTKELDQIAE
FT                   RFIKKQGAIPSFKGYNGFRGSICVSVNEELVHGIPGSRVLKDGDIISIDIGAKLNGYHG
FT                   DSAWTYPVGNISDDDKKLLEVTEESLYKGLQEAKPGERLSNISHAIQTYVENEQFSVVR
FT                   EYVGHGVGQDLHEDPQIPHYGPPNKGPRLKPGMVLAIEPMVNAGSRYVKTLADNWTVVT
FT                   VDGKKCAHFEHTIAITETGFDILTRV"
FT   gene            147312..147536
FT                   /gene="ybzG"
FT                   /locus_tag="BSU_01389"
FT                   /old_locus_tag="BSU01389"
FT   CDS_pept        147312..147536
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybzG"
FT                   /locus_tag="BSU_01389"
FT                   /old_locus_tag="BSU01389"
FT                   /product="putative ribosome binding protein"
FT                   /function="16.2: Construct biomass (Anabolism)"
FT                   /note="Evidence 3: Putative function from multiple
FT                   computational evidences; PubMedId: 17157877; Product type
FT                   f: factor"
FT                   /db_xref="EnsemblGenomes-Gn:BSU01389"
FT                   /db_xref="EnsemblGenomes-Tr:CAX52539"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0H3S8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX52539.1"
FT                   /translation="MIGQKAWVNIGKTEFILLLVVGILTIINVLTADGEKRTFHSPKKK
FT                   NINHLTLYDCVSPEVQNSINETGRVTNFF"
FT   gene            147585..147803
FT                   /gene="infA"
FT                   /locus_tag="BSU_01390"
FT                   /old_locus_tag="BSU01390"
FT   CDS_pept        147585..147803
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="infA"
FT                   /locus_tag="BSU_01390"
FT                   /old_locus_tag="BSU01390"
FT                   /product="initiation factor IF-I"
FT                   /function="16.2: Construct biomass (Anabolism)"
FT                   /function="16.3: Control"
FT                   /note="Evidence 2a: Function from experimental evidences in
FT                   other organisms; PubMedId: 9868784, 20477873, 22720735;
FT                   Product type f: factor"
FT                   /db_xref="EnsemblGenomes-Gn:BSU01390"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11915"
FT                   /db_xref="GOA:P20458"
FT                   /db_xref="InterPro:IPR004368"
FT                   /db_xref="InterPro:IPR006196"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="SubtiList:BG11043"
FT                   /db_xref="UniProtKB/Swiss-Prot:P20458"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB11915.1"
FT                   /translation="MAKDDVIEVEGTIVETLPNAMFKVELENGHTVLAHVSGKIRMHFI
FT                   RILPGDKVTVELSPYDLTRGRITYRYK"
FT   gene            147837..147950
FT                   /gene="rpmJ"
FT                   /locus_tag="BSU_01400"
FT                   /old_locus_tag="BSU01400"
FT   CDS_pept        147837..147950
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmJ"
FT                   /locus_tag="BSU_01400"
FT                   /old_locus_tag="BSU01400"
FT                   /product="ribosomal protein L36 (ribosomal protein B)"
FT                   /function="16.2: Construct biomass (Anabolism)"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 1783905, 23002217, 24335279;
FT                   Product type f: factor"
FT                   /db_xref="EnsemblGenomes-Gn:BSU01400"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11916"
FT                   /db_xref="GOA:P20278"
FT                   /db_xref="InterPro:IPR000473"
FT                   /db_xref="InterPro:IPR035977"
FT                   /db_xref="PDB:3J9W"
FT                   /db_xref="PDB:5NJT"
FT                   /db_xref="PDB:6HA1"
FT                   /db_xref="PDB:6HA8"
FT                   /db_xref="SubtiList:BG11042"
FT                   /db_xref="UniProtKB/Swiss-Prot:P20278"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:1783905, 23002217, 24335279"
FT                   /protein_id="CAB11916.1"
FT                   /translation="MKVRPSVKPICEKCKVIRRKGKVMVICENPKHKQKQG"
FT   gene            147973..148338
FT                   /gene="rpsM"
FT                   /locus_tag="BSU_01410"
FT                   /old_locus_tag="BSU01410"
FT   CDS_pept        147973..148338
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsM"
FT                   /locus_tag="BSU_01410"
FT                   /old_locus_tag="BSU01410"
FT                   /product="ribosomal protein S13"
FT                   /function="16.2: Construct biomass (Anabolism)"
FT                   /note="Evidence 2a: Function from experimental evidences in
FT                   other organisms; PubMedId: 12682299, 22720735; Product type
FT                   s: structure"
FT                   /db_xref="EnsemblGenomes-Gn:BSU01410"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11917"
FT                   /db_xref="GOA:P20282"
FT                   /db_xref="InterPro:IPR001892"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR018269"
FT                   /db_xref="InterPro:IPR019980"
FT                   /db_xref="InterPro:IPR027437"
FT                   /db_xref="PDB:3J9W"
FT                   /db_xref="PDB:5NJT"
FT                   /db_xref="PDB:6HA1"
FT                   /db_xref="PDB:6HA8"
FT                   /db_xref="SubtiList:BG10730"
FT                   /db_xref="UniProtKB/Swiss-Prot:P20282"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB11917.2"
FT                   /translation="MARIAGVDIPRDKRVVISLTYIFGIGRTTAQQVLKEAGVSEDTRV
FT                   RDLTEEELGKIRDIIDKLKVEGDLRREVSLNIKRLIEIGSYRGIRHRRGLPVRGQNSKN
FT                   NARTRKGPRRTVANKKK"
FT   gene            148359..148754
FT                   /gene="rpsK"
FT                   /locus_tag="BSU_01420"
FT                   /old_locus_tag="BSU01420"
FT   CDS_pept        148359..148754
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsK"
FT                   /locus_tag="BSU_01420"
FT                   /old_locus_tag="BSU01420"
FT                   /product="ribosomal protein S11 (BS11)"
FT                   /function="16.2: Construct biomass (Anabolism)"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 10217780, 12682299, 22720735;
FT                   Product type s: structure"
FT                   /db_xref="EnsemblGenomes-Gn:BSU01420"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11918"
FT                   /db_xref="GOA:P04969"
FT                   /db_xref="InterPro:IPR001971"
FT                   /db_xref="InterPro:IPR018102"
FT                   /db_xref="InterPro:IPR019981"
FT                   /db_xref="InterPro:IPR036967"
FT                   /db_xref="PDB:3J9W"
FT                   /db_xref="PDB:5NJT"
FT                   /db_xref="PDB:6HA1"
FT                   /db_xref="PDB:6HA8"
FT                   /db_xref="SubtiList:BG10731"
FT                   /db_xref="UniProtKB/Swiss-Prot:P04969"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:10217780, 12682299, 22720735"
FT                   /protein_id="CAB11918.1"
FT                   /translation="MAAARKSNTRKRRVKKNIESGIAHIRSTFNNTIVTITDTHGNAIS
FT                   WSSAGALGFRGSRKSTPFAAQMAAETAAKGSIEHGLKTLEVTVKGPGSGREAAIRALQA
FT                   AGLEVTAIRDVTPVPHNGCRPPKRRRV"
FT   gene            148931..149875
FT                   /gene="rpoA"
FT                   /locus_tag="BSU_01430"
FT                   /old_locus_tag="BSU01430"
FT   CDS_pept        148931..149875
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoA"
FT                   /locus_tag="BSU_01430"
FT                   /old_locus_tag="BSU01430"
FT                   /product="RNA polymerase (alpha subunit)"
FT                   /function="16.2: Construct biomass (Anabolism)"
FT                   /EC_number="2.7.7.6"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 1484484, 6811591, 9594570,
FT                   10972808, 12682299, 22720735; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU01430"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11919"
FT                   /db_xref="GOA:P20429"
FT                   /db_xref="InterPro:IPR011260"
FT                   /db_xref="InterPro:IPR011262"
FT                   /db_xref="InterPro:IPR011263"
FT                   /db_xref="InterPro:IPR011773"
FT                   /db_xref="InterPro:IPR036603"
FT                   /db_xref="InterPro:IPR036643"
FT                   /db_xref="PDB:1Z3E"
FT                   /db_xref="PDB:3GFK"
FT                   /db_xref="PDB:3IHQ"
FT                   /db_xref="SubtiList:BG10732"
FT                   /db_xref="UniProtKB/Swiss-Prot:P20429"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:1484484, 6811591, 9594570, 10972808, 12682299,
FT                   22720735"
FT                   /protein_id="CAB11919.1"
FT                   /translation="MIEIEKPKIETVEISDDAKFGKFVVEPLERGYGTTLGNSLRRILL
FT                   SSLPGAAVTSIQIDGVLHEFSTIEGVVEDVTTIILHIKKLALKIYSDEEKTLEIDVQGE
FT                   GTVTAADITHDSDVEILNPDLHIATLGENASFRVRLTAQRGRGYTPADANKRDDQPIGV
FT                   IPIDSIYTPVSRVSYQVENTRVGQVANYDKLTLDVWTDGSTGPKEAIALGSKILTEHLN
FT                   IFVGLTDEAQHAEIMVEKEEDQKEKVLEMTIEELDLSVRSYNCLKRAGINTVQELANKT
FT                   EEDMMKVRNLGRKSLEEVKAKLEELGLGLRKDD"
FT   gene            149953..150315
FT                   /gene="rplQ"
FT                   /locus_tag="BSU_01440"
FT                   /old_locus_tag="BSU01440"
FT   CDS_pept        149953..150315
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplQ"
FT                   /locus_tag="BSU_01440"
FT                   /old_locus_tag="BSU01440"
FT                   /product="ribosomal protein L17 (BL15)"
FT                   /function="16.2: Construct biomass (Anabolism)"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 6801428, 10717392, 12682299;
FT                   Product type s: structure"
FT                   /db_xref="EnsemblGenomes-Gn:BSU01440"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11920"
FT                   /db_xref="GOA:P20277"
FT                   /db_xref="InterPro:IPR000456"
FT                   /db_xref="InterPro:IPR036373"
FT                   /db_xref="PDB:3J3V"
FT                   /db_xref="PDB:3J3W"
FT                   /db_xref="PDB:3J9W"
FT                   /db_xref="PDB:5NJT"
FT                   /db_xref="PDB:6HA1"
FT                   /db_xref="PDB:6HA8"
FT                   /db_xref="SubtiList:BG11041"
FT                   /db_xref="UniProtKB/Swiss-Prot:P20277"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:6801428, 10717392, 12682299"
FT                   /protein_id="CAB11920.1"
FT                   /translation="MSYRKLGRTSAQRKAMLRDLTTDLIINERIETTETRAKELRSVVE
FT                   KMITLGKRGDLHARRQAAAYIRNEVANEENNQDALQKLFSDIATRYEERQGGYTRIMKL
FT                   GPRRGDGAPMAIIELV"
FT   gene            150443..151288
FT                   /gene="ecfA"
FT                   /locus_tag="BSU_01450"
FT                   /old_locus_tag="BSU01450"
FT   CDS_pept        150443..151288
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ecfA"
FT                   /locus_tag="BSU_01450"
FT                   /old_locus_tag="BSU01450"
FT                   /product="energizing coupling factor of ABC influx
FT                   transporter (ATP-binding protein)"
FT                   /function="16.1: Circulate"
FT                   /note="Evidence 2a: Function from experimental evidences in
FT                   other organisms; PubMedId: 12110480, 21135102, 26052893;
FT                   Product type t: transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BSU01450"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11921"
FT                   /db_xref="GOA:P40735"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR015856"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030947"
FT                   /db_xref="SubtiList:BG11067"
FT                   /db_xref="UniProtKB/Swiss-Prot:P40735"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB11921.2"
FT                   /translation="MNQNQLISVEDIVFRYRKDAERRALDGVSLQVYEGEWLAIVGHNG
FT                   SGKSTLARALNGLILPESGDIEVAGIQLTEESVWEVRKKIGMVFQNPDNQFVGTTVRDD
FT                   VAFGLENNGVPREEMIERVDWAVKQVNMQDFLDQEPHHLSGGQKQRVAIAGVIAARPDI
FT                   IILDEATSMLDPIGREEVLETVRHLKEQGMATVISITHDLNEAAKADRIIVMNGGKKYA
FT                   EGPPEEIFKLNKELVRIGLDLPFSFQLSQLLRENGLALEENHLTQEGLVKELWTLQSKM
FT                   "
FT   gene            151303..152133
FT                   /gene="ecfAB"
FT                   /locus_tag="BSU_01460"
FT                   /old_locus_tag="BSU01460"
FT   CDS_pept        151303..152133
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ecfAB"
FT                   /locus_tag="BSU_01460"
FT                   /old_locus_tag="BSU01460"
FT                   /product="energizing coupling factor of ABC influx
FT                   transporter (ATP-binding protein)"
FT                   /function="16.1: Circulate"
FT                   /function="16.8: Protect"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 12110480, 21135102, 26052893;
FT                   Product type t: transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BSU01460"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11922"
FT                   /db_xref="GOA:P70970"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR015856"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030946"
FT                   /db_xref="SubtiList:BG11989"
FT                   /db_xref="UniProtKB/Swiss-Prot:P70970"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:12110480, 21135102, 26052893"
FT                   /protein_id="CAB11922.1"
FT                   /translation="MKTPFERLALYDINASIKEGSYVAVIGHTGSGKSTLLQHLNGLLK
FT                   PTKGQISLGSTVIQAGKKNKDLKKLRKKVGIVFQFPEHQLFEETVLKDISFGPMNFGVK
FT                   KEDAEQKAREMLQLVGLSEELLDRSPFELSGGQMRRVAIAGVLAMDPEVLVLDEPTAGL
FT                   DPRGRKEIMDMFYELHQRGNLTTILVTHSMEDAAAYADEMIVMHKGTIQASGSPRDLFL
FT                   KGEEMAGWGLDLPETIKFQRHLEAALGVRFNEPMLTIEDAAAEIRALFQGEKTL"
FT   gene            152130..152927
FT                   /gene="ecfT"
FT                   /locus_tag="BSU_01470"
FT                   /old_locus_tag="BSU01470"
FT   CDS_pept        152130..152927
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ecfT"
FT                   /locus_tag="BSU_01470"
FT                   /old_locus_tag="BSU01470"
FT                   /product="component of the influx ECF transporters"
FT                   /function="16.1: Circulate"
FT                   /note="Evidence 2a: Function from experimental evidences in
FT                   other organisms; PubMedId: 15849754, 16850406, 18931129,
FT                   21135102, 26052893; Product type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BSU01470"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11923"
FT                   /db_xref="GOA:P70972"
FT                   /db_xref="InterPro:IPR003339"
FT                   /db_xref="InterPro:IPR024919"
FT                   /db_xref="SubtiList:BG11990"
FT                   /db_xref="UniProtKB/Swiss-Prot:P70972"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB11923.2"
FT                   /translation="MMDSMIIGKYVPGTSLVHRLDPRTKLITIFLFVCIVFLANNVQTY
FT                   ALLGLFTIGVVSLTRVPFSFLMKGLKPIIWIVLFTFLLHILMTHEGPIIFQIGFFKVYE
FT                   GGLVQGIFISLRFVYLILITTLLTLTTTPIEITDGMEQLLNPLKKLKLPVHELALMMSI
FT                   SLRFIPTLMEETDKIMKAQMARGVDFTSGPVKERVKAIVPLLVPLFVSAFKRAEELAVA
FT                   MEARGYQGGEGRTKYRKLVWTGKDTSVIVSLIVLAALLFFLRA"
FT   gene            152937..153680
FT                   /gene="truA"
FT                   /locus_tag="BSU_01480"
FT                   /old_locus_tag="BSU01480"
FT   CDS_pept        152937..153680
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="truA"
FT                   /locus_tag="BSU_01480"
FT                   /old_locus_tag="BSU01480"
FT                   /product="tRNA pseudouridine (38-40) synthase"
FT                   /function="16.6: Maintain"
FT                   /function="16.2: Construct biomass (Anabolism)"
FT                   /EC_number="5.4.99.12"
FT                   /note="Evidence 2a: Function from experimental evidences in
FT                   other organisms; PubMedId: 10529181, 15353568, 17114947,
FT                   17466622; Product type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU01480"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11924"
FT                   /db_xref="GOA:P70973"
FT                   /db_xref="InterPro:IPR001406"
FT                   /db_xref="InterPro:IPR020095"
FT                   /db_xref="InterPro:IPR020097"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="SubtiList:BG11992"
FT                   /db_xref="UniProtKB/Swiss-Prot:P70973"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB11924.2"
FT                   /translation="MRLKCTISYDGHLFNGYQVQPGKRTVQDELEKALAVLHKSKDRIP
FT                   VVSSGRTDSGVHAAGQVIHFDTPLSIPAERWPYALNALLPDDIAVKQAEIADDGFHARF
FT                   SAVKKEYRYFVYTEKHPDVFKRHYAYHFSYRLNVQDMREAAKHLIGTHDFTSFCAAKTE
FT                   VQDKVRTIYELDWTETADGLQMRITGSGFLYNMVRIIAGTLLDAGIGKISPDEVKSMLE
FT                   AKDREAAGRTAPGHGLYLWNVYYDN"
FT   gene            153737..153793
FT                   /gene="ldlM"
FT                   /locus_tag="BSU_misc_RNA_4"
FT   misc_RNA        153737..153793
FT                   /gene="ldlM"
FT                   /locus_tag="BSU_misc_RNA_4"
FT                   /product="putative L13_leader"
FT                   /note="Evidence 3: Putative function from multiple
FT                   computational evidences; Product type n: RNA"
FT   gene            153842..154279
FT                   /gene="rplM"
FT                   /locus_tag="BSU_01490"
FT                   /old_locus_tag="BSU01490"
FT   CDS_pept        153842..154279
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplM"
FT                   /locus_tag="BSU_01490"
FT                   /old_locus_tag="BSU01490"
FT                   /product="ribosomal protein L13"
FT                   /function="16.2: Construct biomass (Anabolism)"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 10781545, 12682299, 23504016,
FT                   22720735; Product type s: structure"
FT                   /db_xref="EnsemblGenomes-Gn:BSU01490"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11925"
FT                   /db_xref="GOA:P70974"
FT                   /db_xref="InterPro:IPR005822"
FT                   /db_xref="InterPro:IPR005823"
FT                   /db_xref="InterPro:IPR023563"
FT                   /db_xref="InterPro:IPR036899"
FT                   /db_xref="PDB:3J3V"
FT                   /db_xref="PDB:3J3W"
FT                   /db_xref="PDB:3J9W"
FT                   /db_xref="PDB:5NJT"
FT                   /db_xref="PDB:6HA1"
FT                   /db_xref="PDB:6HA8"
FT                   /db_xref="SubtiList:BG11970"
FT                   /db_xref="UniProtKB/Swiss-Prot:P70974"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:10781545, 12682299, 23504016, 22720735"
FT                   /protein_id="CAB11925.2"
FT                   /translation="MRTTPMANASTIERKWLVVDAAGKTLGRLSSEVAAILRGKHKPTY
FT                   TPHVDTGDHVIIINAEKIELTGKKLTDKIYYRHTQHPGGLKSRTALEMRTNYPEKMLEL
FT                   AIKGMLPKGSLGRQMFKKLNVYRGSEHPHEAQKPEVYELRG"
FT   gene            154300..154692
FT                   /gene="rpsI"
FT                   /locus_tag="BSU_01500"
FT                   /old_locus_tag="BSU01500"
FT   CDS_pept        154300..154692
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsI"
FT                   /locus_tag="BSU_01500"
FT                   /old_locus_tag="BSU01500"
FT                   /product="ribosomal protein S9"
FT                   /function="16.2: Construct biomass (Anabolism)"
FT                   /note="Evidence 2a: Function from experimental evidences in
FT                   other organisms; PubMedId: 12682299, 19653700, 22720735;
FT                   Product type s: structure"
FT                   /db_xref="EnsemblGenomes-Gn:BSU01500"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11926"
FT                   /db_xref="GOA:P21470"
FT                   /db_xref="InterPro:IPR000754"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020574"
FT                   /db_xref="InterPro:IPR023035"
FT                   /db_xref="PDB:3J9W"
FT                   /db_xref="PDB:5NJT"
FT                   /db_xref="PDB:6HA1"
FT                   /db_xref="PDB:6HA8"
FT                   /db_xref="SubtiList:BG19007"
FT                   /db_xref="UniProtKB/Swiss-Prot:P21470"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB11926.1"
FT                   /translation="MAQVQYYGTGRRKSSVARVRLVPGEGRIVVNNREISEHIPSAALI
FT                   EDIKQPLTLTETAGTYDVLVNVHGGGLSGQAGAIRHGIARALLEADPEYRTTLKRAGLL
FT                   TRDARMKERKKYGLKGARRAPQFSKR"
FT   gene            155156..155923
FT                   /gene="ybaJ"
FT                   /locus_tag="BSU_01510"
FT                   /old_locus_tag="BSU01510"
FT   CDS_pept        155156..155923
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybaJ"
FT                   /locus_tag="BSU_01510"
FT                   /old_locus_tag="BSU01510"
FT                   /product="putative methyltransferase"
FT                   /note="Evidence 3: Putative function from multiple
FT                   computational evidences; PubMedId: 26582911; Product type
FT                   e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU01510"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11927"
FT                   /db_xref="GOA:P70976"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="SubtiList:BG11994"
FT                   /db_xref="UniProtKB/Swiss-Prot:P70976"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB11927.2"
FT                   /translation="MNALVAHNSKAWDKKVETGNEWTVAVEQQVIEQAKKGNWDIRVTP
FT                   MKDVPKDWFPPIKGLKVLCLASGGGQQGPVLAAAGADVTVLDNSEKQLNQDRMIAERDG
FT                   LTIHTVKGSMDDLSVFNDESFDVIVHPVANVFVENVLPVWKEAYRVLKRNGILISGFVN
FT                   PVVFLFDTELEQQGVLKVKHSIPYADPEDLPKHKVKKLIENNEALEFGHSLEDQIKGQI
FT                   DAGFIVTGFYEDKGGFVLDQYIHTYSATRSVKV"
FT   gene            156109..156552
FT                   /gene="ybaK"
FT                   /locus_tag="BSU_01520"
FT                   /old_locus_tag="BSU01520"
FT   CDS_pept        156109..156552
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybaK"
FT                   /locus_tag="BSU_01520"
FT                   /old_locus_tag="BSU01520"
FT                   /product="conserved protein of unknown function"
FT                   /function="16.8: Protect"
FT                   /function="16.6: Maintain"
FT                   /note="Evidence 4: Unknown function but conserved in other
FT                   organisms; PubMedId: 14679227, 16267290"
FT                   /db_xref="EnsemblGenomes-Gn:BSU01520"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11928"
FT                   /db_xref="InterPro:IPR019667"
FT                   /db_xref="SubtiList:BG11503"
FT                   /db_xref="UniProtKB/Swiss-Prot:P50862"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB11928.1"
FT                   /translation="MAEVLSFMDVKRQKDFELEKNLLKELSLRQIIQSVKDCLEPLFPF
FT                   LHDERDIITEGCIDFAIEAYLLGGRFGIFGYYGESMQSISARSAREEEELRMEFFDYLY
FT                   NWIHEQYATFDKNTVYEAARKFIKDWWTAGFVQREKQCKLRMR"
FT   gene            156612..157325
FT                   /gene="cwlD"
FT                   /locus_tag="BSU_01530"
FT                   /old_locus_tag="BSU01530"
FT   CDS_pept        156612..157325
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cwlD"
FT                   /locus_tag="BSU_01530"
FT                   /old_locus_tag="BSU01530"
FT                   /product="N-acetylmuramoyl-L-alanine amidase"
FT                   /function="16.13: Shape"
FT                   /function="16.8: Protect"
FT                   /function="16.6: Maintain"
FT                   /EC_number="3.5.1.28"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 14679227, 16267290; Product
FT                   type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU01530"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11929"
FT                   /db_xref="GOA:P50864"
FT                   /db_xref="InterPro:IPR002508"
FT                   /db_xref="InterPro:IPR014234"
FT                   /db_xref="SubtiList:BG11514"
FT                   /db_xref="UniProtKB/Swiss-Prot:P50864"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:14679227, 16267290"
FT                   /protein_id="CAB11929.1"
FT                   /translation="MRKKLKWLSFLLGFIILLFLFKYQFSNNDSWKPWSLPLSGKIIYL
FT                   DPGHGGPDGGAVGGKLLEKDVTLEVAFRVRDYLQEQGALVIMTRESDTDLAPEGTKGYS
FT                   RRKAEDLRQRVKLINHSEAELYISIHLNAIPSQKWSGAQSFYYGKYAENEKVAKYIQDE
FT                   LRRNLENTTRKAKRIHGIYLMQNVTKPGALIEVGFLSNPSEATLLGKPKYQDKVASSIY
FT                   KGILRYFTEKGDPPE"
FT   gene            157421..158479
FT                   /gene="salA"
FT                   /locus_tag="BSU_01540"
FT                   /old_locus_tag="BSU01540"
FT   CDS_pept        157421..158479
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="salA"
FT                   /locus_tag="BSU_01540"
FT                   /old_locus_tag="BSU01540"
FT                   /product="phosphorylation-dependent (Y327) transcriptional
FT                   regulator"
FT                   /function="16.8: Protect"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 11790741, 15126467, 26094643;
FT                   Product type r: regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BSU01540"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11930"
FT                   /db_xref="GOA:P50863"
FT                   /db_xref="InterPro:IPR000808"
FT                   /db_xref="InterPro:IPR019591"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033756"
FT                   /db_xref="SubtiList:BG11494"
FT                   /db_xref="UniProtKB/Swiss-Prot:P50863"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:11790741, 15126467, 26094643"
FT                   /protein_id="CAB11930.1"
FT                   /translation="MIREDEVRKLVGEMREPFLQRPLGELDAVKEIKIKPEKRHISVKV
FT                   ALAKTGTAEQMQIQQEIVNVLKGAGAETVGLRFEELPEETVAKFRAPSAEKKTLLNMDN
FT                   PPVFLAVASGKGGVGKSTVSVNLAISLARLGKKVGLIDADIYGFSVPDMMGITVRPTIE
FT                   GEKLLPVERFGVKVMSMGFFVEENAPVVWRGPMLGKMLNNFFHEVEWGEVDYIVLDLPP
FT                   GTGDVALDVHTMLPSCKEIIVSTPHPTAAFVAARAGSMAIKTDHEVVGVIENMAYYESA
FT                   KTGEREYVFGKGGGDKLAEELNVPLLGRIPLKQPDWDKDQFAPSVYDENHPIGEIYQDI
FT                   AKKIDAKMSVQV"
FT   gene            complement(158515..159072)
FT                   /gene="gerD"
FT                   /locus_tag="BSU_01550"
FT                   /old_locus_tag="BSU01550"
FT   CDS_pept        complement(158515..159072)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gerD"
FT                   /locus_tag="BSU_01550"
FT                   /old_locus_tag="BSU01550"
FT                   /product="lipoprotein factor mediating clustering of
FT                   germination proteins"
FT                   /function="16.13: Shape"
FT                   /function="16.3: Control"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 17122337, 10618233, 10376819,
FT                   24530795; Product type f: factor"
FT                   /db_xref="EnsemblGenomes-Gn:BSU01550"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11931"
FT                   /db_xref="GOA:P16450"
FT                   /db_xref="InterPro:IPR041262"
FT                   /db_xref="SubtiList:BG10644"
FT                   /db_xref="UniProtKB/Swiss-Prot:P16450"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:17122337, 10618233, 10376819, 24530795"
FT                   /protein_id="CAB11931.1"
FT                   /translation="MSKAKTLLMSCFLLLSVTACAPKDQAADMDYDQTKKMVVDILKTD
FT                   DGKKAIKELLNDDAMNEALVIDQDAIKGTIEKTLTSKKGEEFWKNIFEDTDFAEGFAKT
FT                   LQTEHEKVIKKLMKDPDYQKMLMSVMQDPGMDKKYSQLAKSQEFRSYLEEVINETLSSP
FT                   LYKKQFEDELKKAAKDTAKESE"
FT   gene            159182..159778
FT                   /gene="kbaA"
FT                   /locus_tag="BSU_01560"
FT                   /old_locus_tag="BSU01560"
FT   CDS_pept        159182..159778
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kbaA"
FT                   /locus_tag="BSU_01560"
FT                   /old_locus_tag="BSU01560"
FT                   /product="inner membrane protein involved in activation of
FT                   the KinB signaling pathway to sporulation"
FT                   /function="16.3: Control"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 8576055, 15849754, 16850406;
FT                   Product type r: regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BSU01560"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11932"
FT                   /db_xref="GOA:P16449"
FT                   /db_xref="InterPro:IPR024164"
FT                   /db_xref="SubtiList:BG10643"
FT                   /db_xref="UniProtKB/Swiss-Prot:P16449"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:8576055, 15849754, 16850406"
FT                   /protein_id="CAB11932.1"
FT                   /translation="MKSRGLVRFFFSILAVGALITSIVGFALKWGEYRGLFLTFEAGQI
FT                   FSVLFWFIGVGMIFSVISQMGFFVFLTVHRFALEILRSSSLWNLLQLFFILFVAFDLMY
FT                   VRFLFFGESGESLAGYAWLPVFLLIFGVITAYIKQKQSSKKTFVSSLFLMVVITALEWF
FT                   PALRVNDEDWLYLMLFPLMACNAFQLLMLPKFAAK"
FT   gene            complement(159779..160543)
FT                   /gene="pdaB"
FT                   /locus_tag="BSU_01570"
FT                   /old_locus_tag="BSU01570"
FT   CDS_pept        complement(159779..160543)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pdaB"
FT                   /locus_tag="BSU_01570"
FT                   /old_locus_tag="BSU01570"
FT                   /product="polysaccharide deacetylase involved in
FT                   sporulation"
FT                   /function="16.13: Shape"
FT                   /function="16.8: Protect"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 12662922, 15547282, 15598884;
FT                   Product type cp: cell process"
FT                   /db_xref="EnsemblGenomes-Gn:BSU01570"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11933"
FT                   /db_xref="GOA:P50865"
FT                   /db_xref="InterPro:IPR002509"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="InterPro:IPR014132"
FT                   /db_xref="SubtiList:BG11416"
FT                   /db_xref="UniProtKB/Swiss-Prot:P50865"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:12662922, 15547282, 15598884"
FT                   /protein_id="CAB11933.1"
FT                   /translation="MNHFYVWHIKRVKQLIIILIAAFAAASFFYIQRAVPLPVFSTDTG
FT                   PKAIYKGETDSKDISLTFDISWGDERAEPILNTLKANGIKNATFFLSASWAERHPDTVA
FT                   RIVKDGHQIGSMGYAYKNYANLESSEIKKDMNRAQTAFEKLGVKDIQLLRPPTGQFNKN
FT                   VLKVAKQYNYTVVHYSVNSQDWTNPGVEKIIDNVTKQVSGGDIILLHASDSAKQTEEAL
FT                   PDIIHQLKEKGLKNVTVGDLIANSDAKSAEVK"
FT   gene            160893..162445
FT                   /gene="rrnI-16S"
FT                   /locus_tag="BSU_rRNA_23"
FT   rRNA            160893..162445
FT                   /gene="rrnI-16S"
FT                   /locus_tag="BSU_rRNA_23"
FT                   /product="ribosomal RNA-16S"
FT                   /function="16.2: Construct biomass (Anabolism)"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; Product type n: RNA"
FT   gene            162610..165535
FT                   /gene="rrnI-23S"
FT                   /locus_tag="BSU_rRNA_14"
FT   rRNA            162610..165535
FT                   /gene="rrnI-23S"
FT                   /locus_tag="BSU_rRNA_14"
FT                   /product="ribosomal RNA-23S"
FT                   /function="16.2: Construct biomass (Anabolism)"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; Product type n: RNA"
FT   gene            165591..165707
FT                   /gene="rrnI-5S"
FT                   /locus_tag="BSU_rRNA_15"
FT   rRNA            165591..165707
FT                   /gene="rrnI-5S"
FT                   /locus_tag="BSU_rRNA_15"
FT                   /product="ribosomal RNA-5S"
FT                   /function="16.2: Construct biomass (Anabolism)"
FT                   /note="Evidence 2a: Function from experimental evidences in
FT                   other organisms; Product type n: RNA"
FT   gene            165754..165825
FT                   /gene="trnI-Asn"
FT                   /locus_tag="BSU_tRNA_23"
FT   tRNA            165754..165825
FT                   /gene="trnI-Asn"
FT                   /locus_tag="BSU_tRNA_23"
FT                   /product="tRNA-Asn"
FT                   /function="16.2: Construct biomass (Anabolism)"
FT                   /note="transfer RNA-Asn(GUU); Evidence 2a: Function from
FT                   experimental evidences in other organisms; Product type n:
FT                   RNA"
FT                   /inference="profile:tRNAscan:1.23"
FT   gene            165830..165902
FT                   /gene="trnI-Thr"
FT                   /locus_tag="BSU_tRNA_24"
FT   tRNA            165830..165902
FT                   /gene="trnI-Thr"
FT                   /locus_tag="BSU_tRNA_24"
FT                   /product="tRNA-Thr"
FT                   /function="16.2: Construct biomass (Anabolism)"
FT                   /note="transfer RNA-Thr(GGU); Evidence 2a: Function from
FT                   experimental evidences in other organisms; Product type n:
FT                   RNA"
FT                   /inference="profile:tRNAscan:1.23"
FT   gene            165959..166033
FT                   /gene="trnI-Gly"
FT                   /locus_tag="BSU_tRNA_25"
FT   tRNA            165959..166033
FT                   /gene="trnI-Gly"
FT                   /locus_tag="BSU_tRNA_25"
FT                   /product="tRNA-Gly"
FT                   /function="16.2: Construct biomass (Anabolism)"
FT                   /note="transfer RNA-Gly(GCC); Evidence 2a: Function from
FT                   experimental evidences in other organisms; Product type n:
FT                   RNA"
FT                   /inference="profile:tRNAscan:1.23"
FT   gene            166064..166140
FT                   /gene="trnI-Arg"
FT                   /locus_tag="BSU_tRNA_26"
FT   tRNA            166064..166140
FT                   /gene="trnI-Arg"
FT                   /locus_tag="BSU_tRNA_26"
FT                   /product="tRNA-Arg"
FT                   /function="16.2: Construct biomass (Anabolism)"
FT                   /note="transfer RNA-Arg(AGC); Evidence 2a: Function from
FT                   experimental evidences in other organisms; Product type n:
FT                   RNA"
FT                   /inference="profile:tRNAscan:1.23"
FT   gene            166168..166244
FT                   /gene="trnI-Pro"
FT                   /locus_tag="BSU_tRNA_27"
FT   tRNA            166168..166244
FT                   /gene="trnI-Pro"
FT                   /locus_tag="BSU_tRNA_27"
FT                   /product="tRNA-Pro"
FT                   /function="16.2: Construct biomass (Anabolism)"
FT                   /note="Evidence 2a: Function from experimental evidences in
FT                   other organisms; Product type n: RNA"
FT                   /inference="profile:tRNAscan:1.23"
FT   gene            166253..166328
FT                   /gene="trnI-Ala"
FT                   /locus_tag="BSU_tRNA_28"
FT   tRNA            166253..166328
FT                   /gene="trnI-Ala"
FT                   /locus_tag="BSU_tRNA_28"
FT                   /product="tRNA-Ala"
FT                   /function="16.2: Construct biomass (Anabolism)"
FT                   /note="transfer RNA-Ala(UGC); Evidence 2a: Function from
FT                   experimental evidences in other organisms; Product type n:
FT                   RNA"
FT                   /inference="profile:tRNAscan:1.23"
FT   gene            166500..168053
FT                   /gene="rrnH-16S"
FT                   /locus_tag="BSU_rRNA_16"
FT   rRNA            166500..168053
FT                   /gene="rrnH-16S"
FT                   /locus_tag="BSU_rRNA_16"
FT                   /product="ribosomal RNA-16S"
FT                   /function="16.2: Construct biomass (Anabolism)"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; Product type n: RNA"
FT   gene            168218..171141
FT                   /gene="rrnH-23S"
FT                   /locus_tag="BSU_rRNA_29"
FT   rRNA            168218..171141
FT                   /gene="rrnH-23S"
FT                   /locus_tag="BSU_rRNA_29"
FT                   /product="ribosomal RNA-23S"
FT                   /function="16.2: Construct biomass (Anabolism)"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; Product type n: RNA"
FT   gene            171197..171314
FT                   /gene="rrnH-5S"
FT                   /locus_tag="BSU_rRNA_24"
FT   rRNA            171197..171314
FT                   /gene="rrnH-5S"
FT                   /locus_tag="BSU_rRNA_24"
FT                   /product="ribosomal RNA-5S"
FT                   /function="16.2: Construct biomass (Anabolism)"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; Product type n: RNA"
FT   gene            171498..173049
FT                   /gene="rrnG-16S"
FT                   /locus_tag="BSU_rRNA_25"
FT   rRNA            171498..173049
FT                   /gene="rrnG-16S"
FT                   /locus_tag="BSU_rRNA_25"
FT                   /product="ribosomal RNA-16S"
FT                   /function="16.2: Construct biomass (Anabolism)"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; Product type n: RNA"
FT   gene            173214..176141
FT                   /gene="rrnG-23S"
FT                   /locus_tag="BSU_rRNA_27"
FT   rRNA            173214..176141
FT                   /gene="rrnG-23S"
FT                   /locus_tag="BSU_rRNA_27"
FT                   /product="ribosomal RNA-23S"
FT                   /function="16.2: Construct biomass (Anabolism)"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; Product type n: RNA"
FT   gene            176197..176315
FT                   /gene="rrnG-5S"
FT                   /locus_tag="BSU_rRNA_28"
FT   rRNA            176197..176315
FT                   /gene="rrnG-5S"
FT                   /locus_tag="BSU_rRNA_28"
FT                   /product="ribosomal RNA-5S"
FT                   /function="16.2: Construct biomass (Anabolism)"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; Product type n: RNA"
FT   gene            177083..178519
FT                   /gene="ybaR"
FT                   /locus_tag="BSU_01580"
FT                   /old_locus_tag="BSU01580"
FT   CDS_pept        177083..178519
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybaR"
FT                   /locus_tag="BSU_01580"
FT                   /old_locus_tag="BSU01580"
FT                   /product="putative permease"
FT                   /function="16.1: Circulate"
FT                   /note="Evidence 3: Putative function from multiple
FT                   computational evidences; PubMedId: 15849754, 16850406;
FT                   Product type t: transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BSU01580"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11934"
FT                   /db_xref="GOA:P55189"
FT                   /db_xref="InterPro:IPR001902"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR011547"
FT                   /db_xref="InterPro:IPR018045"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="SubtiList:BG11562"
FT                   /db_xref="UniProtKB/Swiss-Prot:P55189"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB11934.1"
FT                   /translation="MNNSFTLKQQWFGNIRKDILAGILVALALIPEAIGFSIIAGVDPM
FT                   VGLYASFCIAIIISIFGGRPGMISAATGSMAVVMVSLVADHGLQYLFAATILTGIIQVI
FT                   LGISKIARLMKFIPRSVMIGFVNALAILIFSAQLPQFEGASWSMYAMLAGSLVIIYVLP
FT                   RFTTAVPSPLVAIIVMTIIAVTFHVDVRTVGDMGNISSSLPHFLIPDVPFTFETLQIIF
FT                   PYSIALAFVGLLESLLTAQIIDEMTDTDSDKNKESRGQGIANIVTGFFGGMAGCAMIGQ
FT                   SVINTKAGGRGRLSAFVAGAFLMFLIAVLSHVVVKIPMAALVAVMVMVSVGTFDWSSLK
FT                   GLKKAPLTDSIVMVVTVVTVVVTDDLSKGVFVGVLLSAVFFVAKISKLKIVSHAEDQKL
FT                   RTYQVKGQIFFASVTDLTNAFIYQEDIERVVIDLTEAHVWDDSGAAALDKIVAKFKEQG
FT                   IEAELKGLNKASKSLMKQMA"
FT   gene            178665..179585
FT                   /gene="ybaS"
FT                   /locus_tag="BSU_01590"
FT                   /old_locus_tag="BSU01590"
FT   CDS_pept        178665..179585
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybaS"
FT                   /locus_tag="BSU_01590"
FT                   /old_locus_tag="BSU01590"
FT                   /product="putative sodium dependent transporter"
FT                   /function="7: Transport and binding proteins"
FT                   /note="Evidence 3: Putative function from multiple
FT                   computational evidences; PubMedId: 15849754, 16850406;
FT                   Product type t: transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BSU01590"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11935"
FT                   /db_xref="GOA:P55190"
FT                   /db_xref="InterPro:IPR002657"
FT                   /db_xref="InterPro:IPR004710"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="SubtiList:BG11563"
FT                   /db_xref="UniProtKB/Swiss-Prot:P55190"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB11935.2"
FT                   /translation="MPLLTPTSVVLGVLLSQFLNGYEWAVPWIFAFITFAGSLSANFQS
FT                   LRHALSHPLPMILALFVLHIFMPLFAWGSGHLIFKGDPLTITGLTLAVVIPTGITSLIW
FT                   AAMYKGNVGLTLSIILVDTVLSPLIVPLSLSLLAGAQVHMDVWGMMKGLIVMVVIPSFL
FT                   GMLFNQMSSPERTAFVSSALSPFSKLCLMAVIAINSSAIAPYFKSIDLRFAGIAVTVFF
FT                   IALTGYAAAWLIGKMMKRRQEEIVSLIFTGGMRNISAGAVLAVTFFPSQVAVPVVIGML
FT                   FQQILAALFGYMLNRFELKPMLQKA"
FT   gene            complement(179595..180347)
FT                   /gene="eesA"
FT                   /locus_tag="BSU_01600"
FT                   /old_locus_tag="BSU01600"
FT   CDS_pept        complement(179595..180347)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="eesA"
FT                   /locus_tag="BSU_01600"
FT                   /old_locus_tag="BSU01600"
FT                   /product="iron-chelator (enterobactin family) esterase"
FT                   /function="16.1: Circulate"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 12354229, 2974033, 17725565,
FT                   22210890, 28283524; Product type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU01600"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11936"
FT                   /db_xref="InterPro:IPR000801"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="SubtiList:BG11565"
FT                   /db_xref="UniProtKB/Swiss-Prot:P55192"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:12354229, 2974033, 17725565, 22210890, 28283524"
FT                   /protein_id="CAB11936.2"
FT                   /translation="MKGSLSEHKAGNRRFTLYLPPSYSTDSGGFPAVYVQDGSSLFQNQ
FT                   IELLESAFQQQRLPELVLIGIEPENRLDEYTPWPAASLSDRFTDFGGMGYHYLSDITNQ
FT                   FIPLIEENWNVTREPQSRGMIGASLGGLISMFAILKYPSMFGKIGSISGSYWYENAAET
FT                   IHISSLKPGTARVFMSIGSEEGREKQSIQRHMLKKTKQVHQSLKEKGFTEDQLCLSIEK
FT                   GAVHHHKYFCKQFINALEWLYGKNRSTL"
FT   gene            complement(180344..181354)
FT                   /gene="feuC"
FT                   /locus_tag="BSU_01610"
FT                   /old_locus_tag="BSU01610"
FT   CDS_pept        complement(180344..181354)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="feuC"
FT                   /locus_tag="BSU_01610"
FT                   /old_locus_tag="BSU01610"
FT                   /product="iron-uptake protein"
FT                   /function="16.1: Circulate"
FT                   /note="Evidence 1c: Function from experimental evidences in
FT                   the studied genus; PubMedId: 2651410, 15849754, 16850406,
FT                   27375568; Product type t: transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BSU01610"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11937"
FT                   /db_xref="GOA:P40411"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="SubtiList:BG10837"
FT                   /db_xref="UniProtKB/Swiss-Prot:P40411"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB11937.2"
FT                   /translation="MAKKYALFIALILVVSYFSLTSGSFSVRPAELLSTLFQIDPNPQY
FT                   EILLFDLRLPRVVMAAIIGLGLGIAGAVIQAITRNGLADPGILGINAGAGAGIVAFMLL
FT                   FQGQKEVTSIAAAMGMPLFGLIGGLIAAILIYIFAWHRGNLDSGRIILVGIAINSGFSA
FT                   LSLFLSLKMDPQDYQMAMVWKNGSIWSANWTYITAVLPWMLLFIPILIGKSRLLDTIRF
FT                   DEDTVRSLGISSNKEKTILLVACVAIISACVSVAGSMAFVGLIAPHISRRLAGVEHRYI
FT                   LPLSGLIGMLLVISADFAGKLFFQPAEVPAGIILAILGVPYFLYLLFKQKKGENA"
FT   gene            complement(181347..182351)
FT                   /gene="feuB"
FT                   /locus_tag="BSU_01620"
FT                   /old_locus_tag="BSU01620"
FT   CDS_pept        complement(181347..182351)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="feuB"
FT                   /locus_tag="BSU_01620"
FT                   /old_locus_tag="BSU01620"
FT                   /product="ferri-bacillibactin permease"
FT                   /function="16.1: Circulate"
FT                   /note="Evidence 2a: Function from experimental evidences in
FT                   other organisms; PubMedId: 2651410, 15849754, 16850406,
FT                   17725565; Product type t: transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BSU01620"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11938"
FT                   /db_xref="GOA:P40410"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="SubtiList:BG10836"
FT                   /db_xref="UniProtKB/Swiss-Prot:P40410"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB11938.1"
FT                   /translation="MYSKQWTRIILITSPFAIALSLLLSILYGAKHLSTDIVFTSLIHF
FT                   DPGNTDHQIIWHSRIPRAAGALLIGAALAVSGALMQGITRNYLASPSIMGVSDGSAFII
FT                   TLCMVLLPQSSSIEMMIYSFIGSALGAVLVFGLAAMMPNGFTPVQLAIIGTVTSMLLSS
FT                   LSAAMSIYFQISQDLSFWYSARLHQMSPDFLKLAAPFFLIGIIMAISLSKKVTAVSLGD
FT                   DISKSLGQKKKTIKIMAMLSVIILTGSAVALAGKIAFVGLVVPHITRFLVGSDYSRLIP
FT                   CSCILGGIFLTLCDLASRFINYPFETPIEVVTSIIGVPFFLYLIKRKGGEQNG"
FT   gene            complement(182370..183323)
FT                   /gene="feuA"
FT                   /locus_tag="BSU_01630"
FT                   /old_locus_tag="BSU01630"
FT   CDS_pept        complement(182370..183323)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="feuA"
FT                   /locus_tag="BSU_01630"
FT                   /old_locus_tag="BSU01630"
FT                   /product="ferri-bacillibactin-binding lipoprotein"
FT                   /function="16.1: Circulate"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 8388528, 16889643, 17725565,
FT                   21802011, 22303020, 25355936; Product type lp :
FT                   lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:BSU01630"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11939"
FT                   /db_xref="GOA:P40409"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="PDB:2PHZ"
FT                   /db_xref="PDB:2WHY"
FT                   /db_xref="PDB:2WI8"
FT                   /db_xref="PDB:2XUZ"
FT                   /db_xref="PDB:2XV1"
FT                   /db_xref="SubtiList:BG10835"
FT                   /db_xref="UniProtKB/Swiss-Prot:P40409"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:8388528, 16889643, 17725565, 21802011, 22303020,
FT                   25355936"
FT                   /protein_id="CAB11939.1"
FT                   /translation="MKKISLTLLILLLALTAAACGSKNESTASKASGTASEKKKIEYLD
FT                   KTYEVTVPTDKIAITGSVESMEDAKLLDVHPQGAISFSGKFPDMFKDITDKAEPTGEKM
FT                   EPNIEKILEMKPDVILASTKFPEKTLQKISTAGTTIPVSHISSNWKENMMLLAQLTGKE
FT                   KKAKKIIADYEQDLKEIKTKINDKAKDSKALVIRIRQGNIYIYPEQVYFNSTLYGDLGL
FT                   KAPNEVKAAKAQELSSLEKLSEMNPDHIFVQFSDDENADKPDALKDLEKNPIWKSLKAV
FT                   KEDHVYVNSVDPLAQGGTAWSKVRFLKAAAEKLTQN"
FT   gene            complement(183414..185003)
FT                   /gene="btr"
FT                   /locus_tag="BSU_01640"
FT                   /old_locus_tag="BSU01640"
FT   CDS_pept        complement(183414..185003)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="btr"
FT                   /locus_tag="BSU_01640"
FT                   /old_locus_tag="BSU01640"
FT                   /product="transcriptional activator (AraC/XylS family) of
FT                   synthesis and uptake of the siderophore bacillibactin"
FT                   /function="16.3: Control"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 16889643, 17725565, 17962296,
FT                   22210890; Product type r: regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BSU01640"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11940"
FT                   /db_xref="GOA:P40408"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="SubtiList:BG10834"
FT                   /db_xref="UniProtKB/Swiss-Prot:P40408"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:16889643, 17725565, 17962296, 22210890"
FT                   /protein_id="CAB11940.1"
FT                   /translation="MQNAVIYQPVQIEYLKKTSDLFSEQQLADSFVLIFHLKGNGYISI
FT                   GTNTNPLQKKTLYVCPPNETFGFTPAADGHIDACIIRLLSYIKETGQDIFTPCTESELA
FT                   KLKLMNVSHIENLAVRLQELAALWNESSQLSQLKCVIEVQSLIYDLFTASLSDQTDTHS
FT                   AIEKTKHYIETHADTKITLAQLSQMAGISAKHYSESFKKWTGQSVTEFITKTRITKAKR
FT                   LMAKSNCKLKEIAHQTGYQDEFYFSRIFKKYTGCSPTSYMKKRRKKIAAYGRGTMGHLI
FT                   PLHHIPFAAALHPKWTSYYYQHYSTDIPVQLSAYRFNEKWEENLYTLSQAEPDVIVSMD
FT                   SISPEEQDRLNRIAEVMYLPSEESWRTHFLQTASFLKEESEAEKWLADYDQQTTAAKKT
FT                   LQHVQGLRFLFLRLHKQNFYLAHNRSVREVFFGDLGFSSATTADTPSEQAISLENIANY
FT                   QADCMMLFLFKEPETIAYYQQLQQTEAWQNLSAVRDNRVYLLSLDPWNEYSACGHERIV
FT                   QQTVSLLSGDCP"
FT   gene            complement(185194..186438)
FT                   /gene="ybbC"
FT                   /locus_tag="BSU_01650"
FT                   /old_locus_tag="BSU01650"
FT   CDS_pept        complement(185194..186438)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybbC"
FT                   /locus_tag="BSU_01650"
FT                   /old_locus_tag="BSU01650"
FT                   /product="conserved protein of unknown function"
FT                   /note="Evidence 4: Unknown function but conserved in other
FT                   organisms"
FT                   /db_xref="EnsemblGenomes-Gn:BSU01650"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11941"
FT                   /db_xref="InterPro:IPR008302"
FT                   /db_xref="SubtiList:BG10833"
FT                   /db_xref="UniProtKB/Swiss-Prot:P40407"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB11941.1"
FT                   /translation="MRKTIFAFLTGLMMFGTITAASASPDSKNQTAKKPKVQTGIDTLL
FT                   PDYKKQLKGKRIGLITNPAGVNTSLKSSVDILYENPDIKLTALFGPEHGVRGDAQAGDE
FT                   VGSYIDEKTGVPVYSLYGKTKKPTPEMLKNVDILMFDIQDVGTRFYTYIYTMAYAMEAA
FT                   KENGIPFMVLDRPNPQGGNHIEGPILEPEYASFVGLYPIPLKHGMTIGELASLFNKEFS
FT                   IDADLTVVKMKHWKRKMDFDDTRLPFVLPSPNMPTVESTFVYPATGLIEGTNISEGRGT
FT                   TKPFELIGAPFIKSTELEETLNSLHLPGVTFRAASFTPTFSKHQGTLCHGVQLYVTDRD
FT                   KFEAVKTGLSVIKTIHDLYPEDFEFLSTGSFDKLAGNGWIRTKIENGTSVENIINSYEK
FT                   TLQQFSKTRKKYLIY"
FT   gene            complement(186452..188380)
FT                   /gene="nagZ"
FT                   /locus_tag="BSU_01660"
FT                   /old_locus_tag="BSU01660"
FT   CDS_pept        complement(186452..188380)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nagZ"
FT                   /locus_tag="BSU_01660"
FT                   /old_locus_tag="BSU01660"
FT                   /product="N-acetylglucosaminidase lipoprotein"
FT                   /function="16.11: Scavenge (Catabolism)"
FT                   /EC_number="3.2.1.52"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 8063094, 20400549, 20826810,
FT                   23177201, 26963691; Product type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU01660"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11942"
FT                   /db_xref="GOA:P40406"
FT                   /db_xref="InterPro:IPR001764"
FT                   /db_xref="InterPro:IPR002772"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR019800"
FT                   /db_xref="InterPro:IPR036881"
FT                   /db_xref="InterPro:IPR036962"
FT                   /db_xref="PDB:3BMX"
FT                   /db_xref="PDB:3LK6"
FT                   /db_xref="PDB:3NVD"
FT                   /db_xref="PDB:4GYJ"
FT                   /db_xref="PDB:4GYK"
FT                   /db_xref="SubtiList:BG10832"
FT                   /db_xref="UniProtKB/Swiss-Prot:P40406"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:8063094, 20400549, 20826810, 23177201, 26963691"
FT                   /protein_id="CAB11942.1"
FT                   /translation="MRPVFPLILSAVLFLSCFFGARQTEASASKRAIDANQIVNRMSLD
FT                   EKLGQMLMPDFRNWQKEGESSPQALTKMNDEVASLVKKYQFGGIILFAENVKTTKQTVQ
FT                   LTDDYQKASPKIPLMLSIDQEGGIVTRLGEGTNFPGNMALGAARSRINAYQTGSIIGKE
FT                   LSALGINTDFSPVVDINNNPDNPVIGVRSFSSNRELTSRLGLYTMKGLQRQDIASALKH
FT                   FPGHGDTDVDSHYGLPLVSHGQERLREVELYPFQKAIDAGADMVMTAHVQFPAFDDTTY
FT                   KSKLDGSDILVPATLSKKVMTGLLRQEMGFNGVIVTDALNMKAIADHFGQEEAVVMAVK
FT                   AGVDIALMPASVTSLKEEQKFARVIQALKEAVKNGDIPEQQINNSVERIISLKIKRGMY
FT                   PARNSDSTKEKIAKAKKIVGSKQHLKAEKKLAEKAVTVLKNEQHTLPFKPKKGSRILIV
FT                   APYEEQTASIEQTIHDLIKRKKIKPVSLSKMNFASQVFKTEHEKQVKEADYIITGSYVV
FT                   KNDPVVNDGVIDDTISDSSKWATVFPRAVMKAALQHNKPFVLMSLRNPYDAANFEEAKA
FT                   LIAVYGFKGYANGRYLQPNIPAGVMAIFGQAKPKGTLPVDIPSVTKPGNTLYPLGYGLN
FT                   IKTGRPL"
FT   gene            complement(188408..189733)
FT                   /gene="amiE"
FT                   /locus_tag="BSU_01670"
FT                   /old_locus_tag="BSU01670"
FT   CDS_pept        complement(188408..189733)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="amiE"
FT                   /locus_tag="BSU_01670"
FT                   /old_locus_tag="BSU01670"
FT                   /product="amidase hydrolyzing N-acetylmuramyl-L-Ala bond of
FT                   MurNAc peptides"
FT                   /function="16.13: Shape"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 16452451, 20400549; Product
FT                   type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU01670"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11943"
FT                   /db_xref="GOA:O05213"
FT                   /db_xref="InterPro:IPR001466"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR022849"
FT                   /db_xref="SubtiList:BG11566"
FT                   /db_xref="UniProtKB/Swiss-Prot:O05213"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:16452451, 20400549"
FT                   /protein_id="CAB11943.2"
FT                   /translation="MKTKTLFIFSAILTLSIFAPNETFAQTAGNLIEPKIINAETAQFS
FT                   TKKLRKVDQMIERDIAAGFPGAVLVVVKDGRIIKKAAYGYSKKYEGSELLRRPAKMKTR
FT                   TMFDLASNTKMYATNFALQRLVSQGKLDVYEKVSAYLPGFKDQPGDLIKGKDKIRVIDV
FT                   LQHQSGLPSSFYFYTPEKAGKYYSQERDKTIEYLTKIPLDYQTGTKHVYSDIGYMLLGC
FT                   IVEKLTGKPLDVYTEQELYKPLRLKHTLYNPLQKGFKPKQFAATERMGNTRDGVIQFPN
FT                   IRTNTLQGEVHDEKAFYSMDGVSGHAGLFSNADDMAILLQVMLNKGSYRNISLFDQKTA
FT                   DLFTAPSATDPTFALGWRRNGSKSMEWMFGPHASENAYGHTGWTGTVTIIDPAYNLGIA
FT                   LLTNKKHTPVIDPEENPNVFEGDQFPTGSYGSVITAIYEAME"
FT   gene            complement(189790..191157)
FT                   /gene="murP"
FT                   /locus_tag="BSU_01680"
FT                   /old_locus_tag="BSU01680"
FT   CDS_pept        complement(189790..191157)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murP"
FT                   /locus_tag="BSU_01680"
FT                   /old_locus_tag="BSU01680"
FT                   /product="N-acetylmuramic acid PTS permease-MurP subunit"
FT                   /function="16.1: Circulate"
FT                   /EC_number="2.7.1.192"
FT                   /note="Evidence 2a: Function from experimental evidences in
FT                   other organisms; PubMedId: 15060041, 15849754, 16850406,
FT                   10627040, 20400549, 22960854; Product type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BSU01680"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11944"
FT                   /db_xref="GOA:Q797S1"
FT                   /db_xref="InterPro:IPR001996"
FT                   /db_xref="InterPro:IPR003352"
FT                   /db_xref="InterPro:IPR013013"
FT                   /db_xref="InterPro:IPR018113"
FT                   /db_xref="InterPro:IPR036878"
FT                   /db_xref="SubtiList:BG11567"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q797S1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB11944.3"
FT                   /translation="MSKENNYHHLAQKILELCGGKSNISSYTHCMTRLRITPYDESKAD
FT                   AQALRKLDGVLGVVEAETLQIILGTGVVNHVTAAFSKLVSAEEGADVKEAAAKKKADIN
FT                   RKNATPFKLFLRKIASIFIPLIPALVASGLITGITKAIIQAGWLSADSQIAIILTVIGS
FT                   GLFTYLGILVGINASKEFGGTPALGALAGILIINPEIAKISLFGEELLPGRGGLIGVLF
FT                   AAIFIAYTEQFIRRFIPQSLDIIVTPTVSLLITGIVTYVVFMPLGGFISDAITSGLLSI
FT                   LDIGGIAAGFILGATFLPLVVTGLHQGLTPVHMELINSIGNDPLLPILAMGGAGQVGAA
FT                   FAVFVKTKKTTLRKAIAGGLPSGLLGIGEPLIFGVTLPLGRPFLTACLGAGIGGAFQAY
FT                   FQVATIAIGVSGLPLSFLVLPSQIILYIVGLFISYAAGFLLTYAFGYKDEMASQFD"
FT   gene            complement(191183..192034)
FT                   /gene="murR"
FT                   /locus_tag="BSU_01690"
FT                   /old_locus_tag="BSU01690"
FT   CDS_pept        complement(191183..192034)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murR"
FT                   /locus_tag="BSU_01690"
FT                   /old_locus_tag="BSU01690"
FT                   /product="transcriptional regulator MurR-N-acetylmuramic
FT                   acid"
FT                   /function="16.3: Control"
FT                   /note="Evidence 2a: Function from experimental evidences in
FT                   other organisms; PubMedId: 20400549; Product type r :
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BSU01690"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11945"
FT                   /db_xref="GOA:Q45581"
FT                   /db_xref="InterPro:IPR000281"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR035472"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="PDB:2O3F"
FT                   /db_xref="SubtiList:BG11569"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q45581"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB11945.1"
FT                   /translation="MATGGLAIIQSMKHKLPPSERKLADYILAHPHKAIESTVNEISAL
FT                   ANSSDAAVIRLCKSLGLKGFQDLKMRVAGDLAKPTFQGYRDIVPHEPLPSISEKTAGNA
FT                   IQAIQDTSDLMDYKELERAVSLLLKAHTVHFIGLGASGIVAKDAQQKWLRIHKQATAFT
FT                   DTHLVASLIANADKDDIVFAISFSGETQEIVELFAMAKEKGITTISLTQFSQTSVSALA
FT                   DVPLYTAHSNEALIRSAATSSRLAQLFIIDVLFLGMAAEQYETTTGYIDKTRAAIQSMR
FT                   IK"
FT   gene            complement(192051..192965)
FT                   /gene="murQ"
FT                   /locus_tag="BSU_01700"
FT                   /old_locus_tag="BSU01700"
FT   CDS_pept        complement(192051..192965)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murQ"
FT                   /locus_tag="BSU_01700"
FT                   /old_locus_tag="BSU01700"
FT                   /product="D-lactyl ether N-acetylmuramic-6-phosphate acid
FT                   etherase"
FT                   /function="16.13: Shape"
FT                   /function="16.11: Scavenge (Catabolism)"
FT                   /function="16.6: Maintain"
FT                   /EC_number="4.2.1.126"
FT                   /note="Evidence 2a: Function from experimental evidences in
FT                   other organisms; PubMedId: 15983044, 20400549, 16452451;
FT                   Product type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU01700"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11946"
FT                   /db_xref="GOA:Q45582"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR005486"
FT                   /db_xref="InterPro:IPR005488"
FT                   /db_xref="InterPro:IPR040190"
FT                   /db_xref="SubtiList:BG11570"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q45582"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB11946.1"
FT                   /translation="MSEPLNLHRLTTESRNSQTVEIHKANTLGILKMINNEDMKVAAAV
FT                   QEVLPDIKTAVDCAYESFQNGGRLIYTGAGTSGRLGVMDAVECPPTYSVSPDQVIGIMA
FT                   GGPEAFLQAAEGIEDSEEAGAEDLRNIQLTSNDTVIAIAASGRTPYAAGALRYARKVGA
FT                   HTIALTCNENSAISKDADHSIEVVVGPEAITGSTRMKAATAHKMILNMISTAVMVKIGK
FT                   VYENLMVDVNVSNKKLKERAISIIQSLTNASYDTARYTLEQADHHVKTAIVMLKTSTDQ
FT                   KQAQTLLDEANGFIDKAIEHYHP"
FT   gene            complement(193075..193557)
FT                   /gene="ybbJ"
FT                   /locus_tag="BSU_01710"
FT                   /old_locus_tag="BSU01710"
FT   CDS_pept        complement(193075..193557)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybbJ"
FT                   /locus_tag="BSU_01710"
FT                   /old_locus_tag="BSU01710"
FT                   /product="putative acyltransferase"
FT                   /note="Evidence 3: Putative function from multiple
FT                   computational evidences; Product type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU01710"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11947"
FT                   /db_xref="GOA:Q45583"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="SubtiList:BG11571"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q45583"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB11947.2"
FT                   /translation="MTQDISLSFYKPEHLPELQSFTLTNDDKRFTSLPKEVLSQALGIQ
FT                   DRYPVVILKDDLPVGFFILHASKETLASYSNNPFALLLSSLSLTAVHHGKGYAKKAMLL
FT                   LPAFVSGYFPWCDEIILAVNHLNIRAKHLYMKSGFLDKGRRRIGPLGEQLILHHFL"
FT   gene            complement(193570..194025)
FT                   /gene="ybbK"
FT                   /locus_tag="BSU_01720"
FT                   /old_locus_tag="BSU01720"
FT   CDS_pept        complement(193570..194025)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybbK"
FT                   /locus_tag="BSU_01720"
FT                   /old_locus_tag="BSU01720"
FT                   /product="conserved protein of unknown function"
FT                   /note="Evidence 4: Unknown function but conserved in other
FT                   organisms"
FT                   /db_xref="EnsemblGenomes-Gn:BSU01720"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11948"
FT                   /db_xref="InterPro:IPR007553"
FT                   /db_xref="SubtiList:BG11572"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q45584"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB11948.2"
FT                   /translation="MILVSSCLGGIECRYNGSHAASEKIRKLVDEKKAVMACPELLGGF
FT                   STPREPAEIIGGTGEDVLNGTAKIVTASGEDVTELYMEGAAKTLAYAKEINASAVILKE
FT                   NSPSCGSGFIYNGTFSGKKITGSGVTAALLKQAGYRVISENELNDIL"
FT   gene            194205..194279
FT                   /gene="trnSL-Glu2"
FT                   /locus_tag="BSU_tRNA_75"
FT   tRNA            194205..194279
FT                   /gene="trnSL-Glu2"
FT                   /locus_tag="BSU_tRNA_75"
FT                   /product="tRNA-Glu"
FT                   /function="16.2: Construct biomass (Anabolism)"
FT                   /note="transfer RNA-Glu(UUC); Evidence 2a: Function from
FT                   experimental evidences in other organisms; Product type n:
FT                   RNA"
FT                   /inference="profile:tRNAscan:1.23"
FT   gene            194283..194358
FT                   /gene="trnSL-Val1"
FT                   /locus_tag="BSU_tRNA_78"
FT   tRNA            194283..194358
FT                   /gene="trnSL-Val1"
FT                   /locus_tag="BSU_tRNA_78"
FT                   /product="tRNA-Val"
FT                   /function="16.2: Construct biomass (Anabolism)"
FT                   /note="transfer RNA-Val(UAC); Evidence 2a: Function from
FT                   experimental evidences in other organisms; Product type n:
FT                   RNA"
FT                   /inference="profile:tRNAscan:1.23"
FT   gene            194363..194435
FT                   /gene="trnSL-Thr1"
FT                   /locus_tag="BSU_tRNA_76"
FT   tRNA            194363..194435
FT                   /gene="trnSL-Thr1"
FT                   /locus_tag="BSU_tRNA_76"
FT                   /product="tRNA-Thr"
FT                   /function="16.2: Construct biomass (Anabolism)"
FT                   /note="transfer RNA-Thr(UGU); Evidence 2a: Function from
FT                   experimental evidences in other organisms; Product type n:
FT                   RNA"
FT                   /inference="profile:tRNAscan:1.23"
FT   gene            194458..194542
FT                   /gene="trnSL-Tyr1"
FT                   /locus_tag="BSU_tRNA_77"
FT   tRNA            194458..194542
FT                   /gene="trnSL-Tyr1"
FT                   /locus_tag="BSU_tRNA_77"
FT                   /product="tRNA-Tyr"
FT                   /function="16.2: Construct biomass (Anabolism)"
FT                   /note="transfer RNA-Tyr(GAU); Evidence 2a: Function from
FT                   experimental evidences in other organisms; Product type n:
FT                   RNA"
FT                   /inference="profile:tRNAscan:1.23"
FT   gene            194547..194621
FT                   /gene="trnSL-Gln2"
FT                   /locus_tag="BSU_tRNA_74"
FT   tRNA            194547..194621
FT                   /gene="trnSL-Gln2"
FT                   /locus_tag="BSU_tRNA_74"
FT                   /product="tRNA-Gln"
FT                   /function="16.2: Construct biomass (Anabolism)"
FT                   /note="transfer RNA-Gln(UUG); Evidence 2a: Function from
FT                   experimental evidences in other organisms; Product type n:
FT                   RNA"
FT                   /inference="profile:tRNAscan:1.23"
FT   gene            194849..195412
FT                   /gene="sigW"
FT                   /locus_tag="BSU_01730"
FT                   /old_locus_tag="BSU01730"
FT   CDS_pept        194849..195412
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sigW"
FT                   /locus_tag="BSU_01730"
FT                   /old_locus_tag="BSU01730"
FT                   /product="RNA polymerase ECF(extracytoplasmic
FT                   function)-type sigma factor W"
FT                   /function="16.3: Control"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 11866510, 15130127, 16629676,
FT                   21542858, 28319136, 22720735; Product type r : regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BSU01730"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11949"
FT                   /db_xref="GOA:Q45585"
FT                   /db_xref="InterPro:IPR000838"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR014294"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="PDB:5WUQ"
FT                   /db_xref="PDB:5WUR"
FT                   /db_xref="SubtiList:BG11573"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q45585"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:11866510, 15130127, 16629676, 21542858, 28319136,
FT                   22720735"
FT                   /protein_id="CAB11949.1"
FT                   /translation="MEMMIKKRIKQVKKGDQDAFADIVDIYKDKIYQLCYRMLGNVHEA
FT                   EDIAQEAFIRAYVNIDSFDINRKFSTWLYRIATNLTIDRIRKKKPDYYLDAEVAGTEGL
FT                   TMYSQIVADGVLPEDAVVSLELSNTIQQKILKLPDKYRTVIVLKYIDELSLIEIGEILN
FT                   IPVGTVKTRIHRGREALRKQLRDL"
FT   gene            195426..196052
FT                   /gene="rsiW"
FT                   /locus_tag="BSU_01740"
FT                   /old_locus_tag="BSU01740"
FT   CDS_pept        195426..196052
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rsiW"
FT                   /locus_tag="BSU_01740"
FT                   /old_locus_tag="BSU01740"
FT                   /product="anti-sigma(W) factor"
FT                   /function="16.3: Control"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 15130127, 28319136, 22720735;
FT                   Product type r: regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BSU01740"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11950"
FT                   /db_xref="GOA:Q45588"
FT                   /db_xref="InterPro:IPR027383"
FT                   /db_xref="PDB:5WUQ"
FT                   /db_xref="PDB:5WUR"
FT                   /db_xref="SubtiList:BG11574"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q45588"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:15130127, 28319136, 22720735"
FT                   /protein_id="CAB11950.1"
FT                   /translation="MSCPEQIVQLMHMHLDGDILPKDEHVLNEHLETCEKCRKHFYEME
FT                   KSIALVRSTSHVEAPADFTANVMAKLPKEKKRASVKRWFRTHPVIAAAAVFIILMGGGF
FT                   FNSWHNDHNFSVSKQPNLVVHNHTVTVPEGETVKGDVTVKNGKLIIKGKIDGDVTVVNG
FT                   EKYMASAGQVTGQIEEINQLFDWTWYKMKSAGKSVLDAFNPNGEE"
FT   gene            196213..197034
FT                   /gene="cdaA"
FT                   /locus_tag="BSU_01750"
FT                   /old_locus_tag="BSU01750"
FT   CDS_pept        196213..197034
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cdaA"
FT                   /locus_tag="BSU_01750"
FT                   /old_locus_tag="BSU01750"
FT                   /product="diadenylate cyclase"
FT                   /function="16.3: Control"
FT                   /function="16.6: Maintain"
FT                   /function="16.13: Shape"
FT                   /EC_number="2.7.7.85"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 19901023, 21566650, 23192352,
FT                   25605729, 25616256, 26240071, 28420751; Product type e:
FT                   enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU01750"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11951"
FT                   /db_xref="GOA:Q45589"
FT                   /db_xref="InterPro:IPR003390"
FT                   /db_xref="InterPro:IPR014046"
FT                   /db_xref="InterPro:IPR034701"
FT                   /db_xref="InterPro:IPR036888"
FT                   /db_xref="SubtiList:BG11577"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q45589"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:19901023, 21566650, 23192352, 25605729, 25616256,
FT                   26240071, 28420751"
FT                   /protein_id="CAB11951.2"
FT                   /translation="MAFEDIPFLQYLGNAVDILLVWYVIYKLIMVIRGTKAVQLLKGIV
FT                   VIVLVRMASQYLGLSTLQWLMDQAITWGFLAIIIIFQPELRRALEQLGRGRFFSRSGTP
FT                   VEEAQQKTIEAITKAINYMAKRRIGALLTIERDTGMGDYIETGIPLNAKVSSELLINIF
FT                   IPNTPLHDGAVIMKNNEIAAAACYLPLSESPFISKELGTRHRAAVGISEVTDSLTIIVS
FT                   EETGGVSVAKNGDLHRELTEEALKEMLEAEFKKNTRDTSSNRWYWRGKKNG"
FT   gene            197027..198478
FT                   /gene="cdaR"
FT                   /locus_tag="BSU_01760"
FT                   /old_locus_tag="BSU01760"
FT   CDS_pept        197027..198478
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cdaR"
FT                   /locus_tag="BSU_01760"
FT                   /old_locus_tag="BSU01760"
FT                   /product="regulator of diadenylate cyclase activity"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 16236721, 17406245, 20094656,
FT                   21154411, 22720735, 23192352, 27074767; Product type r:
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BSU01760"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11952"
FT                   /db_xref="GOA:O34659"
FT                   /db_xref="InterPro:IPR012505"
FT                   /db_xref="SubtiList:BG12703"
FT                   /db_xref="UniProtKB/Swiss-Prot:O34659"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:16236721, 17406245, 20094656, 21154411, 22720735,
FT                   23192352, 27074767"
FT                   /protein_id="CAB11952.2"
FT                   /translation="MDKFLNNRWAVKIIALLFALLLYVAVNSNQAPTPKKPGESFFPTS
FT                   TTDEATLTDIPVKAYYDDENYVVTGVPQTVNVTIKGSTSAVKKARQTKNFEIYADMEHL
FT                   KTGTHKVELKAKNVSDGLTISINPSVTTVTIQERTTKSFPVEVEYYNKSKMKKGYSPEQ
FT                   PIVSPKNVQITGSKNVIDNISLVKASVNLENADETIEKEAKVTVYDKDGNALPVDVEPS
FT                   VIKITVPVTSPSKKVPFKIERTGSLPDGVSIANIESSPSEVTVYGSQDVLDSLEFIDGV
FT                   SLDLSKINKDSDIEADIPLPDGVKKISPSKVTLHIEVDSEADQKFENVPIKTVGLSSSQ
FT                   NIEFLDPESQAIDVTAKGSPTNINKLKKSDIELYVNVSDLEDGEHSVKLEVNGPQNVTW
FT                   SLGRKNAKIKLTSKKSNTSTNDNSSNTSGNQDTDKQTNDQKNNQQEDTKNTDKNNNDQN
FT                   QDGNKDQNQDQDEDESTANSQSSSE"
FT   gene            198497..199843
FT                   /gene="glmM"
FT                   /locus_tag="BSU_01770"
FT                   /old_locus_tag="BSU01770"
FT   CDS_pept        198497..199843
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glmM"
FT                   /locus_tag="BSU_01770"
FT                   /old_locus_tag="BSU01770"
FT                   /product="phosphoglucosamine mutase"
FT                   /function="16.6: Maintain"
FT                   /function="16.13: Shape"
FT                   /function="16.2: Construct biomass (Anabolism)"
FT                   /EC_number="5.4.2.10"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 10671448, 10913078, 12089032,
FT                   21154411, 26240071, 27074767; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU01770"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11953"
FT                   /db_xref="GOA:O34824"
FT                   /db_xref="InterPro:IPR005841"
FT                   /db_xref="InterPro:IPR005843"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR006352"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR016066"
FT                   /db_xref="InterPro:IPR036900"
FT                   /db_xref="SubtiList:BG12704"
FT                   /db_xref="UniProtKB/Swiss-Prot:O34824"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:10671448, 10913078, 12089032, 21154411, 26240071,
FT                   27074767"
FT                   /protein_id="CAB11953.1"
FT                   /translation="MGKYFGTDGVRGVANSELTPELAFKVGRFGGYVLTKDKQRPKVLI
FT                   GRDTRISGHMLEGALVAGLLSIGAEVMRLGVISTPGVSYLTKAMDAEAGVMISASHNPV
FT                   QDNGIKFFGGDGFKLSDEQEAEIERLMDEPEDKLPRPVGADLGLVNDYFEGGQKYLQFL
FT                   KQTADEDFTGIHVALDCANGATSSLATHLFADLDADVSTMGTSPNGLNINDGVGSTHPE
FT                   ALSAFVKEKNADLGLAFDGDGDRLIAVDEKGNIVDGDQIMYICSKHLKSEGRLKDDTVV
FT                   STVMSNLGFYKALEKEGIKSVQTAVGDRYVVEAMKKDGYNVGGEQSGHLIFLDYNTTGD
FT                   GLLSAIMLMNTLKATGKPLSELAAEMQKFPQLLVNVRVTDKYKVEENEKVKAVISEVEK
FT                   EMNGDGRILVRPSGTEPLVRVMAEAKTKELCDEYVNRIVEVVRSEMGLE"
FT   gene            200017..200187
FT                   /gene="glmSA"
FT                   /locus_tag="BSU_misc_RNA_5"
FT   misc_RNA        200017..200187
FT                   /gene="glmSA"
FT                   /locus_tag="BSU_misc_RNA_5"
FT                   /product="riboswitch and ribozyme (GlmS-glucosamine-6-P)"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 16298301, 16484375, 16990543,
FT                   17114942, 17283212, 18079181, 19228039, 21317896, 21395279,
FT                   21936556, 25038539, 26240071, 28012261; Product type n:
FT                   RNA"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:16298301, 16484375, 16990543, 17114942, 17283212,
FT                   18079181, 19228039, 21317896, 21395279, 21936556, 25038539,
FT                   26240071, 28012261"
FT   gene            200277..202079
FT                   /gene="glmS"
FT                   /locus_tag="BSU_01780"
FT                   /old_locus_tag="BSU01780"
FT   CDS_pept        200277..202079
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glmS"
FT                   /locus_tag="BSU_01780"
FT                   /old_locus_tag="BSU01780"
FT                   /product="L-glutamine-D-fructose-6-phosphate
FT                   amidotransferase"
FT                   /function="16.13: Shape"
FT                   /function="16.2: Construct biomass (Anabolism)"
FT                   /EC_number="2.6.1.16"
FT                   /note="Evidence 2a: Function from experimental evidences in
FT                   other organisms; PubMedId: 12682299, 15029187, 17114942,
FT                   17283212, 17322533, 23874669; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU01780"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11954"
FT                   /db_xref="GOA:P0CI73"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR005855"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR035466"
FT                   /db_xref="InterPro:IPR035490"
FT                   /db_xref="SubtiList:BG10948"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0CI73"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB11954.1"
FT                   /translation="MCGIVGYIGQLDAKEILLKGLEKLEYRGYDSAGIAVANEQGIHVF
FT                   KEKGRIADLREVVDANVEAKAGIGHTRWATHGEPSYLNAHPHQSALGRFTLVHNGVIEN
FT                   YVQLKQEYLQDVELKSDTDTEVVVQVIEQFVNGGLETEEAFRKTLTLLKGSYAIALFDN
FT                   DNRETIFVAKNKSPLLVGLGDTFNVVASDAMAMLQVTNEYVELMDKEMVIVTDDQVVIK
FT                   NLDGDVITRASYIAELDASDIEKGTYPHYMLKETDEQPVVMRKIIQTYQDENGKLSVPG
FT                   DIAAAVAEADRIYIIGCGTSYHAGLVGKQYIEMWANVPVEVHVASEFSYNMPLLSKKPL
FT                   FIFLSQSGETADSRAVLVQVKALGHKALTITNVPGSTLSREADYTLLLHAGPEIAVAST
FT                   KAYTAQIAVLAVLASVAADKNGINIGFDLVKELGIAANAMEALCDQKDEMEMIAREYLT
FT                   VSRNAFFIGRGLDYFVCVEGALKLKEISYIQAEGFAGGELKHGTIALIEQGTPVFALAT
FT                   QEHVNLSIRGNVKEVAARGANTCIISLKGLDDADDRFVLPEVNPALAPLVSVVPLQLIA
FT                   YYAALHRGCDVDKPRNLAKSVTVE"
FT   gene            202126..202266
FT                   /gene="ybbU"
FT                   /locus_tag="BSU_01790"
FT                   /old_locus_tag="BSU01790"
FT   CDS_pept        202126..202266
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybbU"
FT                   /locus_tag="BSU_01790"
FT                   /old_locus_tag="BSU01790"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5: Unknown function"
FT                   /db_xref="UniProtKB/TrEMBL:A0A2K4Z9G0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="SOX90537.1"
FT                   /translation="MSKSERTSTVEKWIKEVDGTGPDYRSTMAIDLRCFLIRSVNQVKR
FT                   H"
FT   gene            complement(202547..203458)
FT                   /gene="alkA"
FT                   /locus_tag="BSU_01800"
FT                   /old_locus_tag="BSU01800"
FT   CDS_pept        complement(202547..203458)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="alkA"
FT                   /locus_tag="BSU_01800"
FT                   /old_locus_tag="BSU01800"
FT                   /product="DNA-3-methyladenine glycosylase; prophage 1
FT                   region"
FT                   /function="16.6: Maintain"
FT                   /function="16.8: Protect"
FT                   /EC_number="3.2.2.21"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 7565865, 8376346, 16468998;
FT                   Product type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU01800"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11956"
FT                   /db_xref="GOA:P37878"
FT                   /db_xref="InterPro:IPR000035"
FT                   /db_xref="InterPro:IPR003265"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="InterPro:IPR012904"
FT                   /db_xref="SubtiList:BG10165"
FT                   /db_xref="UniProtKB/Swiss-Prot:P37878"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:7565865, 8376346, 16468998"
FT                   /protein_id="CAB11956.1"
FT                   /translation="MTWHEVNDVIVITLPEIFDMNANLGYLTREKNECMYEIENNIITK
FT                   VIAIGEIRSLVQVSVINNKQMIVQFLNDSRPVEQWKREEIVKYIHEWFDLDNDLTPFYE
FT                   MAKADPLLKMPARKFYGLRVIGIPDLFEALCWGVLGQQINLAFAYSLKKQFVEAFGDSI
FT                   EWNGKKYWVFPPYERIARLTPTDLADIKMTVKKSEYIIGIARLMASGELSREKLMKMNF
FT                   KDAEKNLIKIRGIGPWTANYVLMRCLRFPTAFPIDDVGLIHSIKILRNMNRKPTKDEIL
FT                   EISVPWKEWQSYATFYLWRVLY"
FT   gene            203729..204364
FT                   /gene="adaA"
FT                   /locus_tag="BSU_01810"
FT                   /old_locus_tag="BSU01810"
FT   CDS_pept        203729..204364
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="adaA"
FT                   /locus_tag="BSU_01810"
FT                   /old_locus_tag="BSU01810"
FT                   /product="methylphosphotriester-DNA alkyltransferase and
FT                   transcriptional regulator (AraC/XylS family)"
FT                   /function="16.6: Maintain"
FT                   /function="16.3: Control"
FT                   /EC_number="2.1.1.63"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 1744039, 2120677, 7565865,
FT                   8376346; Product type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU01810"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11957"
FT                   /db_xref="GOA:P19219"
FT                   /db_xref="InterPro:IPR004026"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR016220"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR035451"
FT                   /db_xref="SubtiList:BG10166"
FT                   /db_xref="UniProtKB/Swiss-Prot:P19219"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:1744039, 2120677, 7565865, 8376346"
FT                   /protein_id="CAB11957.1"
FT                   /translation="MPDSINNGHKESHDHRISNDAEMITDEKWQAIINNDAAYNNQFFY
FT                   AVKSTGIFCKPSCKSRVPKKENVCIFPNTEQALRANFRPCKRCKPTNEKMPDSEWVDLI
FT                   TEYIDKNFTEKLTLESLADICHGSPYHMHRTFKKIKGITLVEYIQQVRVHAAKKYLIQT
FT                   NKAIGDIAICVGIANAPYFITLFKKKTGQTPARFRQMSKMEETYNGNK"
FT   gene            204351..204890
FT                   /gene="adaB"
FT                   /locus_tag="BSU_01820"
FT                   /old_locus_tag="BSU01820"
FT   CDS_pept        204351..204890
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="adaB"
FT                   /locus_tag="BSU_01820"
FT                   /old_locus_tag="BSU01820"
FT                   /product="O6-methylguanine-DNA methyltransferase; prophage
FT                   1 region"
FT                   /function="16.6: Maintain"
FT                   /EC_number="2.1.1.63"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 1744039, 2120677, 7565865,
FT                   8376346; Product type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU01820"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11958"
FT                   /db_xref="GOA:P19220"
FT                   /db_xref="InterPro:IPR001497"
FT                   /db_xref="InterPro:IPR008332"
FT                   /db_xref="InterPro:IPR014048"
FT                   /db_xref="InterPro:IPR036217"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036631"
FT                   /db_xref="SubtiList:BG10167"
FT                   /db_xref="UniProtKB/Swiss-Prot:P19220"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:1744039, 2120677, 7565865, 8376346"
FT                   /protein_id="CAB11958.1"
FT                   /translation="METNKPTLYWSLLMFKDWNFYIASTLKGLVFVGSQNKPIEELFEW
FT                   ARKRFPGSLLVEDDDKLEPYAVEITQYLEGKRKNFTVPVEYAGTQFQLAVWNALCEIPY
FT                   GQTKSYSDIANDINKPAAVRAVGAAIGANPVLITVPCHRVIGKNGSLTGYRGGFEMKTL
FT                   LLDLEKRASSEMDVPH"
FT   gene            205409..206926
FT                   /gene="ndhF"
FT                   /locus_tag="BSU_01830"
FT                   /old_locus_tag="BSU01830"
FT   CDS_pept        205409..206926
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ndhF"
FT                   /locus_tag="BSU_01830"
FT                   /old_locus_tag="BSU01830"
FT                   /product="putative NADH dehydrogenase; prophage 1 region"
FT                   /function="16.10: Respire"
FT                   /EC_number="1.6.-.-"
FT                   /note="Evidence 3: Putative function from multiple
FT                   computational evidences; PubMedId: 10658656, 15849754,
FT                   16850406, 17015645, 6816592, 7565865; Product type e :
FT                   enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU01830"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11959"
FT                   /db_xref="GOA:P39755"
FT                   /db_xref="InterPro:IPR001516"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="SubtiList:BG10949"
FT                   /db_xref="UniProtKB/Swiss-Prot:P39755"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB11959.1"
FT                   /translation="MLVSLSLSSLLTLFFIMLMASGISGLLFLHPRVPLSFVRIHIGIL
FT                   ALPLLVSLLILANSGVSGNVGPWHLDSLACLMTFFVLAIGFIIQRFSVRYLMGDRSYRK
FT                   YFTLFTFTTGAASMTWLSGDLRLMVLFWGATLVGLTLLIRLNSAWQVASEAAKISGRLF
FT                   LLSWFSLFFAMMWLFHATGQWQLSLVVTNESLAGLGEWERTGIQLLIVLAVIIPAAQWP
FT                   FQRWLVESIVAPTPVSAIMHAGLVNAGGIILTRFSPLFHGGIASIILLLLASISVLIGT
FT                   GISLVQVDYKRQLVGSTIGQMGFMLIQCALGAYIAAIIHLILHGLFKATLFLQAGSAVG
FT                   RHEVSTRTNERTSYLWVMAGRILSLVIGVAFWLTAPGDGYHLISALILGWSLSVSWDQL
FT                   VAFGEGRIGRIAGLTVLGGAALVYFIIHHLFYKWLHTTIFQSVQPPMSAVMIVVCLLLF
FT                   GSALGTWVARHRSSVFFAVLYLWLVRLGEAKPKSVESHPDYLKQYIS"
FT   gene            206941..209556
FT                   /gene="ybcC"
FT                   /locus_tag="BSU_01845"
FT                   /old_locus_tag="BSU01845"
FT   CDS_pept        206941..209556
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybcC"
FT                   /locus_tag="BSU_01845"
FT                   /old_locus_tag="BSU01845"
FT                   /product="conserved transmembrane protein coupled to
FT                   NADH-ubiquinone oxidoreductase chain 5 homolog; prophage 1
FT                   region"
FT                   /function="18: Unknown function"
FT                   /note="Evidence 3: Putative function from multiple
FT                   computational evidences; Product type f: factor"
FT                   /db_xref="EnsemblGenomes-Gn:BSU01845"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11960"
FT                   /db_xref="InterPro:IPR018752"
FT                   /db_xref="SubtiList:BG12706"
FT                   /db_xref="UniProtKB/Swiss-Prot:O34688"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB11960.2"
FT                   /translation="MGITSVLTKDNVKKIDTDIDVQERDLNVFITSASRVIAPLWPIST
FT                   FAARNPWMGLENQPFDQVASWLKNTRDVDIYPSASMIRSAKNKGEIDEDFVEMGLQRWL
FT                   DSHSYHIPRDVAERFCHAALKLDPLPSDLLSSHELEKLVSECSGLDHIENVFMQPLSSY
FT                   IENQDGERLVNILDHHVIKWSKLYLDDSQAGWTMPNREEGFYRAWQHLIQYDPALSKKQ
FT                   RERVKGWPKEAHLALQEALFALEIPESEIQTYLEGHLLSLPGWAGMMLWRSQQSSHEHA
FT                   LLTEYLAVRISMEWALIKPYLPLTNERSKKTISIAPLIAAWIHWGGLTLEEWSQMTASE
FT                   QNEYLSFAYSFDEKLRKKLWLEAWEQTYTDRLSQKIISKQRETGREKSALAQLAFCIDV
FT                   RSEPFRRQLEKEGPFETIGIAGFFGVPIATCELGSKHSHASLPIIQKPQNKIKEFADED
FT                   VFKKYNQRKQAIHSLSHTFKTMKQNALSSLLLPELSGPWLTLQMAARSFVPRKAGRFIR
FT                   NLREAWLRKPDTKLSLHHDATEAEIPVGFTDEEKVNYARQALKMMGLTENIAPLVVICG
FT                   HGSQSTNNPYSAALDCGACGGAAGGFNARVLAALCNLSEVREALLAEGIKIPEDTVFAA
FT                   AEHNTTVDELHWLYVPELSEAAQEAFEQIEAVMPKVRHHVNAERLAQLPNFQSKLKNPK
FT                   AEANRFAEDWSEIRPEWGLARNAAFIIGKRELTQDCDLEGRAFLHNYDWKQDESGELLA
FT                   NIIVGPGTVAQWINLQYYASTVAPHYYGSGNKATQTVTAGLGVMQGNASDLLAGLPWQS
FT                   VMESDHEAYHSPLRLLILIQAPREYVERLLNHDSAFLQKVQNGWVRLASLDPEGCWESW
FT                   "
FT   gene            209633..210160
FT                   /gene="ybcF"
FT                   /locus_tag="BSU_01860"
FT                   /old_locus_tag="BSU01860"
FT   CDS_pept        209633..210160
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybcF"
FT                   /locus_tag="BSU_01860"
FT                   /old_locus_tag="BSU01860"
FT                   /product="putative enzyme; prophage 1 region"
FT                   /note="Evidence 3: Putative function from multiple
FT                   computational evidences; Product type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU01860"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11962"
FT                   /db_xref="GOA:O34823"
FT                   /db_xref="InterPro:IPR036874"
FT                   /db_xref="SubtiList:BG12708"
FT                   /db_xref="UniProtKB/Swiss-Prot:O34823"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB11962.1"
FT                   /translation="MNVNQNKKVLFLTDIENGLEPILQEATNTSAENMLTIQSYGASIS
FT                   HPYGEIMRSVIFAIYQEDVEEIFVVGTKDKKTSAGNGLTQLETMKDKIQTLDYLFQNCK
FT                   PEFLGGTVDEWLNENSSDTIEKSVDMIRHHPLVPSYVKVRGLFVNHKGGKPSIAEVPDV
FT                   KTGQAMPDHCLS"
FT   gene            210224..210514
FT                   /gene="ybcH"
FT                   /locus_tag="BSU_01870"
FT                   /old_locus_tag="BSU01870"
FT   CDS_pept        210224..210514
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybcH"
FT                   /locus_tag="BSU_01870"
FT                   /old_locus_tag="BSU01870"
FT                   /product="conserved protein of unknown function; prophage 1
FT                   region"
FT                   /note="Evidence 4: Unknown function but conserved in other
FT                   organisms"
FT                   /db_xref="EnsemblGenomes-Gn:BSU01870"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11963"
FT                   /db_xref="SubtiList:BG12709"
FT                   /db_xref="UniProtKB/Swiss-Prot:O34795"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB11963.1"
FT                   /translation="MSANLTDFVTKTIEEMNSFDRENMECIKKLIRKAIDFYHLKSYEE
FT                   VEETHSGNVRFLHVHSMMEENMLSKMIVVTRNGKTDLDIEGVYEGYVVREY"
FT   gene            210572..210946
FT                   /gene="ybcI"
FT                   /locus_tag="BSU_01880"
FT                   /old_locus_tag="BSU01880"
FT   CDS_pept        210572..210946
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybcI"
FT                   /locus_tag="BSU_01880"
FT                   /old_locus_tag="BSU01880"
FT                   /product="conserved hypothetical protein; prophage 1
FT                   region"
FT                   /note="Evidence 4: Unknown function but conserved in other
FT                   organisms"
FT                   /db_xref="EnsemblGenomes-Gn:BSU01880"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11964"
FT                   /db_xref="InterPro:IPR018745"
FT                   /db_xref="SubtiList:BG12710"
FT                   /db_xref="UniProtKB/Swiss-Prot:O34380"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB11964.1"
FT                   /translation="MKKSKGSIESEISKSITQWEKDYLGRGSVSVKTDILRDMIIVNLK
FT                   GILTPAEYVVCGSKEGMLSIKQTRSELVESGIEGLKDIILKITGEKVKSFHTDLSSRTG
FT                   ERVMVFKLCNDLEKNLEKIL"
FT   gene            211429..211731
FT                   /gene="ybzH"
FT                   /locus_tag="BSU_01889"
FT                   /old_locus_tag="BSU01889"
FT   CDS_pept        211429..211731
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybzH"
FT                   /locus_tag="BSU_01889"
FT                   /old_locus_tag="BSU01889"
FT                   /product="putative transcriptional regulator (ArsR family);
FT                   prophage 1 region"
FT                   /function="16.3: Control"
FT                   /note="Evidence 3: Putative function from multiple
FT                   computational evidences; Product type r: regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BSU01889"
FT                   /db_xref="EnsemblGenomes-Tr:CAX52540"
FT                   /db_xref="GOA:C0H3S9"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0H3S9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX52540.1"
FT                   /translation="MEPIEVFKALSNESRLQILQWLKEPDRHFAPHEGIDMNTIGVCVS
FT                   QITDKLKMTQSTASQYLTILLRAGLIKAERIGKYTYYKRDEEAIGKLADFLKTEI"
FT   gene            211859..213031
FT                   /gene="ybcL"
FT                   /locus_tag="BSU_01890"
FT                   /old_locus_tag="BSU01890"
FT   CDS_pept        211859..213031
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybcL"
FT                   /locus_tag="BSU_01890"
FT                   /old_locus_tag="BSU01890"
FT                   /product="putative efflux transporter; prophage 1 region"
FT                   /function="16.1: Circulate"
FT                   /function="16.8: Protect"
FT                   /note="Evidence 3: Putative function from multiple
FT                   computational evidences; PubMedId: 15812018, 15849754,
FT                   16850406; Product type t: transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BSU01890"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11965"
FT                   /db_xref="GOA:O34663"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="SubtiList:BG12711"
FT                   /db_xref="UniProtKB/Swiss-Prot:O34663"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB11965.1"
FT                   /translation="MSNTWKIYILAIVSFLVGTSEYIISGILDQIAHTLGITLAAAGQL
FT                   ITIFSLVYALSTPVLMALTASMDRRKLMMYALGLFVFGNVLAFVLPGYGWFIAARIIMA
FT                   MGAGVVVVTALTIAAKIASEGKQGSAIATVVMGFTASLIIGVPLGRMIAVALGWKSVFG
FT                   AIALLGLIAMVVIFFTLPYTEGDKPVPLLQQLALFKKRKVAMGLSITFFWLGGYSVAYT
FT                   YLSPYLLNISGINGKLLSGVLLIFGIASLVGSKFGGYSTDKWGVPFTLVGGMTLHIVTL
FT                   ILLSLVTHSYIGVLVILILWSFAAWSTGPTQQFHLATIEPEMSGVLLSMNQSMMQFAMA
FT                   VGAGIGGVFVENVSLASITWVGALGVMIAIIASLLIFNSQPKQALKDINQ"
FT   gene            213155..213469
FT                   /gene="ybcM"
FT                   /locus_tag="BSU_01900"
FT                   /old_locus_tag="BSU01900"
FT   CDS_pept        213155..213469
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybcM"
FT                   /locus_tag="BSU_01900"
FT                   /old_locus_tag="BSU01900"
FT                   /product="putative enzyme"
FT                   /function="16.11: Scavenge (Catabolism)"
FT                   /note="Evidence 3: Putative function from multiple
FT                   computational evidences; Product type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU01900"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11983"
FT                   /db_xref="GOA:O31421"
FT                   /db_xref="SubtiList:BG12712"
FT                   /db_xref="UniProtKB/Swiss-Prot:O31421"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB11983.1"
FT                   /translation="MRFLKALPRRAEVQYDCLDRTLETQENVNLNIRVNVKEVATWGVN
FT                   TCIISLKGLDNADDRFVLPEVNTALALFPLSIAADCLLMLPCISVVMSISSVMKSVTVE
FT                   "
FT   gene            213941..214108
FT                   /gene="skfA"
FT                   /locus_tag="BSU_01910"
FT                   /old_locus_tag="BSU01910"
FT   CDS_pept        213941..214108
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="skfA"
FT                   /locus_tag="BSU_01910"
FT                   /old_locus_tag="BSU01910"
FT                   /product="sporulation killing factor A"
FT                   /function="16.11: Scavenge (Catabolism)"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 15812018, 16816204, 17069462,
FT                   17184776, 26284661; Product type f: factor"
FT                   /db_xref="EnsemblGenomes-Gn:BSU01910"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11984"
FT                   /db_xref="GOA:O31422"
FT                   /db_xref="InterPro:IPR030919"
FT                   /db_xref="SubtiList:BG12713"
FT                   /db_xref="UniProtKB/Swiss-Prot:O31422"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:15812018, 16816204, 17069462, 17184776, 26284661"
FT                   /protein_id="CAB11984.1"
FT                   /translation="MKRNQKEWESVSKKGLMKPGGTSIVKAAGCMGCWASKSIAMTRVC
FT                   ALPHPAMRAI"
FT   gene            214175..215407
FT                   /gene="skfB"
FT                   /locus_tag="BSU_01920"
FT                   /old_locus_tag="BSU01920"
FT   CDS_pept        214175..215407
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="skfB"
FT                   /locus_tag="BSU_01920"
FT                   /old_locus_tag="BSU01920"
FT                   /product="synthesis of sporulation killing factor A"
FT                   /function="16.11: Scavenge (Catabolism)"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 15812018, 16816204, 17069462,
FT                   17184776, 18307109, 23282011, 26284661; Product type f:
FT                   factor"
FT                   /db_xref="EnsemblGenomes-Gn:BSU01920"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11985"
FT                   /db_xref="GOA:O31423"
FT                   /db_xref="InterPro:IPR000385"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR023885"
FT                   /db_xref="InterPro:IPR030915"
FT                   /db_xref="PDB:6EFN"
FT                   /db_xref="SubtiList:BG12714"
FT                   /db_xref="UniProtKB/Swiss-Prot:O31423"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:15812018, 16816204, 17069462, 17184776, 18307109,
FT                   23282011, 26284661"
FT                   /protein_id="CAB11985.2"
FT                   /translation="MSYDRVKDFDLPELAVHLQPHGAVMIDRKSMFYFRLSGRGAQLAF
FT                   LLSKNKNLHKTARIWEIMKKEEMSADQLKEELSAHPFTEAWTEGLLDQPLHVSGSLDSY
FT                   LPISCTLQLTNACNLSCSFCYASSGKPYPEELSSEQWILVMQKLAAHGVADITLTGGEA
FT                   KLIKGFKELVVVASSLFTNVNVFSNGLNWRDEEVELLSHLGNVSVQISIDGMDNTHDQL
FT                   RGRKGGFKESMNTIKKLSEANIPVIVAMTINESNADEVSDVVEQCANAGAFIFRAGKTL
FT                   SVGRATEGFKALDIDFEEMVQIQLREARHKWGDRLNIIDWEHEESSFTTDFCTPGYLAW
FT                   YIRADGYVTPCQLEDLPLGHILEDSMADIGSPARLLQLKCEAKNCKCIGKIELSEPDLP
FT                   FQKEVKAGIQE"
FT   gene            215404..216894
FT                   /gene="skfC"
FT                   /locus_tag="BSU_01935"
FT                   /old_locus_tag="BSU01935"
FT   CDS_pept        215404..216894
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="skfC"
FT                   /locus_tag="BSU_01935"
FT                   /old_locus_tag="BSU01935"
FT                   /product="sporulation killing factor biosynthesis and
FT                   export"
FT                   /function="16.11: Scavenge (Catabolism)"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 15812018, 15849754, 16816204,
FT                   16850406, 17069462, 17184776, 26284661; Product type t:
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BSU01935"
FT                   /db_xref="EnsemblGenomes-Tr:CAX52541"
FT                   /db_xref="GOA:O31425"
FT                   /db_xref="InterPro:IPR003675"
FT                   /db_xref="UniProtKB/Swiss-Prot:O31425"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:15812018, 15849754, 16816204, 16850406, 17069462,
FT                   17184776, 26284661"
FT                   /protein_id="CAX52541.1"
FT                   /translation="MNSLSLVFWSILAVVGLLLFIKFKPPTIASLLLSKDEAKEISIQF
FT                   IKEFVGIDVENWDFYSVYWYDHDTVNKLHHLGILKKNRKVLYDVGLVESWRVRFVHQNQ
FT                   SFVVGVNANREITFFYADVPKKTLSGKFEQVSPETLKQRLMASPDGLWSRANMTGTGKK
FT                   EEDFREVSTYWYIAEAGDIRLKVTVELQGGRISYIGTEQEILTDQMSKVIRDEQVESTF
FT                   GVSGMLGSALAMILAILILVFMDVQTSIIFSLVLGLLIIICQSLTLKEDIQLTIVNAYD
FT                   ARMSVKTVSLLGILSTLLTGLLTGFVVFICSLAGNALAGDFGWKTFEQPIVQIFYGIGA
FT                   GLISLGVTSLLFNLLEKKQYLRISPELSNRTVFLSGFTFRQGLNMSIQSSIGEEVIYRL
FT                   LMIPVIWWMSGNILISIIVSSFLWAVMHQVTGYDPRWIRWLHLFIFGCFLGVLFIKFGF
FT                   ICVLVAHFIHNLVLVCMPLWQFKLQKHMHHDQPKHTSL"
FT   gene            216913..217632
FT                   /gene="skfE"
FT                   /locus_tag="BSU_01950"
FT                   /old_locus_tag="BSU01950"
FT   CDS_pept        216913..217632
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="skfE"
FT                   /locus_tag="BSU_01950"
FT                   /old_locus_tag="BSU01950"
FT                   /product="sporulation killing factor biosynthesis and
FT                   export; ABC transporter (binding protein)"
FT                   /function="16.11: Scavenge (Catabolism)"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 26284661; Product type t:
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BSU01950"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11989"
FT                   /db_xref="GOA:O31427"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="SubtiList:BG12718"
FT                   /db_xref="UniProtKB/Swiss-Prot:O31427"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:26284661"
FT                   /protein_id="CAB11989.1"
FT                   /translation="MQLMQVQNLSKCYRNGDGVEHLSFSIQRGEIVALLGPNGAGKTTT
FT                   IRCLTGLYKPDKGDILIEGSPPGDINVQKKVALIPDQPYLYPALTAAEHIQFRARGYHP
FT                   GKKDVKERVYHALKEVHLEEKANQLCGQLSRGQKQRVVLAGAIVQDALLYILDEPTVGL
FT                   DIPSKQWLSNWLKTKTDQGCSAFVSTHSLEFVIETADRVILIRDGKLMQDLYVPQFEEQ
FT                   AEWRKEVIRLLGEWSDE"
FT   gene            217697..219040
FT                   /gene="skfF"
FT                   /locus_tag="BSU_01960"
FT                   /old_locus_tag="BSU01960"
FT   CDS_pept        217697..219040
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="skfF"
FT                   /locus_tag="BSU_01960"
FT                   /old_locus_tag="BSU01960"
FT                   /product="sporulation killing factor biosynthesis and
FT                   export; ABC transporter (permease)"
FT                   /function="16.1: Circulate"
FT                   /function="16.11: Scavenge (Catabolism)"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 15812018, 15849754, 16816204,
FT                   16850406, 17069462, 17184776, 26284661; Product type t:
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BSU01960"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11990"
FT                   /db_xref="GOA:O31428"
FT                   /db_xref="InterPro:IPR030920"
FT                   /db_xref="SubtiList:BG12719"
FT                   /db_xref="UniProtKB/Swiss-Prot:O31428"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:15812018, 15849754, 16816204, 16850406, 17069462,
FT                   17184776, 26284661"
FT                   /protein_id="CAB11990.2"
FT                   /translation="MPFLIMLLFVGAIGFQVSFVSRSTTWDMSIAGWVLTGVFILYTAF
FT                   GLFSNRLPSQMADIIWLYGTATSFSKVVYSVLFFSVTWKALLWIISAIFGDVLIVLLSG
FT                   DHINLLGRSIIFVGLFFIAEVWLMSVSCARTVKKMKRVYVLVFLLMLGIYSICLYRFFF
FT                   LQHSSGIWESIARFISGVGLVFDTLSPLYVVVFIGIITVSFMTIAFTSRQVEMKESLVK
FT                   EAEFWEEFQERQFGSGQIIQKPKTTWWGLQGLNGIWSFLWLELLLFKKYLFFHSIHTVM
FT                   LSGVFYVVIFMYPEWFYLLFFLIVSAVMLSSYYSGIVRHSQSGTLHLFPGALWKKIIIL
FT                   ELTNTVWLYILYCVSITFMAVGNLVYWYIYGLGIYIWFMTIRLFAFTHTNRNDIKLSLP
FT                   QYYKSFFMALGLSGICLYVIHLLTADWYTLVVVVCIGSLSWCLFYRFR"
FT   gene            219087..219602
FT                   /gene="skfG"
FT                   /locus_tag="BSU_01970"
FT                   /old_locus_tag="BSU01970"
FT   CDS_pept        219087..219602
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="skfG"
FT                   /locus_tag="BSU_01970"
FT                   /old_locus_tag="BSU01970"
FT                   /product="sporulation killing factor biosynthesis and
FT                   export"
FT                   /function="16.11: Scavenge (Catabolism)"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 15812018, 16816204, 17069462,
FT                   17184776, 26284661; Product type ph : phenotype"
FT                   /db_xref="EnsemblGenomes-Gn:BSU01970"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11991"
FT                   /db_xref="GOA:O31429"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="SubtiList:BG12720"
FT                   /db_xref="UniProtKB/Swiss-Prot:O31429"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:15812018, 16816204, 17069462, 17184776, 26284661"
FT                   /protein_id="CAB11991.2"
FT                   /translation="MNSNGDKLSLSVQNLANTNEITIVQAIGELKKSGKDAIPVLVEAL
FT                   KEEGSLCNIAAAVLGEFGEDASEAAEELSCLLKSHAEDTRMAAAISLMRIGKPSLPFVI
FT                   KIAQESEGQSCFWASWCIAWIDPSCIEPKMYKCLKYEHEHPSGIVAPFAAEEALGKLIA
FT                   FQLKDKED"
FT   gene            219607..220032
FT                   /gene="skfH"
FT                   /locus_tag="BSU_01980"
FT                   /old_locus_tag="BSU01980"
FT   CDS_pept        219607..220032
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="skfH"
FT                   /locus_tag="BSU_01980"
FT                   /old_locus_tag="BSU01980"
FT                   /product="sibling killing effect; sporulation killing
FT                   factor biosynthesis and export"
FT                   /function="16.11: Scavenge (Catabolism)"
FT                   /function="16.8: Protect"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 15812018, 16816204, 17069462,
FT                   17184776, 26284661; Product type ph : phenotype"
FT                   /db_xref="EnsemblGenomes-Gn:BSU01980"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11992"
FT                   /db_xref="GOA:O31430"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="SubtiList:BG12721"
FT                   /db_xref="UniProtKB/Swiss-Prot:O31430"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:15812018, 16816204, 17069462, 17184776, 26284661"
FT                   /protein_id="CAB11992.2"
FT                   /translation="MKDEQMLTEWPSHLPWLNQSQNDFTFPSDTYLLLYFWSMSCPNCH
FT                   QLTDKVLQDIKDMNVKVIGVHVPYIEEEKSMEVVLTYALDRGLAIPIVLDQNYEIVTTC
FT                   HVQGIPSFCLLSQYGQIITKTMGDVGWDKMLKKIAGL"
FT   gene            220279..221256
FT                   /gene="ybdG"
FT                   /locus_tag="BSU_01990"
FT                   /old_locus_tag="BSU01990"
FT   CDS_pept        220279..221256
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybdG"
FT                   /locus_tag="BSU_01990"
FT                   /old_locus_tag="BSU01990"
FT                   /product="putative hydrolase/transferase"
FT                   /note="Evidence 3: Putative function from multiple
FT                   computational evidences; Product type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU01990"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11993"
FT                   /db_xref="GOA:O31431"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="SubtiList:BG12722"
FT                   /db_xref="UniProtKB/Swiss-Prot:O31431"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB11993.2"
FT                   /translation="MKTLWKVLKIVFVSLAALVLLVSVSVFIYHHFQLNKEAALLKGKG
FT                   TVVDVDGKKMNVYQEGSGKDTFVFMSGSGIAAPAYEMKGLYSKFSKENKIAVVDRAGYG
FT                   YSEVSHDDRDIDTVLEQTRKALMKSGNKPPYILMPHSISGIEAMYWAQKYPKEIKAIIA
FT                   MDIGLPQQYVTYKLSGVDRLKVRGFHLLTSIGFHRFIPSAVYNPEVIRQSFLTDEEKEI
FT                   YKAINFKQFFNADMEHELLQSYQNGSKSVNLPAPKETPVLILDAVSDQNRHSKYAIQNR
FT                   KDYEAFAAQFNTADIKELRGTHSIYLYQPDQIYKLSMEFMRKVR"
FT   gene            221258..221929
FT                   /gene="ybdJ"
FT                   /locus_tag="BSU_02000"
FT                   /old_locus_tag="BSU02000"
FT   CDS_pept        221258..221929
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybdJ"
FT                   /locus_tag="BSU_02000"
FT                   /old_locus_tag="BSU02000"
FT                   /product="two-component system response regulator [YbdK]"
FT                   /function="16.3: Control"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 11717295, 20035725; Product
FT                   type r: regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BSU02000"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11994"
FT                   /db_xref="GOA:O31432"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="SubtiList:BG12723"
FT                   /db_xref="UniProtKB/Swiss-Prot:O31432"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:11717295, 20035725"
FT                   /protein_id="CAB11994.1"
FT                   /translation="MKGYRILIVEDDVMIGDLLQKILQREGYRVIWKTDGADVLSVIQK
FT                   VDLVIMDVMLPGEDGYQMSAKIKKLGLGIPVIFLSARNDMDSKLQGLQIGEDYMVKPFD
FT                   PRELLLRMRNMLEHHYGTFTQIKHLYIDAVTKKVFNESLHDEVLFTAIERKIFFYLYEN
FT                   RDSILTKEHFFEYLWQLEDRNPNIVNVHIKKIRAKINDQAGEMIENIYGEGYRLNTVVK
FT                   K"
FT   gene            221950..222912
FT                   /gene="ybdK"
FT                   /locus_tag="BSU_02010"
FT                   /old_locus_tag="BSU02010"
FT   CDS_pept        221950..222912
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybdK"
FT                   /locus_tag="BSU_02010"
FT                   /old_locus_tag="BSU02010"
FT                   /product="two-component system sensor histidine kinase
FT                   [YbdJ]"
FT                   /function="16.12: Sense"
FT                   /function="16.3: Control"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 11717295, 20035725; Product
FT                   type rc: receptor"
FT                   /db_xref="EnsemblGenomes-Gn:BSU02010"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11995"
FT                   /db_xref="GOA:O31433"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="SubtiList:BG12724"
FT                   /db_xref="UniProtKB/Swiss-Prot:O31433"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:11717295, 20035725"
FT                   /protein_id="CAB11995.1"
FT                   /translation="MLLFTAVISVPMLLLAVSVLMSVIYDSMFKPMNHGMPFHRSFAYP
FT                   AMIVVFLISLLLLAFLFSKSIHSLLHKINLLNQTIRHLASDQRVPDKIEVKRADEIGEL
FT                   IKSVNLLIERTTYRELELRQQEEIKKELLQKLRHDINTPLTALRLQLFYLEDQCHGQAV
FT                   FESLYQQIEYISELTNEFNLYSAETLESSYIVNEEVRLNELLETAVKKWDYLYSMSGIE
FT                   LHYKPADQDVIWMSNTLWMERLFDNIFQNTLRHSKAKKMEVTIEHGDVFIRDDGIGFDR
FT                   NESSEGLGLKIIEDTCRLLAITYELHTNDNGTGFLFSKE"
FT   gene            222971..223234
FT                   /gene="ybzI"
FT                   /locus_tag="BSU_02019"
FT                   /old_locus_tag="BSU02019"
FT   CDS_pept        222971..223234
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybzI"
FT                   /locus_tag="BSU_02019"
FT                   /old_locus_tag="BSU02019"
FT                   /product="conserved protein of unknown function"
FT                   /note="Evidence 4: Unknown function but conserved in other
FT                   organisms"
FT                   /db_xref="EnsemblGenomes-Gn:BSU02019"
FT                   /db_xref="EnsemblGenomes-Tr:CAX52542"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0H3T1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX52542.1"
FT                   /translation="MNIICLKKSSKRLSTSQAVLVTDIADTGITAAAGADIIAATAAVR
FT                   AKEDTTTVMAAVIVTNAGATAAVNPKKVLVPLLGQGFFYVTD"
FT   gene            complement(223219..223989)
FT                   /gene="ybdM"
FT                   /locus_tag="BSU_02030"
FT                   /old_locus_tag="BSU02030"
FT   CDS_pept        complement(223219..223989)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybdM"
FT                   /locus_tag="BSU_02030"
FT                   /old_locus_tag="BSU02030"
FT                   /product="putative protein kinase"
FT                   /function="16.3: Control"
FT                   /EC_number="2.7.11.-"
FT                   /note="Evidence 3: Putative function from multiple
FT                   computational evidences; PubMedId: 21304896; Product type
FT                   e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU02030"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11997"
FT                   /db_xref="GOA:O31435"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="SubtiList:BG12726"
FT                   /db_xref="UniProtKB/Swiss-Prot:O31435"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB11997.1"
FT                   /translation="MALKLLKKLLFDRPLKNGVILNHQYKIEECLGMGGYGLVYLCTDI
FT                   LAQTPYVLKQLRPTKAKKEKEKVRFQQEIKLLKNIHHPQIPGFIDEFIIDGQAYYVMQF
FT                   IEGENIEELLFFRKQPFTELMALQLISQLLEIIEYLHDRLIFHSDIRTPNIIINDGRLC
FT                   LIDFGLAKQLTPEEMEEIKVRKQDDFFDLGETLLFLLYSQYKGKKKKNGTWLEELTLTK
FT                   EVTLLLKRLLGIEEEYQHTASIREDLNRAIQSVT"
FT   gene            complement(224075..224932)
FT                   /gene="ybdN"
FT                   /locus_tag="BSU_02040"
FT                   /old_locus_tag="BSU02040"
FT   CDS_pept        complement(224075..224932)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybdN"
FT                   /locus_tag="BSU_02040"
FT                   /old_locus_tag="BSU02040"
FT                   /product="putative phage protein; prophage region 1"
FT                   /function="16.5: Explore"
FT                   /function="16.13: Shape"
FT                   /note="Evidence 3: Putative function from multiple
FT                   computational evidences; PubMedId: 16794953; Product type
FT                   h: extrachromosomal origin"
FT                   /db_xref="EnsemblGenomes-Gn:BSU02040"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11998"
FT                   /db_xref="SubtiList:BG12727"
FT                   /db_xref="UniProtKB/Swiss-Prot:O31436"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB11998.1"
FT                   /translation="MVKKWLIQFAVMLSVLSTFTYSASAVGVTAITGNNSFDTAMPIGY
FT                   WKYKNIDTTILEAGQDEAYFTFTANKGEKVYMRSTYQSAYTGMKIEIYDKNRIPVSQGT
FT                   EVINPNTFSSFIYANADAQNTTDTFYVKVSRGTYTGNMYFTLSIEDRIKSGSGTFQFSG
FT                   VAENKGNTSLSPSGSDSSVIKVDLTNQSGIPRDAIVTRVQTTATQTPSQGNTRHLIMTS
FT                   ENNEWSRALVNSSTSGSYDISLSDQLSVAKVWSFKYNTLATARSTMSNVKAKIDYEYDV
FT                   TKQF"
FT   gene            225064..226248
FT                   /gene="ybdO"
FT                   /locus_tag="BSU_02050"
FT                   /old_locus_tag="BSU02050"
FT   CDS_pept        225064..226248
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybdO"
FT                   /locus_tag="BSU_02050"
FT                   /old_locus_tag="BSU02050"
FT                   /product="putative phage protein; prophage region 1"
FT                   /function="16.5: Explore"
FT                   /note="Evidence 3: Putative function from multiple
FT                   computational evidences; PubMedId: 15033535; Product type
FT                   h: extrachromosomal origin"
FT                   /db_xref="EnsemblGenomes-Gn:BSU02050"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11999"
FT                   /db_xref="InterPro:IPR032617"
FT                   /db_xref="SubtiList:BG12728"
FT                   /db_xref="UniProtKB/Swiss-Prot:O31437"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB11999.1"
FT                   /translation="MRLNRQFIRTQLIAQNILSKNAPAKRENATENPAAVLEKAYSRLK
FT                   SQSSTGGINQFNYSKTSVSGNSGTFSKVYQSANDRTVTDTGEETVIQSQNPYESESDIR
FT                   IKILDEKYSRMNAINKTKSDPLGYIKDKYQNSKSPYFRSDLSAAERQAAYDNETEWLFK
FT                   GKAQNYNLQDAVFRNVTFHGEVEAENEKVYQRGQVNQQLQVLLNRNHIHIPEGTELTFT
FT                   ITPIDYQVRVSGTDDQDLIKQIEQVLQSGDNSKELFLHIMKSQSSDSAQFSEEAYKKYQ
FT                   AAREMYEVTGYHLKDLEVIDGRYVTPEGRDLMDVYKEELEKDPVQKQTASYAISYYRSE
FT                   LSKIAEAGYNAIPDFILSIDYSNGSLRDVGQSKSYGTGDTGWLEALKRQTGVNY"
FT   gene            226566..227954
FT                   /gene="ybxG"
FT                   /locus_tag="BSU_02060"
FT                   /old_locus_tag="BSU02060"
FT   CDS_pept        226566..227954
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybxG"
FT                   /locus_tag="BSU_02060"
FT                   /old_locus_tag="BSU02060"
FT                   /product="putative amino acid permease"
FT                   /function="16.1: Circulate"
FT                   /note="Evidence 3: Putative function from multiple
FT                   computational evidences; PubMedId: 15849754, 16850406;
FT                   Product type t: transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BSU02060"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12000"
FT                   /db_xref="GOA:P54425"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004840"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="SubtiList:BG11505"
FT                   /db_xref="UniProtKB/Swiss-Prot:P54425"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB12000.1"
FT                   /translation="MANKELKRGLGARHIQMIALGGTIGVGLFMGSASTISWTGPSVLL
FT                   AYAICGIFIFFIMRAMGEMLYVEPSTGSFATFGHQYIHPMAGYITAWSNWFQWIIVGMS
FT                   EIIAVGSYTKYWFPDLPAWIPGIVAMVILGAANLISVKSFGEFEFWFAMIKIVTIILMI
FT                   IAGIGIIFFGFGNGGDAIGLSNLWSHGGFFAGGFSGFFFALSLVIAAYQGVELIGITAG
FT                   EAKDPQNTLRNAIQSIIWRILIFYIGAIFVIVTVYPWDELNSLGSPFVSTFSKIGITAA
FT                   AGIINFVVITAAMSGCNSGIFSAGRMLYTLGVNGQAPKFFKKISRNGVPLYGTIAVLIG
FT                   LAVGVVLNYIAPPKIFVYVYSASVLPGMIPWFIILISHIGFRKAKGAALDKHPFKMPFA
FT                   PFTNYLTIAFLLMVLVGMWFNDDTRISLIVGVIFLALVVISYYVFGIGKRTQANLTKSE
FT                   QAAE"
FT   gene            228066..228314
FT                   /gene="csgA"
FT                   /locus_tag="BSU_02070"
FT                   /old_locus_tag="BSU02070"
FT   CDS_pept        228066..228314
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="csgA"
FT                   /locus_tag="BSU_02070"
FT                   /old_locus_tag="BSU02070"
FT                   /product="sporulation-specific SASP protein"
FT                   /function="16.5: Explore"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 9016963; Product type cp:
FT                   cell process"
FT                   /db_xref="EnsemblGenomes-Gn:BSU02070"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12001"
FT                   /db_xref="GOA:P54379"
FT                   /db_xref="InterPro:IPR020255"
FT                   /db_xref="SubtiList:BG11504"
FT                   /db_xref="UniProtKB/Swiss-Prot:P54379"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:9016963"
FT                   /protein_id="CAB12001.1"
FT                   /translation="MDVTLGYLRESLSNHLENEVCQRICKKMLAKRYANEEEFVKDLDD
FT                   NEMSFLNHVLEKEIKYAQNEQDQKRAKELNEVYELLL"
FT   gene            228331..228522
FT                   /gene="ybxH"
FT                   /locus_tag="BSU_02080"
FT                   /old_locus_tag="BSU02080"
FT   CDS_pept        228331..228522
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybxH"
FT                   /locus_tag="BSU_02080"
FT                   /old_locus_tag="BSU02080"
FT                   /product="conserved protein of unknown function"
FT                   /note="Evidence 4: Unknown function but conserved in other
FT                   organisms"
FT                   /db_xref="EnsemblGenomes-Gn:BSU02080"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12002"
FT                   /db_xref="InterPro:IPR035314"
FT                   /db_xref="SubtiList:BG11506"
FT                   /db_xref="UniProtKB/Swiss-Prot:P54426"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB12002.1"
FT                   /translation="MGAIERSGYTFQPEFSVVRQNGAIHVYHQGEFVEEIEFEFNGEYP
FT                   DHDLIEELVNHYCFEHEI"
FT   gene            complement(228549..229352)
FT                   /gene="ybxI"
FT                   /locus_tag="BSU_02090"
FT                   /old_locus_tag="BSU02090"
FT   CDS_pept        complement(228549..229352)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybxI"
FT                   /locus_tag="BSU_02090"
FT                   /old_locus_tag="BSU02090"
FT                   /product="exported beta-lactamase"
FT                   /function="16.11: Scavenge (Catabolism)"
FT                   /EC_number="3.5.2.6"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 14742199; Product type e:
FT                   enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU02090"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12003"
FT                   /db_xref="GOA:P54427"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR002137"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="PDB:5E2F"
FT                   /db_xref="SubtiList:BG11507"
FT                   /db_xref="UniProtKB/Swiss-Prot:P54427"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:14742199"
FT                   /protein_id="CAB12003.1"
FT                   /translation="MKKWIYVVLVLSIAGIGGFSVHAASSAHEKHLNVSKMNVDDEFKD
FT                   TDGTFILHDLQKDQTFVYNRKRANQRQTPQSTFKVVNALIGLQVKAVRDEYDVKRWDGV
FT                   KREFESWNRDHTLGSAMRESAIWYYQALARDIGEERMKTWLHTLSYGNEDISGGIDQFW
FT                   LQSSLTISPLEQETFLEKLAKEELPFDKPVMKIVKRMMIQEEGDHYTLYGKTGTRLTDM
FT                   GLGWFVGFIKTEHGSYVFVTNVDDSGTKAKNITVDILKKYGLITS"
FT   gene            229525..230778
FT                   /gene="cypC"
FT                   /locus_tag="BSU_02100"
FT                   /old_locus_tag="BSU02100"
FT   CDS_pept        229525..230778
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cypC"
FT                   /locus_tag="BSU_02100"
FT                   /old_locus_tag="BSU02100"
FT                   /product="fatty acid beta-hydroxylating cytochrome P450"
FT                   /function="16.8: Protect"
FT                   /function="16.6: Maintain"
FT                   /function="16.11: Scavenge (Catabolism)"
FT                   /EC_number="1.11.2.4"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 10529095, 12519760, 21673922;
FT                   Product type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU02100"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12004"
FT                   /db_xref="GOA:O31440"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002401"
FT                   /db_xref="InterPro:IPR036396"
FT                   /db_xref="PDB:1IZO"
FT                   /db_xref="PDB:2ZQJ"
FT                   /db_xref="PDB:2ZQX"
FT                   /db_xref="SubtiList:BG12729"
FT                   /db_xref="UniProtKB/Swiss-Prot:O31440"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:10529095, 12519760, 21673922"
FT                   /protein_id="CAB12004.1"
FT                   /translation="MNEQIPHDKSLDNSLTLLKEGYLFIKNRTERYNSDLFQARLLGKN
FT                   FICMTGAEAAKVFYDTDRFQRQNALPKRVQKSLFGVNAIQGMDGSAHIHRKMLFLSLMT
FT                   PPHQKRLAELMTEEWKAAVTRWEKADEVVLFEEAKEILCRVACYWAGVPLKETEVKERA
FT                   DDFIDMVDAFGAVGPRHWKGRRARPRAEEWIEVMIEDARAGLLKTTSGTALHEMAFHTQ
FT                   EDGSQLDSRMAAIELINVLRPIVAISYFLVFSALALHEHPKYKEWLRSGNSREREMFVQ
FT                   EVRRYYPFGPFLGALVKKDFVWNNCEFKKGTSVLLDLYGTNHDPRLWDHPDEFRPERFA
FT                   EREENLFDMIPQGGGHAEKGHRCPGEGITIEVMKASLDFLVHQIEYDVPEQSLHYSLAR
FT                   MPSLPESGFVMSGIRRKS"
FT   gene            complement(230819..231079)
FT                   /gene="ybyB"
FT                   /locus_tag="BSU_02110"
FT                   /old_locus_tag="BSU02110"
FT   CDS_pept        complement(230819..231079)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybyB"
FT                   /locus_tag="BSU_02110"
FT                   /old_locus_tag="BSU02110"
FT                   /product="conserved protein of unknown function"
FT                   /note="Evidence 4: Unknown function but conserved in other
FT                   organisms"
FT                   /db_xref="EnsemblGenomes-Gn:BSU02110"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12005"
FT                   /db_xref="SubtiList:BG12754"
FT                   /db_xref="UniProtKB/Swiss-Prot:O31441"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB12005.1"
FT                   /translation="MKQKLLLSGLAVSTVGITSYLLKDPSNRQKAREFIHSMKMKITKQ
FT                   PDMETFPVDKAGHPDPQDIEDNKMVSEGSMYPVQYYDEKKK"
FT   gene            231348..232967
FT                   /gene="ybeC"
FT                   /locus_tag="BSU_02120"
FT                   /old_locus_tag="BSU02120"
FT   CDS_pept        231348..232967
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybeC"
FT                   /locus_tag="BSU_02120"
FT                   /old_locus_tag="BSU02120"
FT                   /product="putative H+/amino acid transporter"
FT                   /function="16.1: Circulate"
FT                   /note="Evidence 3: Putative function from multiple
FT                   computational evidences; PubMedId: 15849754, 16850406;
FT                   Product type t: transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BSU02120"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12006"
FT                   /db_xref="GOA:Q45577"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="SubtiList:BG12730"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q45577"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB12006.2"
FT                   /translation="MNQLHRRMGTFSLMMVGLGSMIGSGWLFGAWRAAQIAGPAAIISW
FT                   VIGMVVILFIALSYSELGSMFPEAGGMVKYTQYSHGSFIGFIAGWANWIAIVSVIPVEA
FT                   VASVQYMSSWPWEWAKWTSGLVKNGTLTGEGLAFASVLLLIYFLLNYWTVNLFSKANSL
FT                   ITIFKIIIPGLTIGALLFVGFHGENFTGGQSIAPNGWASVLTAVATSGIVFAFNGFQSP
FT                   INMAGEAKNPGKSIPIAVVGSLFVATVIYVLLQIAFIGAVNPSDIAHGWSHLNFNSPFA
FT                   DLAIALNINWLVIVLYADAFVSPSGTGITYTATTSRMIYGMEKNKYMPSIFGKLHPIYG
FT                   VPRQAMFFNLIVSFIFLFLFRGWGVLAEIISVATLISYITGPITVMTLRRTGKDLYRPL
FT                   RLKGLNVIAPLGFIFASLVLYWARWPLTGQVLFIILIGLPIYFYYQAKAKWKGFGRNFK
FT                   AGVWMVFYLLAMMVISYLGSDKFGGLNVIHYGWDMVLIAMVSLVFYVWALKSGYQTEYL
FT                   KDAKEINSQLLNGQSEAAAGKE"
FT   gene            complement(233014..233895)
FT                   /gene="glpQA"
FT                   /locus_tag="BSU_02130"
FT                   /old_locus_tag="BSU02130"
FT   CDS_pept        complement(233014..233895)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glpQA"
FT                   /locus_tag="BSU_02130"
FT                   /old_locus_tag="BSU02130"
FT                   /product="secreted glycerophosphoryl diester
FT                   phosphodiesterase"
FT                   /function="16.11: Scavenge (Catabolism)"
FT                   /EC_number="3.1.4.46"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 10913081, 21966272; Product
FT                   type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU02130"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12007"
FT                   /db_xref="GOA:P37965"
FT                   /db_xref="InterPro:IPR017946"
FT                   /db_xref="InterPro:IPR030395"
FT                   /db_xref="PDB:5T91"
FT                   /db_xref="PDB:5T9B"
FT                   /db_xref="PDB:5T9C"
FT                   /db_xref="SubtiList:BG10646"
FT                   /db_xref="UniProtKB/Swiss-Prot:P37965"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:10913081, 21966272"
FT                   /protein_id="CAB12007.1"
FT                   /translation="MRKNRILALFVLSLGLLSFMVTPVSAASKGNLLSPDRILTVAHRG
FT                   ASGYVPEHTILSYETAQKMKADFIELDLQMTKDGKLIVMHDEKLDRTTNGMGWVKDHTL
FT                   ADIKKLDAGSWFNEAYPEKAKPQYVGLKVPTLEEVLDRFGKHANYYIETKSPDTYPGME
FT                   EKLIASLQKHKLLGKHSKPGQVIIQSFSKESLVKVHQLQPNLPTVQLLEAKQMASMTDA
FT                   ALEEIKTYAVGAGPDYKALNQENVRMIRSHGLLLHPYTVNNEADMHRLLDWGVTGVFTN
FT                   YPDLFHKVKKGY"
FT   gene            complement(233994..235328)
FT                   /gene="glpT"
FT                   /locus_tag="BSU_02140"
FT                   /old_locus_tag="BSU02140"
FT   CDS_pept        complement(233994..235328)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glpT"
FT                   /locus_tag="BSU_02140"
FT                   /old_locus_tag="BSU02140"
FT                   /product="sn-glycerol-3-phosphate permease"
FT                   /function="16.1: Circulate"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 8012593, 11929549, 15849754,
FT                   16850406; Product type t: transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BSU02140"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12008"
FT                   /db_xref="GOA:P37948"
FT                   /db_xref="InterPro:IPR000849"
FT                   /db_xref="InterPro:IPR005267"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR021159"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="SubtiList:BG10645"
FT                   /db_xref="UniProtKB/Swiss-Prot:P37948"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:8012593, 11929549, 15849754, 16850406"
FT                   /protein_id="CAB12008.1"
FT                   /translation="MLNIFKPAPHIERLDDSKMDAAYKRLRLQVFIGIFIGYAGYYLLR
FT                   KNFAFAIPYLQEQGFSKTELGLVLAAVSIAYGFSKFIMGMVSDRCNPRYFLATGLFLSA
FT                   IVNILFVSMPWVTSSVTIMFIFMFINGWFQGMGWPPCGRTMAHWFSISERGTKMSIWNV
FT                   AHNIGGGILAPLVTLGIAMFVTWKSVFFFPAIIAIIISFLIVLLVRDTPQSCGLPPIEE
FT                   YRNDYPKHAFKNQEKELTTKEILFQYVLNNKFLWYIAFANVFVYFVRYGVVDWAPTYLT
FT                   EAKGFSPEDSRWSYFLYEYAGIPGTILCGWISDRFFKSRRAPAGVLFMAGVFIAVLVYW
FT                   LNPAGNPLVDNIALISIGFLIYGPVMLIGLQAIDLAPKKAAGTAAGLTGFFGYIGGSAF
FT                   ANAIMGFVVDRFNWNGGFIMLISSCILAIVFLALTWNTGKRAEHV"
FT   gene            235625..235873
FT                   /gene="ybeF"
FT                   /locus_tag="BSU_02150"
FT                   /old_locus_tag="BSU02150"
FT   CDS_pept        235625..235873
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybeF"
FT                   /locus_tag="BSU_02150"
FT                   /old_locus_tag="BSU02150"
FT                   /product="conserved protein of unknown function"
FT                   /note="Evidence 4: Unknown function but conserved in other
FT                   organisms"
FT                   /db_xref="EnsemblGenomes-Gn:BSU02150"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12009"
FT                   /db_xref="GOA:O31442"
FT                   /db_xref="InterPro:IPR020258"
FT                   /db_xref="SubtiList:BG12731"
FT                   /db_xref="UniProtKB/Swiss-Prot:O31442"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB12009.1"
FT                   /translation="MDELDIAFFILPLGIMLLSIVGTCICKNPYLMPMLSLVISLVLTF
FT                   TIFNQSFLGWAVVYSLVSLALSYITLIVVRKRKESGN"
FT   gene            235965..236882
FT                   /gene="ybfA"
FT                   /locus_tag="BSU_02160"
FT                   /old_locus_tag="BSU02160"
FT   CDS_pept        235965..236882
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybfA"
FT                   /locus_tag="BSU_02160"
FT                   /old_locus_tag="BSU02160"
FT                   /product="putative transcriptional regulator with
FT                   acetyltransferase domain"
FT                   /note="Evidence 3: Putative function from multiple
FT                   computational evidences; Product type r: regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BSU02160"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12010"
FT                   /db_xref="GOA:O31443"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="SubtiList:BG12732"
FT                   /db_xref="UniProtKB/Swiss-Prot:O31443"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB12010.1"
FT                   /translation="MKTRESSVGLKFRKFNRFYTNVLGFLNEHIYDSPFSLTETRILFE
FT                   IYNTPNCTAKALQDKLGLDRGYVSRIVKQFEKEDLIYKQRSKDDARHHYIFVTETGKTI
FT                   YKKLEEKANEQVELMLKVINQKEQHKLAEAMAEIEAILSQSLSARASEISIRDYFLSED
FT                   LQLLIEKQRQFYAEAHGWDDTFLAYLQETFDADIEKIWIAESGGKFAGSVGLVKHDEKT
FT                   VQLRWFLVDADFRGRGLGTQLLEHLVAYCQDMKFDRIFLWTVSTMAEARPLYKKFGFRI
FT                   SEVKQEAPLWGQQLTEERWDLELS"
FT   gene            236879..238129
FT                   /gene="ybfB"
FT                   /locus_tag="BSU_02170"
FT                   /old_locus_tag="BSU02170"
FT   CDS_pept        236879..238129
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybfB"
FT                   /locus_tag="BSU_02170"
FT                   /old_locus_tag="BSU02170"
FT                   /product="putative carboxylate transporter"
FT                   /function="16.1: Circulate"
FT                   /note="Evidence 3: Putative function from multiple
FT                   computational evidences; PubMedId: 15849754, 16850406;
FT                   Product type t: transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BSU02170"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12011"
FT                   /db_xref="GOA:O31444"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="SubtiList:BG12733"
FT                   /db_xref="UniProtKB/Swiss-Prot:O31444"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB12011.1"
FT                   /translation="MKRLHYAWIIVSVTFLILLAVQGVRLSFGAFVEPWERQFSIDRST
FT                   ISLISTVSFIVYGISQPVIGRLVDKWGARAVLAWSALLTGVSIFLTYLVTSPWQLFLLY
FT                   GLGVSLGVGGASNVAASVLVVNWFSKKRGLAFGIMEAGFGAGQMLLVPGSLMLIHWFSW
FT                   KLTVVVLGLLLIVIVFPAALLMLRNNPSEKNTEPIGGLAASEKETAPKTTALSVAGMFR
FT                   MRQFWFLIFPFLICGFTTVGLMDTHLIPFSHDHGFSTTVTSAAVSLLAGFNIAGILLSG
FT                   IVADRWSSRKILCILYAVRALSIVILIYSHEPYLLLAFAILFGLVDFATVAPTQMLATQ
FT                   YFQNYSIGLMIGWLSLAHQIGSALGAYVPGVIYTVTGEYTLAFYLSIGMLVLASVMNVM
FT                   LREPAAVTRDSAAVVDK"
FT   gene            complement(238164..238448)
FT                   /pseudo
FT                   /gene="ybfEc"
FT                   /locus_tag="BSU_02180"
FT                   /old_locus_tag="BSU02180"
FT   CDS_pept        complement(238164..238448)
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybfEc"
FT                   /locus_tag="BSU_02180"
FT                   /old_locus_tag="BSU02180"
FT                   /product="conserved protein of unknown function (C-terminal
FT                   end)"
FT                   /note="Evidence 4: Unknown function but conserved in other
FT                   organisms"
FT                   /db_xref="PSEUDO:CAB12012.2"
FT                   /db_xref="EnsemblGenomes-Gn:BSU02180"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12012"
FT                   /db_xref="GOA:O31445"
FT                   /db_xref="SubtiList:BG12734"
FT                   /db_xref="UniProtKB/Swiss-Prot:O31445"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT   gene            complement(238354..238476)
FT                   /pseudo
FT                   /gene="ybfEn"
FT                   /locus_tag="BSU_02181"
FT                   /old_locus_tag="BSU02181"
FT   CDS_pept        complement(238354..238476)
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybfEn"
FT                   /locus_tag="BSU_02181"
FT                   /old_locus_tag="BSU02181"
FT                   /product="conserved protein of unknown function YbfE
FT                   (N-terminal fragment)"
FT                   /note="Evidence 4: Unknown function but conserved in other
FT                   organisms"
FT                   /db_xref="PSEUDO:SOX90538.1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT   gene            complement(238644..239555)
FT                   /gene="ybfF"
FT                   /locus_tag="BSU_02190"
FT                   /old_locus_tag="BSU02190"
FT   CDS_pept        complement(238644..239555)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybfF"
FT                   /locus_tag="BSU_02190"
FT                   /old_locus_tag="BSU02190"
FT                   /product="conserved protein of unknown function"
FT                   /note="Evidence 4: Unknown function but conserved in other
FT                   organisms"
FT                   /db_xref="EnsemblGenomes-Gn:BSU02190"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12013"
FT                   /db_xref="GOA:O31446"
FT                   /db_xref="SubtiList:BG12735"
FT                   /db_xref="UniProtKB/Swiss-Prot:O31446"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB12013.1"
FT                   /translation="MKNDQIVFEKTKNIAHDINQMQNQQEIIDYLFRQDSLTLNQLKHY
FT                   YSEPSLPLQFLVKVAVLCMFISMTLASFLFIQAKEVFTNTILSDISPAVFSIFTVICIF
FT                   MTYTKIIKKGNKNKGKASLNQRSEFYEKNKLINTILYKKYKMDQQNIQANKHTASDNED
FT                   SMNFSAVLNHVLTISKNDKELLGYLDTRDNAMLSQLKAYFSTRPFSLPHYMSLMFCGSI
FT                   IVVYATSLFSGQINYIDIPHIFIFLLLIIFLKILIDLIKLLNISRKGQLHTVLHFAQRA
FT                   EYLRMRGVIDFILTERYNKKIM"
FT   gene            complement(239644..241842)
FT                   /gene="ybfG"
FT                   /locus_tag="BSU_02200"
FT                   /old_locus_tag="BSU02200"
FT   CDS_pept        complement(239644..241842)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybfG"
FT                   /locus_tag="BSU_02200"
FT                   /old_locus_tag="BSU02200"
FT                   /product="putative pepdidoglycan binding protein"
FT                   /note="Evidence 3: Putative function from multiple
FT                   computational evidences; Product type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU02200"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12014"
FT                   /db_xref="GOA:O31447"
FT                   /db_xref="InterPro:IPR002477"
FT                   /db_xref="InterPro:IPR015020"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR036365"
FT                   /db_xref="InterPro:IPR036366"
FT                   /db_xref="SubtiList:BG12736"
FT                   /db_xref="UniProtKB/Swiss-Prot:O31447"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB12014.1"
FT                   /translation="MVDEMVLITQQWLNDTYSGKHGYNPVEESGKTGWDTIYGLTRALQ
FT                   IELGISEPADNFGPTTQRLFKPLKRQAPDSKPSNMNFILQGALWCKGFNPGGFTGVFYE
FT                   KTENAVKEFQKAAGLTTQDGIVTTLIMKALLDMSAFKLVSGGDSRIRQIQQNLNRDYND
FT                   YIGLMPCDGLYGRDTNKALIYALQKEEGMSTSVANGFFGNGTTSLCPTLTPGDSRTGFV
FT                   LIVQYALYCNGKSFDPGEFDGKYGVGVVSAVKAFQEFMCLPQTGYADMPTIKALLSSSG
FT                   DTTRTASACDTATIITAEKAQTLRNNGYKTVGRYLTGNVRTSSGLTSKALTSKELAVIL
FT                   DAGLKVFPIYQDGGYESSYFVKDQGTRDAYSAASAARRLGFPSGTTIYFAVDFDAYDYE
FT                   VTDKIIPYFQEIKSAFTKMQTFSTAPKYEIGVYGPRNICIRTSEAGLTKYSFVANMSTG
FT                   FSGNLGYPMPNNWAFDQFYEGTIGSGSGSIGIDKDGYSGRDSGASNVNPPSDPVYDARL
FT                   RTLTDILSTIPALENLTSLANAMFEFDTTETIFTSPELDIILSTSLLATIPSEGSPNTI
FT                   TITNGKPGAYITGLLGDTQTSLTASQIDSYQNLLNSLSLSVRNGYLEVYVNPTAESLNI
FT                   QIKIYTPDIPVGDNVTTGLTTTITFKIKTYKGVPVTSPESELALDWPSYDQYLFPVVGV
FT                   AALLLIGNMGSDLTNNKGVKVATALSAMLLAIFAYYTS"
FT   gene            complement(241917..242837)
FT                   /gene="ybfH"
FT                   /locus_tag="BSU_02210"
FT                   /old_locus_tag="BSU02210"
FT   CDS_pept        complement(241917..242837)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybfH"
FT                   /locus_tag="BSU_02210"
FT                   /old_locus_tag="BSU02210"
FT                   /product="putative permease"
FT                   /function="16.1: Circulate"
FT                   /note="Evidence 3: Putative function from multiple
FT                   computational evidences; PubMedId: 15849754, 16850406;
FT                   Product type t: transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BSU02210"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12015"
FT                   /db_xref="GOA:O31448"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="SubtiList:BG12737"
FT                   /db_xref="UniProtKB/Swiss-Prot:O31448"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB12015.1"
FT                   /translation="MNIQRETSGHIAAIVTILIWGTTFISTKVLLADFSPMEILFYRFL
FT                   MGFIALILVRPNMIPFRNWRQELLFAGAGLFGVTLYFLLENIALTYTYASNVGMIVSII
FT                   PMITAVLAHFLLEGEKLRLTFLIGFISALIGLLLITFNGNVVLRLNPLGDIMAAGAALV
FT                   FGGYSIFMKKLSAYEYHIIELTQRVFLYGLLFMVPALFLFDFHFDLSRFSSASNILNML
FT                   FLGIGASALCFATWNYSVGVLGAVKSSAYIYMVPVITIAASVLILHENMTWIALLGGAL
FT                   TLLGLYISELKPKAKLLENGCKMDA"
FT   gene            complement(242834..243661)
FT                   /gene="ybfI"
FT                   /locus_tag="BSU_02220"
FT                   /old_locus_tag="BSU02220"
FT   CDS_pept        complement(242834..243661)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybfI"
FT                   /locus_tag="BSU_02220"
FT                   /old_locus_tag="BSU02220"
FT                   /product="putative transcriptional regulator (AraC/XylS
FT                   family, cupin family)"
FT                   /function="16.3: Control"
FT                   /note="Evidence 3: Putative function from multiple
FT                   computational evidences; Product type r: regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BSU02220"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12016"
FT                   /db_xref="GOA:O31449"
FT                   /db_xref="InterPro:IPR003313"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR037923"
FT                   /db_xref="SubtiList:BG12738"
FT                   /db_xref="UniProtKB/Swiss-Prot:O31449"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB12016.1"
FT                   /translation="MQNETRTLQLDPHLHIEAYRFKGIMQKFPNHFHDYYVIGFIEKGQ
FT                   RYLACQDQEYIINPGDLLLFNPRDTHSCEQIDGRTLDYRCINVMPDIMEKAVKEITGSG
FT                   HLPYFSQHVLFRHELTASLQELHILISEEKQALRKEELFLHLLEELIRHYSDVTFLSSV
FT                   PEPSDEVKMVCEFLEEHYAENVTLNDLSELTGWSKYHLLRSFTKQKGITPNSYMETIRI
FT                   NQAKKLLEQGVRPIDAAFQTGFSDQSHMTKFFKRQVGLTPKQYMKIFEKELHR"
FT   gene            243892..245046
FT                   /gene="purT"
FT                   /locus_tag="BSU_02230"
FT                   /old_locus_tag="BSU02230"
FT   CDS_pept        243892..245046
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purT"
FT                   /locus_tag="BSU_02230"
FT                   /old_locus_tag="BSU02230"
FT                   /product="phosphoribosylglycinamide formyltransferase 2"
FT                   /function="16.2: Construct biomass (Anabolism)"
FT                   /EC_number="2.1.2.-"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 7496533; Product type e :
FT                   enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU02230"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12017"
FT                   /db_xref="GOA:P39771"
FT                   /db_xref="InterPro:IPR003135"
FT                   /db_xref="InterPro:IPR005862"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="SubtiList:BG10924"
FT                   /db_xref="UniProtKB/Swiss-Prot:P39771"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:7496533"
FT                   /protein_id="CAB12017.1"
FT                   /translation="MYQSKKVLLLGSGELGKEVVIEAQRLGVQTVAVDSYEHAPAMQVA
FT                   HNSYVVDMLDPEQIRTIIEKENPDLIVPEVEAIATDELLKLEEEGFHVIPNARAAKLTM
FT                   DREGIRRLAAETLGLATAGYEFANTYDEFIQAAAQIGFPCVVKPLMSSSGKGQSVCRSE
FT                   ADLESCWETAMEGGRVKNGRVIVEEFIPFESEITLLTVRAVNGTAFCEPIGHVQKDGDY
FT                   IESWQPHDMTEQQIEEAKHIAKTITDELGGYGLFGVELFLAKDRVYFSEVSPRPHDTGL
FT                   VTLVTQNLSEFALHVRAILGFPITEITQLSPGASRPLKAPEELADYTVEGLENALAVPK
FT                   TQVRVFGKPITKAGRRMAVALSAADSVETARENAKKALDQLILK"
FT   gene            245190..246131
FT                   /gene="mpr"
FT                   /locus_tag="BSU_02240"
FT                   /old_locus_tag="BSU02240"
FT   CDS_pept        245190..246131
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mpr"
FT                   /locus_tag="BSU_02240"
FT                   /old_locus_tag="BSU02240"
FT                   /product="extracellular glutamyl-endopeptidase"
FT                   /function="16.11: Scavenge (Catabolism)"
FT                   /EC_number="3.4.21.-"
FT                   /note="Evidence 1c: Function from experimental evidences in
FT                   the studied genus; PubMedId: 15205417, 15375126, 21819557,
FT                   25666135; Product type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU02240"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12018"
FT                   /db_xref="GOA:P39790"
FT                   /db_xref="InterPro:IPR000126"
FT                   /db_xref="InterPro:IPR001254"
FT                   /db_xref="InterPro:IPR008256"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR018114"
FT                   /db_xref="InterPro:IPR028301"
FT                   /db_xref="SubtiList:BG10690"
FT                   /db_xref="UniProtKB/Swiss-Prot:P39790"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB12018.1"
FT                   /translation="MKLVPRFRKQWFAYLTVLCLALAAAVSFGVPAKAAENPQTSVSNT
FT                   GKEADATKNQTSKADQVSAPYEGTGKTSKSLYGGQTELEKNIQTLQPSSIIGTDERTRI
FT                   SSTTSFPYRATVQLSIKYPNTSSTYGCTGFLVNPNTVVTAGHCVYSQDHGWASTITAAP
FT                   GRNGSSYPYGTYSGTMFYSVKGWTESKDTNYDYGAIKLNGSPGNTVGWYGYRTTNSSSP
FT                   VGLSSSVTGFPCDKTFGTMWSDTKPIRSAETYKLTYTTDTYGCQSGSPVYRNYSDTGQT
FT                   AIAIHTNGGSSYNLGTRVTNDVFNNIQYWANQ"
FT   gene            246094..246492
FT                   /gene="ybfJ"
FT                   /locus_tag="BSU_02250"
FT                   /old_locus_tag="BSU02250"
FT   CDS_pept        246094..246492
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybfJ"
FT                   /locus_tag="BSU_02250"
FT                   /old_locus_tag="BSU02250"
FT                   /product="putative lipoprotein"
FT                   /note="Evidence 3: Putative function from multiple
FT                   computational evidences; Product type lp: lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:BSU02250"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12019"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR019730"
FT                   /db_xref="SubtiList:BG12739"
FT                   /db_xref="UniProtKB/Swiss-Prot:O31451"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB12019.1"
FT                   /translation="MYSTIFNIGQINKYSKLAIFMSILFLCGCSSQTHSSQKETTIPVT
FT                   LHVEDAKGLPVEGVQVTIVKAPSSDEEPSTEIGEILGKTDKNGDIKWDTGRKGDYSVAL
FT                   TKGETSVTHHISLTEDKKDHAIPLVFKE"
FT   gene            246658..247548
FT                   /gene="cesB"
FT                   /locus_tag="BSU_02260"
FT                   /old_locus_tag="BSU02260"
FT   CDS_pept        246658..247548
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cesB"
FT                   /locus_tag="BSU_02260"
FT                   /old_locus_tag="BSU02260"
FT                   /product="enantioselective carboxylesterase"
FT                   /function="16.11: Scavenge (Catabolism)"
FT                   /EC_number="3.1.1.1"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 11389736, 24418394; Product
FT                   type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU02260"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12020"
FT                   /db_xref="GOA:O31452"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="PDB:4CCY"
FT                   /db_xref="SubtiList:BG12740"
FT                   /db_xref="UniProtKB/Swiss-Prot:O31452"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:11389736, 24418394"
FT                   /protein_id="CAB12020.1"
FT                   /translation="MIQDSMQFAAVESGLRFYQAYDQSLSLWPIESEAFYVSTRFGKTH
FT                   IIASGPKDAPSLILLHGGLFSSAMWYPNIAAWSSQFRTYAVDIIGDKNKSIPSAAMETR
FT                   ADFAEWMKDVFDSLGLETAHLAGLSLGGSHIVNFLLRAPERVERAVVISPAEAFISFHP
FT                   DVYKYAAELTGARGAESYIKWITGDSYDLHPLLQRQIVAGVEWQDEQRSLKPTENGFPY
FT                   VFTDQELKSIQVPVLLMFGEHEAMYHQQMAFERASVLVPGIQAEIVKNAGHLLSLEQPE
FT                   YVNQRVLSFLCGGIK"
FT   gene            247744..248277
FT                   /gene="pssA"
FT                   /locus_tag="BSU_02270"
FT                   /old_locus_tag="BSU02270"
FT   CDS_pept        247744..248277
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pssA"
FT                   /locus_tag="BSU_02270"
FT                   /old_locus_tag="BSU02270"
FT                   /product="phosphatidylserine synthase"
FT                   /function="16.2: Construct biomass (Anabolism)"
FT                   /function="16.13: Shape"
FT                   /EC_number="2.7.8.8"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 12682299, 14762009, 15743965,
FT                   15849754, 16850406; Product type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU02270"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12021"
FT                   /db_xref="GOA:P39823"
FT                   /db_xref="InterPro:IPR000462"
FT                   /db_xref="InterPro:IPR004533"
FT                   /db_xref="SubtiList:BG11012"
FT                   /db_xref="UniProtKB/Swiss-Prot:P39823"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:12682299, 14762009, 15743965, 15849754, 16850406"
FT                   /protein_id="CAB12021.1"
FT                   /translation="MNYIPCMITIGNFICGLLAIHSLLYHNIHSAVLFIFTGMFLDFFD
FT                   GMAARKLNAVSDMGRELDSFADLVTFGVAPSMLAYSVALYTLPFIGILCALTYSICGML
FT                   RLSKFNIEQSKLPTFIGMPIPFAGMCLVILSFTYNPILLAIGTCGLSYLMVSKIKFPHF
FT                   KKHAAENLESGRWN"
FT   gene            248268..248756
FT                   /gene="ybfM"
FT                   /locus_tag="BSU_02280"
FT                   /old_locus_tag="BSU02280"
FT   CDS_pept        248268..248756
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybfM"
FT                   /locus_tag="BSU_02280"
FT                   /old_locus_tag="BSU02280"
FT                   /product="putative membrane phosphatase"
FT                   /function="16.8: Protect"
FT                   /function="16.6: Maintain"
FT                   /note="Evidence 3: Putative function from multiple
FT                   computational evidences; PubMedId: 12682299, 14762009,
FT                   15849754, 16850406; Product type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU02280"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12022"
FT                   /db_xref="GOA:O31453"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="SubtiList:BG12741"
FT                   /db_xref="UniProtKB/Swiss-Prot:O31453"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB12022.1"
FT                   /translation="MELVQQLIADYGYLAIFLMLVLGIVGLPIPDEVMMTVVGYFTHTD
FT                   VLNYELSILISFVGALLGMLISYMIGRKAGRPFIDKYGKWVGLKEKRMMKVEKWMKKYG
FT                   PYSLILGYFIPGVRHVTCYFSGIGKMDLKTYVAFAAIGAFLWCFVFITIGRVIGIIHV"
FT   gene            248749..249540
FT                   /gene="psd"
FT                   /locus_tag="BSU_02290"
FT                   /old_locus_tag="BSU02290"
FT   CDS_pept        248749..249540
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="psd"
FT                   /locus_tag="BSU_02290"
FT                   /old_locus_tag="BSU02290"
FT                   /product="phosphatidylserine decarboxylase; 32 kDa
FT                   precursor processed into a 29 kDa protein"
FT                   /function="16.2: Construct biomass (Anabolism)"
FT                   /function="16.13: Shape"
FT                   /EC_number="4.1.1.65"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 12682299, 14762009, 9422599;
FT                   Product type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU02290"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12023"
FT                   /db_xref="GOA:P39822"
FT                   /db_xref="InterPro:IPR003817"
FT                   /db_xref="InterPro:IPR033177"
FT                   /db_xref="InterPro:IPR033178"
FT                   /db_xref="SubtiList:BG11013"
FT                   /db_xref="UniProtKB/Swiss-Prot:P39822"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:12682299, 14762009, 9422599"
FT                   /protein_id="CAB12023.1"
FT                   /translation="MFNTAVKILYRSLIELTNHRLSSYLIKGFCESKISKPVIPLFSKH
FT                   FRLNWDDVDGTAADYGSLSELFIRQINLERRPVSKEAHAVVSPVDGVVQTVGIINPNQT
FT                   FTVKGKDYSFAELTGCKSADHQYNGGYFVVLYLSPRHYHRFHSPISCRYQKLAELGNRS
FT                   YPVNQLGLKYGKDVLSKNYRFVYELNSGSRNVLMIPVGAMNINSIVQTNTRTELEIGEE
FT                   LGYFSFGSTVILVFEKDAFQPSAHLAEGQEVQVGELIGYEE"
FT   gene            249595..249873
FT                   /gene="ybfN"
FT                   /locus_tag="BSU_02300"
FT                   /old_locus_tag="BSU02300"
FT   CDS_pept        249595..249873
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybfN"
FT                   /locus_tag="BSU_02300"
FT                   /old_locus_tag="BSU02300"
FT                   /product="conserved protein of unknown function"
FT                   /note="Evidence 4: Unknown function but conserved in other
FT                   organisms"
FT                   /db_xref="EnsemblGenomes-Gn:BSU02300"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12024"
FT                   /db_xref="SubtiList:BG12742"
FT                   /db_xref="UniProtKB/Swiss-Prot:O31454"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB12024.1"
FT                   /translation="MEKQIISWITDYQNTGDEAVLRQVREVCWPIVEAVLQEKVMDDEQ
FT                   ANNLREKGIERFPFIISKYQADVQLPVETFLQNTYRFYFHQVMRESS"
FT   gene            249979..251319
FT                   /gene="ybfO"
FT                   /locus_tag="BSU_02310"
FT                   /old_locus_tag="BSU02310"
FT   CDS_pept        249979..251319
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybfO"
FT                   /locus_tag="BSU_02310"
FT                   /old_locus_tag="BSU02310"
FT                   /product="putative exported hydrolase"
FT                   /function="16.11: Scavenge (Catabolism)"
FT                   /function="16.8: Protect"
FT                   /EC_number="3.-.-.-"
FT                   /note="Evidence 3: Putative function from multiple
FT                   computational evidences; Product type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU02310"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12025"
FT                   /db_xref="GOA:O31455"
FT                   /db_xref="InterPro:IPR007815"
FT                   /db_xref="SubtiList:BG12743"
FT                   /db_xref="UniProtKB/Swiss-Prot:O31455"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB12025.1"
FT                   /translation="MKRMIVRMTLPLLIVCLAFSSFSASARAASEEKYWDHWIERHAQP
FT                   LDASNASNKDLRFLKKVLKGKRIVQLGETTHGAGEINATKVRMIKYLHEELGYDVLAFE
FT                   SGFPDTNASYLNMDQLTPKSTMKNSIYAVWHTEDVVELFDYMKEQKEKGDPLILTGFDI
FT                   QSMKNSFNVAATQWVKAVDPEKAELLSQSENDFSTLVTDSNTFDEFSQKKEKLVKNYQK
FT                   LIKFTKTHASELKENLPKEPKAYEMFMHSLQLRIDVMETYMLEEMKEKLEEYPENIEDF
FT                   SFFMRDRMMAEQFQWVADTLYPKKKIIVWGHNYHLRKQNTKMIKDWVQLNGPNMGDYLP
FT                   ERLKKQTYTIGIYAYSGASLDSSDNKTVKPVTSPPPSGSLEALLKAADRPAVFVDFLHT
FT                   KNKKGTSWMYTPRTALYWGYMEEQMILKEQYDGVIWLEHITPSVIIK"
FT   gene            251427..252314
FT                   /gene="ybfP"
FT                   /locus_tag="BSU_02320"
FT                   /old_locus_tag="BSU02320"
FT   CDS_pept        251427..252314
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybfP"
FT                   /locus_tag="BSU_02320"
FT                   /old_locus_tag="BSU02320"
FT                   /product="putative transcriptional regulator (AraC/XylS
FT                   family)"
FT                   /function="16.3: Control"
FT                   /note="Evidence 3: Putative function from multiple
FT                   computational evidences; Product type r: regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BSU02320"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12026"
FT                   /db_xref="GOA:O31456"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="SubtiList:BG12744"
FT                   /db_xref="UniProtKB/Swiss-Prot:O31456"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB12026.1"
FT                   /translation="MYYEKAVQKTINWIESHLHEQISNEDIVNVSSFSKFHFHRIFQKE
FT                   VGMSVASYIRLRRLANAAAALLYTDHRIIDIALYYQFESQEAFTRTFKKMYHMPPGAYR
FT                   TFMKRFTSKKEESYMEKKMKGWVLSGSHPFQFEMGIDRENVHQGKASGYLKSTMVQDIG
FT                   EFATMMQQFKADRYLGKRLRLSSFIKTKGVQHFASLWMRVDSAADDVLQFDNMSNRPIT
FT                   GTTNWNHYAIVLDVPENSAVISFGVQLSGPGQVWMDHVVFEEVDESVPSTNLEMPGELL
FT                   DEPVNLSFEEELQK"
FT   gene            252514..253482
FT                   /gene="ybfQ"
FT                   /locus_tag="BSU_02330"
FT                   /old_locus_tag="BSU02330"
FT   CDS_pept        252514..253482
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybfQ"
FT                   /locus_tag="BSU_02330"
FT                   /old_locus_tag="BSU02330"
FT                   /product="putative enzyme with rhodanese domain"
FT                   /function="16.11: Scavenge (Catabolism)"
FT                   /function="16.8: Protect"
FT                   /note="Evidence 3: Putative function from multiple
FT                   computational evidences; PubMedId: 10939241, 22720735;
FT                   Product type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU02330"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12027"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR020936"
FT                   /db_xref="InterPro:IPR022111"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="InterPro:IPR040503"
FT                   /db_xref="SubtiList:BG12745"
FT                   /db_xref="UniProtKB/Swiss-Prot:O31457"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB12027.1"
FT                   /translation="MEKQYRVLLYYKYVPIEDPEAFREQHLAFCKELGLLGRILVSSEG
FT                   INGTVSGTVEQTEKYMETMKADPRFADMVFKIDEAEGHAFKKIFVRHKKELVTLRLEDD
FT                   VDPNETTGQHLKPAEFYEKMQDPNTIVIDARNDYEYDLGHFRGAVRPDIEAFRELPEWI
FT                   EEHKDMLEGKKILTYCTGGVRCEKFSGWLVKQGFEDVAQLDGGIVTYGKDPEVQGKLWD
FT                   GQCYVFDERISVPVNRVEHVIVGKDYFTGEPCERYVNCANPSCNKKMICTPENEYKYMR
FT                   SCSHECRTNPRNLYVKEHNMTEEEVNARLAAIETEDHAAAE"
FT   gene            complement(253518..254762)
FT                   /gene="gltP"
FT                   /locus_tag="BSU_02340"
FT                   /old_locus_tag="BSU02340"
FT   CDS_pept        complement(253518..254762)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gltP"
FT                   /locus_tag="BSU_02340"
FT                   /old_locus_tag="BSU02340"
FT                   /product="proton/glutamate symport protein"
FT                   /function="16.1: Circulate"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 7751298, 15849754, 16850406;
FT                   Product type t: transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BSU02340"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12028"
FT                   /db_xref="GOA:P39817"
FT                   /db_xref="InterPro:IPR001991"
FT                   /db_xref="InterPro:IPR018107"
FT                   /db_xref="InterPro:IPR033380"
FT                   /db_xref="InterPro:IPR036458"
FT                   /db_xref="SubtiList:BG11015"
FT                   /db_xref="UniProtKB/Swiss-Prot:P39817"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:7751298, 15849754, 16850406"
FT                   /protein_id="CAB12028.1"
FT                   /translation="MKKLIAFQILIALAVGAVIGHFFPDFGMALRPVGDGFIRLIKMIV
FT                   VPIVFSTIVIGAAGSGSMKKMGSLGIKTIIWFEVITTLVLGLGLLLANVLKPGVGLDLS
FT                   HLAKKDIHELSGYTDKVVDFKQMILDIIPTNIIDVMARNDLLAVIFFAILFGVAAAGIG
FT                   KASEPVMKFFESTAQIMFKLTQIVMVTAPIGVLALMAASVGQYGIELLLPMFKLVGTVF
FT                   LGLFLILFVLFPLVGLIFQIKYFEVLKMIWDLFLIAFSTTSTETILPQLMDRMEKYGCP
FT                   KRVVSFVVPSGLSLNCDGSSLYLSVSCIFLAQAFQVDMTLSQQLLMMLVLVMTSKGIAA
FT                   VPSGSLVVLLATANAVGLPAEGVAIIAGVDRVMDMARTGVNVPGHAIACIVVSKWEKAF
FT                   RQKEWVSANSQTESI"
FT   gene            complement(254907..256802)
FT                   /gene="gamP"
FT                   /locus_tag="BSU_02350"
FT                   /old_locus_tag="BSU02350"
FT   CDS_pept        complement(254907..256802)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gamP"
FT                   /locus_tag="BSU_02350"
FT                   /old_locus_tag="BSU02350"
FT                   /product="phosphotransferase system (PTS)
FT                   glucosamine-specific enzyme IICBA component"
FT                   /function="16.1: Circulate"
FT                   /EC_number="2.7.1.193"
FT                   /note="Evidence 2a: Function from experimental evidences in
FT                   other organisms; PubMedId: 10627040, 15849754, 16850406;
FT                   Product type t: transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BSU02350"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12029"
FT                   /db_xref="GOA:P39816"
FT                   /db_xref="InterPro:IPR001127"
FT                   /db_xref="InterPro:IPR001996"
FT                   /db_xref="InterPro:IPR003352"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR011299"
FT                   /db_xref="InterPro:IPR013013"
FT                   /db_xref="InterPro:IPR018113"
FT                   /db_xref="InterPro:IPR036878"
FT                   /db_xref="SubtiList:BG11014"
FT                   /db_xref="UniProtKB/Swiss-Prot:P39816"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB12029.1"
FT                   /translation="MFKKAFQILQQLGRALMTPVAVLPAAGLLLRFGDKDLLNIPIIKD
FT                   AGGVVFDNLPLIFAVGVAIGLAGGEGVAGLAAVIGYLILTVTLDNMGKLLGLQPPYEGA
FT                   EHLIDMGVFGGIIIGLLAAYLYKRFSSIELHPVLGFFSGKRFVPIITSVSSLVIGVIFS
FT                   FVWPLIQNGINAASSLIADSTVGLFFYATIYRLLIPFGLHHIFYTPFYFMMGEYTDPST
FT                   GNTVTGDLTRFFAGDPTAGRFMMGDFPYMIFCLPAVALAIIHTARPEKKKMISGVMISA
FT                   ALTSMLTGITEPVEFSFLFVAPVLYLINSILAGVIFVVCDLFHVRHGYTFSGGGIDYVL
FT                   NYGLSTNGWVVIPVGIVFAFIYYYLFRFAILKWNLKTPGRETDEDGQNEEKAPVAKDQL
FT                   AFHVLQALGGQQNIANLDACITRLRVTVHQPSQVCKDELKRLGAVGVLEVNNNFQAIFG
FT                   TKSDALKDDIKTIMAGGVPATAAALDTVTDKPLKPDSDETFIYPIKGETVSLGDVPDQV
FT                   FSEKMMGEGFAIIPSEGKVVAPADGEIVSIFPTKHAIGFMSAGGTEILIHVGIDTVKLN
FT                   GEGFEAHVTSGQAVKQGELLLTFDLNYIKQHAASAITPVIFTNTSEEDLKHIQMK"
FT   gene            complement(256823..257572)
FT                   /gene="gamA"
FT                   /locus_tag="BSU_02360"
FT                   /old_locus_tag="BSU02360"
FT   CDS_pept        complement(256823..257572)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gamA"
FT                   /locus_tag="BSU_02360"
FT                   /old_locus_tag="BSU02360"
FT                   /product="glucosamine-6-phosphate deaminase"
FT                   /function="16.2: Construct biomass (Anabolism)"
FT                   /function="16.11: Scavenge (Catabolism)"
FT                   /function="16.13: Shape"
FT                   /EC_number="3.5.99.6"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 23667565, 27002132; Product
FT                   type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU02360"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12030"
FT                   /db_xref="GOA:O31458"
FT                   /db_xref="InterPro:IPR004547"
FT                   /db_xref="InterPro:IPR006148"
FT                   /db_xref="InterPro:IPR018321"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="SubtiList:BG12746"
FT                   /db_xref="UniProtKB/Swiss-Prot:O31458"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:23667565, 27002132"
FT                   /protein_id="CAB12030.1"
FT                   /translation="MKILIAEHYEELCKLSAAIIKEQIQAKKDAVLGLATGSTPVGLYK
FT                   QLISDYQAGEIDFSKVTTFNLDEYAGLSPSHPQSYNHFMHEHLFQHINMQPDHIHIPQG
FT                   DNPQLEAACKVYEDLIRQAGGIDVQILGIGANGHIGFNEPGSDFEDRTRVVKLSESTIQ
FT                   ANARFFGGDPVLVPRLAISMGIKTIMEFSKHIVLLASGEEKADAIQKMAEGPVTTDVPA
FT                   SILQKHNHVTVIADYKAAQKLKSASFS"
FT   gene            257791..258498
FT                   /gene="gamR"
FT                   /locus_tag="BSU_02370"
FT                   /old_locus_tag="BSU02370"
FT   CDS_pept        257791..258498
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gamR"
FT                   /locus_tag="BSU_02370"
FT                   /old_locus_tag="BSU02370"
FT                   /product="transcriptional regulator-GlcN6P (GntR family)"
FT                   /function="16.3: Control"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 23667565, 24673833; Product
FT                   type r: regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BSU02370"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12031"
FT                   /db_xref="GOA:O31459"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR011663"
FT                   /db_xref="InterPro:IPR028978"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="SubtiList:BG12747"
FT                   /db_xref="UniProtKB/Swiss-Prot:O31459"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:23667565, 24673833"
FT                   /protein_id="CAB12031.1"
FT                   /translation="MTALYSVIKFKIIELIKSGKYQANDQLPTESEFCEQYDVSRTTVR
FT                   LALQQLELEGYIKRIQGKGTFVSAAKIQTPIPHKITSFAEQMRGLRSESKVLELVVIPA
FT                   DHSIAELLKMKENEPVNKLVRVRYAEGEPLQYHTSYIPWKAAPGLAQEECTGSLFELLR
FT                   TKYNIEISRGTESIEPILTDETISGHLLTNVGAPAFLSESLTYDKNEEVVEYAQIITRG
FT                   DRTKFTVEQSYHS"
FT   gene            258532..258807
FT                   /gene="ybgB"
FT                   /locus_tag="BSU_02380"
FT                   /old_locus_tag="BSU02380"
FT   CDS_pept        258532..258807
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybgB"
FT                   /locus_tag="BSU_02380"
FT                   /old_locus_tag="BSU02380"
FT                   /product="conserved protein of unknown function (B.
FT                   subtilis-specific)"
FT                   /note="Evidence 4: Unknown function but conserved in other
FT                   organisms; PubMedId: 12897008, 23667565"
FT                   /db_xref="EnsemblGenomes-Gn:BSU02380"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12032"
FT                   /db_xref="GOA:O31460"
FT                   /db_xref="InterPro:IPR012867"
FT                   /db_xref="SubtiList:BG12748"
FT                   /db_xref="UniProtKB/Swiss-Prot:O31460"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB12032.1"
FT                   /translation="MFLFTNGKVLWGAVIAAFILSIVFYPFLPTQMPIHYDVANSPDLT
FT                   VNKLAGTVMLPVLMVVFAWARKINWQFVFAVYILLICHIVVLCLAL"
FT   gene            259016..260086
FT                   /gene="ilvE"
FT                   /locus_tag="BSU_02390"
FT                   /old_locus_tag="BSU02390"
FT   CDS_pept        259016..260086
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ilvE"
FT                   /locus_tag="BSU_02390"
FT                   /old_locus_tag="BSU02390"
FT                   /product="isoleucine-valine aminotransferase / aromatic
FT                   amino acid aminotransferase"
FT                   /function="16.11: Scavenge (Catabolism)"
FT                   /function="16.2: Construct biomass (Anabolism)"
FT                   /EC_number="2.6.1.42"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 12670965, 15060025, 15102328,
FT                   20332210, 23429746; Product type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU02390"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12033"
FT                   /db_xref="GOA:O31461"
FT                   /db_xref="InterPro:IPR001544"
FT                   /db_xref="InterPro:IPR005786"
FT                   /db_xref="InterPro:IPR018300"
FT                   /db_xref="InterPro:IPR033939"
FT                   /db_xref="InterPro:IPR036038"
FT                   /db_xref="SubtiList:BG12749"
FT                   /db_xref="UniProtKB/Swiss-Prot:O31461"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:12670965, 15060025, 15102328, 20332210, 23429746"
FT                   /protein_id="CAB12033.1"
FT                   /translation="MNKLIEREKTVYYKEKPDPSSLGFGQYFTDYMFVMDYEEGIGWHH
FT                   PRIAPYAPLTLDPSSSVFHYGQAVFEGLKAYRTDDGRVLLFRPDQNIKRLNRSCERMSM
FT                   PPLDEELVLEALTQLVELEKDWVPKEKGTSLYIRPFVIATEPSLGVKASRSYTFMIVLS
FT                   PVGSYYGDDQLKPVRIYVEDEYVRAVNGGVGFAKTAGNYAASLQAQRKANELGYDQVLW
FT                   LDAIEKKYVEEVGSMNIFFVINGEAVTPALSGSILSGVTRASAIELIRSWGIPVREERI
FT                   SIDEVYAASARGELTEVFGTGTAAVVTPVGELNIHGKTVIVGDGQIGDLSKKLYETITD
FT                   IQLGKVKGPFNWTVEV"
FT   gene            complement(260123..261535)
FT                   /gene="ybgF"
FT                   /locus_tag="BSU_02400"
FT                   /old_locus_tag="BSU02400"
FT   CDS_pept        complement(260123..261535)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybgF"
FT                   /locus_tag="BSU_02400"
FT                   /old_locus_tag="BSU02400"
FT                   /product="putative aminoacid permease"
FT                   /function="16.1: Circulate"
FT                   /note="Evidence 3: Putative function from multiple
FT                   computational evidences; PubMedId: 7704263, 15849754,
FT                   16850406; Product type t: transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BSU02400"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12034"
FT                   /db_xref="GOA:O31462"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004840"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="SubtiList:BG12750"
FT                   /db_xref="UniProtKB/Swiss-Prot:O31462"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB12034.1"
FT                   /translation="MNSAHNKNETTFQRSMKSRHLFMLSLGGVIGTGLFLSSGYTIQQA
FT                   GPAGTILAYLVGAGIVYLVMLCLGELSVAMPVTGAFHTYAAKYIGPGTGFTVAWLYWLT
FT                   WTVALGSEFTAAGLLMQRWFPHTSVWMWSAVFALFIFLLNAFSVKFFAESEFWFSSIKV
FT                   LAIVLFILLGGSAMFGIIPIKGGEAAPMLSNFTAEGGLFPNGFVPILMTMLSVNFAFSG
FT                   TELIGIAAGESVDPDKTIPKAIKTTVWRLSLFFVGTIFVLSGLIPIQDAGVIKSPFVAV
FT                   FDRVGVPYAADIMNFVILTAILSAANSGLYASSRMLWSLSKEKTLHPTFAKLTSKGTPF
FT                   NALVFSMIGGILSLLSSVFAPDTVYVVLVSISGFAVVVVWMGIAASQFMFRKRYIEAGN
FT                   KVTDLKYRTPLYPFVPIAAFLLCLASVVGIAFDPNQRIALYCGVPFMAICYAIYYVKNR
FT                   KSQPAADMTHSK"
FT   gene            complement(261656..262603)
FT                   /gene="ybgG"
FT                   /locus_tag="BSU_02410"
FT                   /old_locus_tag="BSU02410"
FT   CDS_pept        complement(261656..262603)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybgG"
FT                   /locus_tag="BSU_02410"
FT                   /old_locus_tag="BSU02410"
FT                   /product="homocysteine methylase using (R,S)AdoMet"
FT                   /function="16.11: Scavenge (Catabolism)"
FT                   /function="16.6: Maintain"
FT                   /EC_number="2.1.1.10"
FT                   /note="Evidence 2a: Function from experimental evidences in
FT                   other organisms; PubMedId: 11267663, 15995196, 17264075;
FT                   Product type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU02410"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12035"
FT                   /db_xref="GOA:O31463"
FT                   /db_xref="InterPro:IPR003726"
FT                   /db_xref="InterPro:IPR017226"
FT                   /db_xref="InterPro:IPR036589"
FT                   /db_xref="SubtiList:BG12751"
FT                   /db_xref="UniProtKB/Swiss-Prot:O31463"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB12035.1"
FT                   /translation="MNPIQHILDTYPLIVLDGAMATELERKGCNLNDSLWSAKILMEEP
FT                   ELIKQVHTDYFAAGADCAITASYQSTFEGFAARGLSEAEARRLIELSVSIAAEARDEFW
FT                   SLEENRLNRPKPIIAASIGPYGAYLADGSEYRGNYAISEDELIEFHRPRMKALIEAGAD
FT                   VLACETIPCLTEAKAIVRLLKEFPETYAWISFSAKDGLHISDGTPAADCASWLDEHRQI
FT                   AALGINCTPLQHIPSLIEELKKNTSKPIIVYPNSGEQYDPETKTWNGAACAESYGASAR
FT                   TWHEKGARLIGGCCRTKPENIQEIAAWARSLKTT"
FT   gene            complement(262732..264168)
FT                   /gene="glnT"
FT                   /locus_tag="BSU_02420"
FT                   /old_locus_tag="BSU02420"
FT   CDS_pept        complement(262732..264168)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glnT"
FT                   /locus_tag="BSU_02420"
FT                   /old_locus_tag="BSU02420"
FT                   /product="glutamine transporter"
FT                   /function="16.1: Circulate"
FT                   /note="Evidence 2b: Function from indirect experimental
FT                   evidences (e.g. phenotypes); PubMedId: 15849754, 15995196,
FT                   16850406; Product type t: transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BSU02420"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12036"
FT                   /db_xref="GOA:O31464"
FT                   /db_xref="InterPro:IPR001463"
FT                   /db_xref="SubtiList:BG12752"
FT                   /db_xref="UniProtKB/Swiss-Prot:O31464"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB12036.2"
FT                   /translation="MQQILEHIVGIANDLLWSKLLIVLLLSFGIYFTFRLKFLQVRMLK
FT                   EMVRVLREGAASRSKNSISPFQAFCISMAARVGTGNITGIAIAIALGGPGAIFWMWIIA
FT                   IIGSASSFVESTLAQIYKVKDVNGFRGGPAYYMEKGLNKRWMGALFAVLITLSFGIVFN
FT                   SVQSNTVSLAFENAFGTNRLTLGLILIAVFGTIIFGGVKRIAKLAESIVVVLAVLYIGV
FT                   AFFVIFSNITQLPGVLALIVKNAFGFDQAAGGALGAALMQGVRRGIFSNEAGMGSAPNA
FT                   AATATTSHPVKQGLIQAFGVLTDTLVICTSTAFIILFSDAYHTPGLSGIALTQASLSSH
FT                   VGSWASGFLAILILLFGFCALIGNYYYGETNIGFLNKSKKLIFVYRIGVLAMIVFGCVA
FT                   KVQLVWDLADLFMGLMVIVNLIAIFLLSKVVFTALKDYTRQKKAGKDPVFYKDVLKNHN
FT                   GIECWPVSDTKTDTHNKQIS"
FT   gene            complement(264191..265174)
FT                   /gene="glsA"
FT                   /locus_tag="BSU_02430"
FT                   /old_locus_tag="BSU02430"
FT   CDS_pept        complement(264191..265174)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glsA"
FT                   /locus_tag="BSU_02430"
FT                   /old_locus_tag="BSU02430"
FT                   /product="glutaminase"
FT                   /function="16.11: Scavenge (Catabolism)"
FT                   /EC_number="3.5.1.2"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 15995196, 18459799, 20050917;
FT                   Product type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU02430"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12037"
FT                   /db_xref="GOA:O31465"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR015868"
FT                   /db_xref="PDB:1MKI"
FT                   /db_xref="PDB:2OSU"
FT                   /db_xref="PDB:3AGF"
FT                   /db_xref="PDB:3BRM"
FT                   /db_xref="SubtiList:BG12753"
FT                   /db_xref="UniProtKB/Swiss-Prot:O31465"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:15995196, 18459799, 20050917"
FT                   /protein_id="CAB12037.1"
FT                   /translation="MKELIKEHQKDINPALQLHDWVEYYRPFAANGQSANYIPALGKVN
FT                   DSQLGICVLEPDGTMIHAGDWNVSFTMQSISKVISFIAACMSRGIPYVLDRVDVEPTGD
FT                   AFNSIIRLEINKPGKPFNPMINAGALTIASILPGESAYEKLEFLYSVMETLIGKRPRIH
FT                   EEVFRSEWETAHRNRALAYYLKETNFLEAEVEETLEVYLKQCAMESTTEDIALIGLILA
FT                   HDGYHPIRHEQVIPKDVAKLAKALMLTCGMYNASGKYAAFVGVPAKSGVSGGIMALVPP
FT                   SARREQPFQSGCGIGIYGPAIDEYGNSLTGGMLLKHMAQEWELSIF"
FT   gene            265476..266708
FT                   /gene="glnJ"
FT                   /locus_tag="BSU_02440"
FT                   /old_locus_tag="BSU02440"
FT   CDS_pept        265476..266708
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glnJ"
FT                   /locus_tag="BSU_02440"
FT                   /old_locus_tag="BSU02440"
FT                   /product="two-component sensor histidine kinase [GlnL] for
FT                   glutamine degradation"
FT                   /function="16.12: Sense"
FT                   /function="16.3: Control"
FT                   /EC_number="2.7.13.3"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 11717295, 15995196, 17001076,
FT                   21435182, 23461034, 25691471; Product type rc : receptor"
FT                   /db_xref="EnsemblGenomes-Gn:BSU02440"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12038"
FT                   /db_xref="GOA:P40758"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="SubtiList:BG10871"
FT                   /db_xref="UniProtKB/Swiss-Prot:P40758"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:11717295, 15995196, 17001076, 21435182, 23461034,
FT                   25691471"
FT                   /protein_id="CAB12038.2"
FT                   /translation="MLITVPLAGELKFYPLNEEFRVSFGAPVFFFFLSLLRHVPAVLPG
FT                   FLTGAAVFIFRVFLELWGGGHNGLTPILYDQASGFFFYMTYACLFSILKANRFRERPIM
FT                   LGFIGFMIEVVSDCVELTVQFLIFHTVVTPEKITDIAVIAISHTFIVMSFYSVLKLYET
FT                   QSREKQTRQQHEHMLMIVSNLYEETVHLKKTLKTTEKVTNDSYQLYREMKGKDVQLSGR
FT                   ILRLAGEIHEVKKDNQRIFAGLSKLISNESLRDYMRASDLLQLVIRMNEKYAEALGKQI
FT                   DFYCSIEGEHDEYHVFIVLSIINNLTANAVEAMDEEGMVSLRLRKPNESMVEFQVEDNG
FT                   PGISEKIGDIVFDPGFTSKYDEFGTPSTGIGLSYVKEIVTELEGDITFDNQQRGVVFAI
FT                   RLPVRHLIQKG"
FT   gene            266719..267663
FT                   /gene="glnL"
FT                   /locus_tag="BSU_02450"
FT                   /old_locus_tag="BSU02450"
FT   CDS_pept        266719..267663
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glnL"
FT                   /locus_tag="BSU_02450"
FT                   /old_locus_tag="BSU02450"
FT                   /product="two-component response regulator [GlnJ] for
FT                   glutamine utilisation"
FT                   /function="16.3: Control"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 11717295, 15995196; Product
FT                   type r: regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BSU02450"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12039"
FT                   /db_xref="GOA:P40759"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR013972"
FT                   /db_xref="SubtiList:BG10872"
FT                   /db_xref="UniProtKB/Swiss-Prot:P40759"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:11717295, 15995196"
FT                   /protein_id="CAB12039.1"
FT                   /translation="MRFFIADDDRAVRSILRQIIEDEDLGEAAGEADDGSQVEGHMLQF
FT                   KQIDILLIDLLMPGRDGIETIRQIQNTYSGKIVMISQVEAKEMVGEAYSLGIEYFIHKP
FT                   INRIEIVTVLQKVKERIELEHSIGAIQHSLSRLVNRTERKARPQQKSDSGLKEAGTFLL
FT                   SELGMMGEGGAHDLMAVLQYLAEHEQSEPHEKQSPSLKQIFTQVAVRKLGTGASQTEVN
FT                   REMKASEQRIRRAIIHSLHHFASLGTTDFSNPKFETYASKFFDFPVVSQKMKELQSKDA
FT                   KPLAPARINMKKFIHVFFLEAKLLHETMKQRRI"
FT   gene            267890..268816
FT                   /gene="kdgD"
FT                   /locus_tag="BSU_02460"
FT                   /old_locus_tag="BSU02460"
FT   CDS_pept        267890..268816
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kdgD"
FT                   /locus_tag="BSU_02460"
FT                   /old_locus_tag="BSU02460"
FT                   /product="5-dehydro-4-deoxyglucarate dehydratase"
FT                   /function="16.11: Scavenge (Catabolism)"
FT                   /EC_number="4.2.1.41"
FT                   /note="Evidence 2a: Function from experimental evidences in
FT                   other organisms; PubMedId: 12044674; Product type e :
FT                   enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU02460"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12040"
FT                   /db_xref="GOA:P42235"
FT                   /db_xref="InterPro:IPR002220"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017655"
FT                   /db_xref="SubtiList:BG11158"
FT                   /db_xref="UniProtKB/Swiss-Prot:P42235"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB12040.2"
FT                   /translation="MSRIRKAPAGILGFPVAPFNTQGKLEEEALFQNIEFLLNEGLEAI
FT                   FIACGSGEFQSLSQKEYEQMVEVAVSAAGGKVPVYTGVGGNLSTALDWAQLSEKKGADG
FT                   YLILPPYLVHGEQEGLYQYAKTIIESTDLNAILYQRDNAVLSVEQIKRLTECEQLVGVK
FT                   DGVGNMDLNINLVYTIGDRLGWLNGMPMAEVTMPAYLPIGFHSYSSAISNYIPHISRMF
FT                   YDALKNGNDELVKELYRHVILPINDIRKQRKGYAVSLIKAGMEIMGLNVRNTARPPVGP
FT                   VEKDHYQQLEAILKQAADRFPKKAATV"
FT   gene            268846..270312
FT                   /gene="gucD"
FT                   /locus_tag="BSU_02470"
FT                   /old_locus_tag="BSU02470"
FT   CDS_pept        268846..270312
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gucD"
FT                   /locus_tag="BSU_02470"
FT                   /old_locus_tag="BSU02470"
FT                   /product="2,5-dioxovalerate dehydrogenase
FT                   (alpha-ketoglutaric semialdehyde dehydrogenase)"
FT                   /function="16.11: Scavenge (Catabolism)"
FT                   /EC_number="1.2.1.26"
FT                   /note="Evidence 2a: Function from experimental evidences in
FT                   other organisms; PubMedId: 12044674, 17202142; Product type
FT                   e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU02470"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12041"
FT                   /db_xref="GOA:P42236"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="SubtiList:BG11159"
FT                   /db_xref="UniProtKB/Swiss-Prot:P42236"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB12041.1"
FT                   /translation="MSVITEQNTYLNFINGEWVKSQSGDMVKVENPADVNDIVGYVQNS
FT                   TAEDVERAVTAANEAKTAWRKLTGAERGQYLYKTADIMEQRLEEIAACATREMGKTLPE
FT                   AKGETARGIAILRYYAGEGMRKTGDVIPSTDKDALMFTTRVPLGVVGVISPWNFPVAIP
FT                   IWKMAPALVYGNTVVIKPATETAVTCAKIIACFEEAGLPAGVINLVTGPGSVVGQGLAE
FT                   HDGVNAVTFTGSNQVGKIIGQAALARGAKYQLEMGGKNPVIVADDADLEAAAEAVITGA
FT                   FRSTGQKCTATSRVIVQSGIYERFKEKLLQRTKDITIGDSLKEDVWMGPIASKNQLDNC
FT                   LSYIEKGKQEGASLLIGGEKLENGKYQNGYYVQPAIFDNVTSEMTIAQEEIFGPVIALI
FT                   KVDSIEEALNIANDVKFGLSASIFTENIGRMLSFIDEIDAGLVRINAESAGVELQAPFG
FT                   GMKQSSSHSREQGEAAKDFFTAIKTVFVKP"
FT   gene            270396..271763
FT                   /gene="gudP"
FT                   /locus_tag="BSU_02480"
FT                   /old_locus_tag="BSU02480"
FT   CDS_pept        270396..271763
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gudP"
FT                   /locus_tag="BSU_02480"
FT                   /old_locus_tag="BSU02480"
FT                   /product="glucarate transporter"
FT                   /function="16.1: Circulate"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 12044674, 15849754, 16850406;
FT                   Product type t: transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BSU02480"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12042"
FT                   /db_xref="GOA:P42237"
FT                   /db_xref="InterPro:IPR000849"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="SubtiList:BG11160"
FT                   /db_xref="UniProtKB/Swiss-Prot:P42237"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:12044674, 15849754, 16850406"
FT                   /protein_id="CAB12042.2"
FT                   /translation="MKKDFASVTPAGKKTSVRWFIVFMLFLVTSINYADRATLSITGDS
FT                   VQHDLGLDSVAMGYVFSAFGWAYVIGQLPGGWLLDRFGSKTIIALSIFFWSFFTLLQGA
FT                   IGFFSAGTAIILLFALRFLVGLSEAPSFPGNGRVVASWFPSSERGTASAFFNSAQYFAI
FT                   VIFSPLMGWLTHSFGWHSVFVVMGIAGILLAVIWLKTVYEPKKHPKVNEAELAYIEQGG
FT                   GLISMDDSKSKQETESKWPYIKQLLTNRMLIGVYIAQYCITTLTYFFLTWFPVYLVQAR
FT                   GMSILEAGFVASLPALCGFAGGVLGGIVSDILLKKGRSLTFARKVPIIAGMLLSCSMIV
FT                   CNYTDSAWLVVVIMSLAFFGKGFGALGWAVVSDTSPKECAGLSGGLFNTFGNIASITTP
FT                   IIIGYIVNATGSFNGALVFVGANAIAAILSYLLLVGPIKRVVLKKQEQDPDQSLPV"
FT   gene            271800..273167
FT                   /gene="gudD"
FT                   /locus_tag="BSU_02490"
FT                   /old_locus_tag="BSU02490"
FT   CDS_pept        271800..273167
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gudD"
FT                   /locus_tag="BSU_02490"
FT                   /old_locus_tag="BSU02490"
FT                   /product="glucarate dehydratase"
FT                   /function="16.11: Scavenge (Catabolism)"
FT                   /EC_number="4.2.1.40"
FT                   /note="Evidence 2a: Function from experimental evidences in
FT                   other organisms; PubMedId: 9772161, 12044674; Product type
FT                   e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU02490"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12043"
FT                   /db_xref="GOA:P42238"
FT                   /db_xref="InterPro:IPR013342"
FT                   /db_xref="InterPro:IPR017653"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR029065"
FT                   /db_xref="InterPro:IPR034593"
FT                   /db_xref="InterPro:IPR034598"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="SubtiList:BG11161"
FT                   /db_xref="UniProtKB/Swiss-Prot:P42238"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB12043.2"
FT                   /translation="MSSPIQEQVQKEKRSNIPSISEMKVIPVAGHDSMLLNLSGAHSPF
FT                   FTRNIVILTDSSGNQGVGEVPGGEHIRRTLELSEPLVVGKSIGAYQAILQTVRKQFGDQ
FT                   DRGGRGNQTFDLRTTVHAVTALEAALLDLLGKFLQEPVAALLGEGKQRDEVKMLGYLFY
FT                   IGDRNRTTLPYQSDEQSDCAWFRLRHEEALTPEAIVRLAESAQERYGFQDFKLKGGVLR
FT                   GEEEIEAVTALSKRFPEARITLDPNGAWSLEEAIALCKGKQDVLAYAEDPCGDENGYSA
FT                   REVMAEFRRATGLPTATNMIATDWREMGHAIQLHAVDIPLADPHFWTMQGSVRVAQMCH
FT                   DWGLTWGSHSNNHFDISLAMFTHVAAAAPGRITAIDTHWIWQDGQRLTKQPFEISSGCV
FT                   KVPDKPGLGVDIDMEQVEKAHEIYRKMNLGARNDAIPMQFLISNWEFDRKRPCLVR"
FT   gene            273237..273938
FT                   /gene="garR"
FT                   /locus_tag="BSU_02500"
FT                   /old_locus_tag="BSU02500"
FT   CDS_pept        273237..273938
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="garR"
FT                   /locus_tag="BSU_02500"
FT                   /old_locus_tag="BSU02500"
FT                   /product="transcriptional regulator (GntR family)"
FT                   /function="16.3: Control"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 12044674; Product type r:
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BSU02500"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12044"
FT                   /db_xref="GOA:P42239"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="SubtiList:BG11162"
FT                   /db_xref="UniProtKB/Swiss-Prot:P42239"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:12044674"
FT                   /protein_id="CAB12044.2"
FT                   /translation="MYEGLEDLKVDTVNRKTLAKQVIERIVHLLSSGQLRAGDKLPTEM
FT                   ELMDILHVSRPVLREALSSLETLGVITRKTRGGTYFNDKIGMQPFSVMLALATDNLPAI
FT                   IEARMALELGLVTIAAEKINEEELQRLQKTIDDIANSTDNHYGEADKEFHRIIALSANN
FT                   PVVEGMIQSLLITHAKIDSQIPYRERDVTVEYHKKIYDALAKRDPYKAHYHMYEHLKFV
FT                   RDKILKGMDEK"
FT   gene            274029..275561
FT                   /gene="garD"
FT                   /locus_tag="BSU_02510"
FT                   /old_locus_tag="BSU02510"
FT   CDS_pept        274029..275561
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="garD"
FT                   /locus_tag="BSU_02510"
FT                   /old_locus_tag="BSU02510"
FT                   /product="D-galactarate dehydratase"
FT                   /function="16.11: Scavenge (Catabolism)"
FT                   /EC_number="4.2.1.42"
FT                   /note="Evidence 2a: Function from experimental evidences in
FT                   other organisms; PubMedId: 9772162; Product type e :
FT                   enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU02510"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12045"
FT                   /db_xref="GOA:P42240"
FT                   /db_xref="InterPro:IPR007392"
FT                   /db_xref="InterPro:IPR013974"
FT                   /db_xref="InterPro:IPR017654"
FT                   /db_xref="SubtiList:BG11163"
FT                   /db_xref="UniProtKB/Swiss-Prot:P42240"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB12045.2"
FT                   /translation="MAMNLRKNQAPLYIKVHEIDNTAIIVNDGGLPKGTVFSCGLVLEE
FT                   DVPQGHKVALTDLNQGDEIVRYGEVIGFADETIKRGSWIREALVRMPAPPALDDLPLAN
FT                   RVPQPRPPLEGYTFEGYRNADGSAGTKNILGITTSVQCVVGVLDYAVKRIKEELLPKYP
FT                   NVDDVVPLHHQYGCGVAINAPDAVIPIRTIQNLAKHPNFGGEVMVIGLGCEKLLPERIA
FT                   SENDDDILSLQDHRGFAAMIQSILEMAEERLIRLNSRTRVSCPVSDLVIGLQCGGSDAF
FT                   SGVTANPAVGYAADLLVRAGATVLFSEVTEVRDAIHLLTPRAVSEEVGQSLIKEMKWYD
FT                   SYLRRGDADRSANPSPGNKKGGLSNVVEKALGSVAKSGTSPISGVLGPGERAKQKGLLF
FT                   AATPASDFVCGTLQLAAGMNLQVFTTGRGTPYGLAAAPVLKVSTRHSLSEHWADLIDIN
FT                   AGRIATGEASIEDVGWEIFRTILDVASGRKQTWADRWGLHNDLCLFNPAPVT"
FT   gene            275838..276758
FT                   /gene="ycbJ"
FT                   /locus_tag="BSU_02520"
FT                   /old_locus_tag="BSU02520"
FT   CDS_pept        275838..276758
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycbJ"
FT                   /locus_tag="BSU_02520"
FT                   /old_locus_tag="BSU02520"
FT                   /product="putative phosphotransferase"
FT                   /note="Evidence 3: Putative function from multiple
FT                   computational evidences; PubMedId: 12044674; Product type
FT                   e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU02520"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12046"
FT                   /db_xref="GOA:P42242"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="SubtiList:BG11165"
FT                   /db_xref="UniProtKB/Swiss-Prot:P42242"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB12046.1"
FT                   /translation="MTNLNEKQLITEIVGLARSQGLTVHSENAQLNETGMDFQVVFAKD
FT                   DTGMPWVLRKPRRSDVVERASAEGITLAFLRANLTADVPDWRIHTPELIAYPMLKGTPA
FT                   AGIDLEQKQYVWNMDHQPPSDDFVRTLADILAELHGTDQISAGQSGIEVIRPEDFRQMT
FT                   ADSMVDVKNKLGVSTTLWERWQKWVDDDAYWPGFSSLIHGDLHPPHILIDQNGRVTGLL
FT                   DWTEAKVADPAKDFVLYQTIFGEKETARLLEYYDQAGGRIWAKMQEHISEMQAAYPVEI
FT                   AKLALQTQQEEHINMALEALGVTSD"
FT   gene            276815..277062
FT                   /gene="tboW"
FT                   /locus_tag="BSU_misc_RNA_6"
FT   misc_RNA        276815..277062
FT                   /gene="tboW"
FT                   /locus_tag="BSU_misc_RNA_6"
FT                   /product="T-box riboswitch specific of tryptophan tRNA
FT                   ligase"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 1317842, 9098041, 10706627,
FT                   12165569, 12547201; Product type n: RNA"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:1317842, 9098041, 10706627, 12165569, 12547201"
FT   gene            277160..277321
FT                   /gene="rtpA"
FT                   /locus_tag="BSU_02530"
FT                   /old_locus_tag="BSU02530"
FT   CDS_pept        277160..277321
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rtpA"
FT                   /locus_tag="BSU_02530"
FT                   /old_locus_tag="BSU02530"
FT                   /product="anti-TRAP regulator"
FT                   /function="16.3: Control"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 10706627, 11557884, 12855807,
FT                   15099736, 15213402, 15743934, 16306262; Product type r:
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BSU02530"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12047"
FT                   /db_xref="GOA:O31466"
FT                   /db_xref="InterPro:IPR031538"
FT                   /db_xref="InterPro:IPR036410"
FT                   /db_xref="PDB:2BX9"
FT                   /db_xref="PDB:2KO8"
FT                   /db_xref="PDB:2ZP8"
FT                   /db_xref="PDB:2ZP9"
FT                   /db_xref="SubtiList:BG12776"
FT                   /db_xref="UniProtKB/Swiss-Prot:O31466"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:10706627, 11557884, 12855807, 15099736, 15213402,
FT                   15743934, 16306262"
FT                   /protein_id="CAB12047.1"
FT                   /translation="MVIATDDLEVACPKCERAGEIEGTPCPACSGKGVILTAQGYTLLD
FT                   FIQKHLNK"
FT   gene            277342..278280
FT                   /gene="ycbK"
FT                   /locus_tag="BSU_02540"
FT                   /old_locus_tag="BSU02540"
FT   CDS_pept        277342..278280
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycbK"
FT                   /locus_tag="BSU_02540"
FT                   /old_locus_tag="BSU02540"
FT                   /product="putative tryptophan or indole exporter"
FT                   /function="16.1: Circulate"
FT                   /note="Evidence 3: Putative function from multiple
FT                   computational evidences; PubMedId: 10706627, 15063849,
FT                   15849754, 16850406, 16879415, 17114263; Product type t :
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BSU02540"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12048"
FT                   /db_xref="GOA:P42243"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="SubtiList:BG11166"
FT                   /db_xref="UniProtKB/Swiss-Prot:P42243"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB12048.1"
FT                   /translation="MRAEEQSKIREAAAGTIFLLIGTVCFASKSIWIKWAYQMGAEPDA
FT                   VLLYRQLLAVPLFWLIFLIYRPPMPDGKKKGDLWKACGAGVFCFFLSPLLDFIGLNHVS
FT                   AMVERILLMSYPLFVFGFTACRDRKMSSIQDLFAVLAVMFGLFLALGGWNAELFQANMI
FT                   GAVFILLSSAVYAGYLVLSGHLVHQIGGIRLNAYGMTAAGAAMMLYTGIKSAAGMNTPM
FT                   AAYPLSMYGLFAVIAVVTTVIPFVLMLEGIKRIGAQRAAAISMAGPILTIFYGALFLGE
FT                   RLGLIQVIGCGGVFFVITGMEYRKLKTGKKE"
FT   gene            278377..279057
FT                   /gene="ycbL"
FT                   /locus_tag="BSU_02550"
FT                   /old_locus_tag="BSU02550"
FT   CDS_pept        278377..279057
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycbL"
FT                   /locus_tag="BSU_02550"
FT                   /old_locus_tag="BSU02550"
FT                   /product="two-component response regulator [YcbM]"
FT                   /function="16.3: Control"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 11717295; Product type r:
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BSU02550"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12049"
FT                   /db_xref="GOA:P42244"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="SubtiList:BG11167"
FT                   /db_xref="UniProtKB/Swiss-Prot:P42244"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:11717295"
FT                   /protein_id="CAB12049.2"
FT                   /translation="MLVEDDHSISEMVDHYLTKEGFGIVHAFDGEEGIRLFQQGSYDLV
FT                   LLDIMLPKLNGMDFLKIIREKSNIPVLMISAKDGDVDKALGLGFGADDYIAKPFSMIEL
FT                   TARVKAAIRRATQYSAEEPAVNKVIRIHQLAIDIDNVSVLKNGEPLQLTSTEWQLLCLF
FT                   ASNPKKVFTKEQIYRSVWNEEYFDDQNIINVHMRRLREKIEDDPSSPQYIKTLWGIGYK
FT                   LGEF"
FT   gene            279059..279994
FT                   /gene="ycbM"
FT                   /locus_tag="BSU_02560"
FT                   /old_locus_tag="BSU02560"
FT   CDS_pept        279059..279994
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycbM"
FT                   /locus_tag="BSU_02560"
FT                   /old_locus_tag="BSU02560"
FT                   /product="two-component sensor histidine kinase [YcbL]"
FT                   /function="16.3: Control"
FT                   /function="16.12: Sense"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 11717295; Product type rc:
FT                   receptor"
FT                   /db_xref="EnsemblGenomes-Gn:BSU02560"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12050"
FT                   /db_xref="GOA:P42245"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="SubtiList:BG11168"
FT                   /db_xref="UniProtKB/Swiss-Prot:P42245"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:11717295"
FT                   /protein_id="CAB12050.2"
FT                   /translation="MTVLWVAAVIALACLNVIQFIMKKKRDGNLAYTADQLSYMLSRDS
FT                   AGQILLPTDDHALKDLLVNINLIVENRQQISAQFAKTEQSMKRMLTNMSHDLKTPLTVI
FT                   LGYIEAIQSDPNMPDEERERLLGKLRQKTNELIQMINSFFDLAKLESEDKEIPITKVHM
FT                   NDICKRNILHYYDAVQSKGFQAAIDIPDTPVYAQANEEALDRILQNLLSNAIQYGAAGK
FT                   LIGLTLSYDERNIAITVWDRGKGISETDQQRVFERLYTLEESRNKAFQGSGLGLTITKR
FT                   LTEKMGGIISVQSKPYERTAFTITLKRMTY"
FT   gene            280086..281009
FT                   /gene="ycbN"
FT                   /locus_tag="BSU_02570"
FT                   /old_locus_tag="BSU02570"
FT   CDS_pept        280086..281009
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycbN"
FT                   /locus_tag="BSU_02570"
FT                   /old_locus_tag="BSU02570"
FT                   /product="putative ABC efflux transporter (ATP-binding
FT                   protein)"
FT                   /function="16.1: Circulate"
FT                   /note="Evidence 3: Putative function from multiple
FT                   computational evidences; PubMedId: 12486040; Product type
FT                   t: transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BSU02570"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12051"
FT                   /db_xref="GOA:P42246"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="SubtiList:BG11169"
FT                   /db_xref="UniProtKB/Swiss-Prot:P42246"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB12051.2"
FT                   /translation="MTYIVQTNGLTKTYQGKEVVSNVSMHIKKGEIYGFLGPNGAGKTT
FT                   IMKMLTSLVKPTSGEIIILGNKFTHTSYEVLGNIGSMIEYPIFYENLTAEENLDLHCEY
FT                   MGYHNKKAIQEVLDMVNLKQIDKKPVKTFSLGMKQRLGIARAILTKPDLLILDEPVNGL
FT                   DPLGIKKIRQLFQVLSKEYGMTLLISSHLLGEIEQIADTIGVIRDGRLLEEVSMEDVRG
FT                   QNTEYIELVTPNQTRACFVLEKELQLTNFKILNEKTIRIYEAEASQAAISKALILNDVD
FT                   IESMNKKYTSLEDYFIKLINGNSISA"
FT   gene            281028..281714
FT                   /gene="ycbO"
FT                   /locus_tag="BSU_02580"
FT                   /old_locus_tag="BSU02580"
FT   CDS_pept        281028..281714
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycbO"
FT                   /locus_tag="BSU_02580"
FT                   /old_locus_tag="BSU02580"
FT                   /product="putative Na+-driven exporter"
FT                   /function="16.1: Circulate"
FT                   /function="16.6: Maintain"
FT                   /note="Evidence 3: Putative function from multiple
FT                   computational evidences; PubMedId: 15849754, 16850406;
FT                   Product type t: transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BSU02580"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12052"
FT                   /db_xref="GOA:P42247"
FT                   /db_xref="SubtiList:BG11170"
FT                   /db_xref="UniProtKB/Swiss-Prot:P42247"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB12052.3"
FT                   /translation="MNLIRIELRKMKMGWYIRGALIANVIIMGFMWLISYSEKADGGVS
FT                   FQSTDEAFLIIGTFVRAVFIVFGAVLIVKLVISEYKNKTILVMFTYPISRKKLLTAKLM
FT                   IAGGLTFITILLSNILIAAGFFWLNSICHFIPGELTSEIISQQAVKMAVFAFGAAGTSL
FT                   VPIFFGMRRHSVPATIISSVVIVMLISSTSPGFSISSVVYIPLSLAAFGLFFSYMAIRN
FT                   ADKQDA"
FT   gene            complement(281675..281809)
FT                   /locus_tag="BSU_02585"
FT                   /old_locus_tag="BSU02585"
FT   CDS_pept        complement(281675..281809)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSU_02585"
FT                   /old_locus_tag="BSU02585"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5: Unknown function"
FT                   /db_xref="GOA:A0A2K4Z9H7"
FT                   /db_xref="UniProtKB/TrEMBL:A0A2K4Z9H7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="SOX90539.1"
FT                   /translation="MARSIILKQEQTHNGKAGADSIGLLYILGAFVYASCLSAFLIAM"
FT   gene            complement(281769..282155)
FT                   /gene="ycbP"
FT                   /locus_tag="BSU_02590"
FT                   /old_locus_tag="BSU02590"
FT   CDS_pept        complement(281769..282155)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycbP"
FT                   /locus_tag="BSU_02590"
FT                   /old_locus_tag="BSU02590"
FT                   /product="putative inner integral membrane protein"
FT                   /function="16.13: Shape"
FT                   /note="Evidence 3: Putative function from multiple
FT                   computational evidences; PubMedId: 15849754, 16850406,
FT                   22582280; Product type m: membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:BSU02590"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12053"
FT                   /db_xref="GOA:P42248"
FT                   /db_xref="InterPro:IPR019649"
FT                   /db_xref="SubtiList:BG11171"
FT                   /db_xref="UniProtKB/Swiss-Prot:P42248"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB12053.1"
FT                   /translation="MTHVKALAIKGIMTIIVLYLVLGLGFGFTFGDTLLMTIVLGVISY
FT                   LLGDLYVLPKWNNMIATLADFGLAFLVIWLMGMPLSMGMTGGEVALAALFGAIVMAIGE
FT                   YCFHFYMMSKEIGKKHYLETRTDS"
FT   gene            282469..282897
FT                   /gene="cwlJ"
FT                   /locus_tag="BSU_02600"
FT                   /old_locus_tag="BSU02600"
FT   CDS_pept        282469..282897
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cwlJ"
FT                   /locus_tag="BSU_02600"
FT                   /old_locus_tag="BSU02600"
FT                   /product="spore cortex cell wall hydrolase"
FT                   /function="16.3: Control"
FT                   /function="16.5: Explore"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 9515903, 11466292, 11807087,
FT                   12177332, 16936016, 26190134, 28333204; Product type e:
FT                   enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU02600"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12054"
FT                   /db_xref="GOA:P42249"
FT                   /db_xref="InterPro:IPR011105"
FT                   /db_xref="InterPro:IPR042047"
FT                   /db_xref="SubtiList:BG11172"
FT                   /db_xref="UniProtKB/Swiss-Prot:P42249"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:9515903, 11466292, 11807087, 12177332, 16936016,
FT                   26190134, 28333204"
FT                   /protein_id="CAB12054.2"
FT                   /translation="MAVVRATSADVDLMARLLRAEAEGEGKQGMLLVGNVGINRLRANC
FT                   SDFKGLRTIRQMIYQPHAFEAVTHGYFYQRARDSERALARRSINGERRWPAKFSLWYFR
FT                   PQGDCPAQWYNQPFVARFKSHCFYQPTAETCENVYNTF"
FT   gene            283003..283734
FT                   /gene="ycbR"
FT                   /locus_tag="BSU_02610"
FT                   /old_locus_tag="BSU02610"
FT   CDS_pept        283003..283734
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycbR"
FT                   /locus_tag="BSU_02610"
FT                   /old_locus_tag="BSU02610"
FT                   /product="conserved protein of unknown function"
FT                   /note="Evidence 4: Unknown function but conserved in other
FT                   organisms"
FT                   /db_xref="EnsemblGenomes-Gn:BSU02610"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12055"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR019303"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="SubtiList:BG11173"
FT                   /db_xref="UniProtKB/Swiss-Prot:P42250"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB12055.2"
FT                   /translation="MATIDLQKKSVKIVLEKKQLTKVTARVGLVLDITGSMRPLYKNGT
FT                   VQNVVERILAVADQFDDNGLLDVWVYDNEFSRLKPVSEKDFSGYVDREILNNDRLHKFG
FT                   RNDEPPVMKDVLRKYVTEEPSSYPAFIVFINDGGCKKSIKPIIEASSDKPVFWQFVGIG
FT                   NGNFDFLNKLDTLEGRVIDNTNFLHIEEIDRISDDELYDALLAEFPFWLKEAKEKGIVR
FT                   EQEPPAEKPKKKGFFSRLFSK"
FT   gene            283816..283992
FT                   /gene="yczK"
FT                   /locus_tag="BSU_02619"
FT                   /old_locus_tag="BSU02619"
FT   CDS_pept        283816..283992
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yczK"
FT                   /locus_tag="BSU_02619"
FT                   /old_locus_tag="BSU02619"
FT                   /product="conserved protein of unknown function"
FT                   /note="Evidence 4: Unknown function but conserved in other
FT                   organisms"
FT                   /db_xref="EnsemblGenomes-Gn:BSU02619"
FT                   /db_xref="EnsemblGenomes-Tr:CAX52543"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0H3T2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX52543.1"
FT                   /translation="MGGLQTTGYAENASFSQLSACFSSRLVREDLFLMFSAYNQFTLLH
FT                   SRLTMISYNGDDQ"
FT   gene            284011..285762
FT                   /gene="phoD"
FT                   /locus_tag="BSU_02620"
FT                   /old_locus_tag="BSU02620"
FT   CDS_pept        284011..285762
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phoD"
FT                   /locus_tag="BSU_02620"
FT                   /old_locus_tag="BSU02620"
FT                   /product="secreted phosphodiesterase (endo-hydrolysis at
FT                   non-specific sites throughout the cell wall teichoic acid
FT                   polymer)"
FT                   /function="16.11: Scavenge (Catabolism)"
FT                   /EC_number="3.1.4.46"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 11719524, 12867413, 16698798,
FT                   19395490, 19616508, 21479178, 27780866; Product type e:
FT                   enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU02620"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12056"
FT                   /db_xref="GOA:P42251"
FT                   /db_xref="InterPro:IPR008963"
FT                   /db_xref="InterPro:IPR018946"
FT                   /db_xref="InterPro:IPR032093"
FT                   /db_xref="InterPro:IPR038607"
FT                   /db_xref="PDB:2YEQ"
FT                   /db_xref="SubtiList:BG11174"
FT                   /db_xref="UniProtKB/Swiss-Prot:P42251"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:11719524, 12867413, 16698798, 19395490, 19616508,
FT                   21479178, 27780866"
FT                   /protein_id="CAB12056.2"
FT                   /translation="MAYDSRFDEWVQKLKEESFQNNTFDRRKFIQGAGKIAGLSLGLTI
FT                   AQSVGAFEVNAAPNFSSYPFTLGVASGDPLSDSVVLWTRLAPDPLNGGGMPKQAVPVKW
FT                   EVAKDEHFRKIVRKGTEMAKPSLAHSVHVEADGLEPNKVYYYRFKTGHELSPVGKTKTL
FT                   PAPGANVPQMTFAFASCQQYEHGYYTAYKHMAKEKLDLVFHLGDYIYEYGPNEYVSKTG
FT                   NVRTHNSAEIITLQDYRNRHAQYRSDANLKAAHAAFPWVVTWDDHEVENNYANKIPEKG
FT                   QSVEAFVLRRAAAYQAYYEHMPLRISSLPNGPDMQLYRHFTYGNLASFNVLDTRQYRDD
FT                   QANNDGNKPPSDESRNPNRTLLGKEQEQWLFNNLGSSTAHWNVLAQQIFFAKWNFGTSA
FT                   SPIYSMDSWDGYPAQRERVINFIKSKNLNNVVVLTGDVHASWASNLHVDFEKTSSKIFG
FT                   AEFVGTSITSGGNGADKRADTDQILKENPHIQFFNDYRGYVRCTVTPHQWKADYRVMPF
FT                   VTEPGAAISTRASFVYQKDQTGLRKVSSTTIQGGVKQSDEVEEDRFFSHNKAHEKQMIK
FT                   KRAKITN"
FT   gene            285775..285987
FT                   /gene="tatAD"
FT                   /locus_tag="BSU_02630"
FT                   /old_locus_tag="BSU02630"
FT   CDS_pept        285775..285987
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tatAD"
FT                   /locus_tag="BSU_02630"
FT                   /old_locus_tag="BSU02630"
FT                   /product="component of the twin-arginine pre-protein
FT                   translocation pathway"
FT                   /function="16.1: Circulate"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 12867413, 15554971, 16678787,
FT                   19049517, 21479530, 27984091; Product type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BSU02630"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12057"
FT                   /db_xref="GOA:O31467"
FT                   /db_xref="InterPro:IPR003369"
FT                   /db_xref="InterPro:IPR006312"
FT                   /db_xref="PDB:2L16"
FT                   /db_xref="SubtiList:BG12777"
FT                   /db_xref="UniProtKB/Swiss-Prot:O31467"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:12867413, 15554971, 16678787, 19049517, 21479530,
FT                   27984091"
FT                   /protein_id="CAB12057.2"
FT                   /translation="MFSNIGIPGLILIFVIALIIFGPSKLPEIGRAAGRTLLEFKSATK
FT                   SLVSGDEKEEKSAELTAVKQDKNAG"
FT   gene            286048..286776
FT                   /gene="tatCD"
FT                   /locus_tag="BSU_02640"
FT                   /old_locus_tag="BSU02640"
FT   CDS_pept        286048..286776
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tatCD"
FT                   /locus_tag="BSU_02640"
FT                   /old_locus_tag="BSU02640"
FT                   /product="component of the twin-arginine pre-protein
FT                   translocation pathway"
FT                   /function="16.1: Circulate"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 16698798, 19049517, 27984091;
FT                   Product type t: transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BSU02640"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12058"
FT                   /db_xref="GOA:P42252"
FT                   /db_xref="InterPro:IPR002033"
FT                   /db_xref="InterPro:IPR019820"
FT                   /db_xref="SubtiList:BG11175"
FT                   /db_xref="UniProtKB/Swiss-Prot:P42252"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:16698798, 19049517, 27984091"
FT                   /protein_id="CAB12058.2"
FT                   /translation="MDKKETHLIGHLEELRRRIIVTLAAFFLFLITAFLFVQDIYDWLI
FT                   RDLDGKLAVLGPSEILWVYMMLSGICAIAASIPVAAYQLWRFVAPALTKTERKVTLMYI
FT                   PGLFALFLAGISFGYFVLFPIVLSFLTHLSSGHFETMFTADRYFRFMVNLSLPFGFLFE
FT                   MPLVVMFLTRLGILNPYRLAKARKLSYFLLIVVSILITPPDFISDFLVMIPLLVLFEVS
FT                   VTLSAFVYKKRMREETAAAA"
FT   gene            complement(286773..287420)
FT                   /gene="pcp"
FT                   /locus_tag="BSU_02650"
FT                   /old_locus_tag="BSU02650"
FT   CDS_pept        complement(286773..287420)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pcp"
FT                   /locus_tag="BSU_02650"
FT                   /old_locus_tag="BSU02650"
FT                   /product="pyrrolidone-carboxylate (pyroglutamate)
FT                   peptidase"
FT                   /function="16.11: Scavenge (Catabolism)"
FT                   /function="16.6: Maintain"
FT                   /EC_number="3.4.19.3"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 1362573, 28830929; Product
FT                   type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU02650"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12059"
FT                   /db_xref="GOA:P28618"
FT                   /db_xref="InterPro:IPR000816"
FT                   /db_xref="InterPro:IPR016125"
FT                   /db_xref="InterPro:IPR029762"
FT                   /db_xref="InterPro:IPR033693"
FT                   /db_xref="InterPro:IPR033694"
FT                   /db_xref="InterPro:IPR036440"
FT                   /db_xref="SubtiList:BG10873"
FT                   /db_xref="UniProtKB/Swiss-Prot:P28618"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:1362573, 28830929"
FT                   /protein_id="CAB12059.1"
FT                   /translation="MRKKVLITGFDPFDKETVNPSWEAAKRLNGFETEEAIITAEQIPT
FT                   VFRSALDTLRQAIQKHQPDIVICVGQAGGRMQITPERVAINLADARIPDNEGHQPIDEE
FT                   ISPDGPAAYWTRLPVKRMTAKMKEHGIPAAVSYTAGTFVCNYLFYGLMDHISRTSPHIR
FT                   GGFIHIPYIPQQTIDKTAPSLSLDTIVRALRIAAVTAAQYDEDVKSPGGTLH"
FT   gene            287499..288611
FT                   /gene="ycbU"
FT                   /locus_tag="BSU_02660"
FT                   /old_locus_tag="BSU02660"
FT   CDS_pept        287499..288611
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycbU"
FT                   /locus_tag="BSU_02660"
FT                   /old_locus_tag="BSU02660"
FT                   /product="putative lyase (PLP-dependent)"
FT                   /function="16.2: Construct biomass (Anabolism)"
FT                   /note="Evidence 3: Putative function from multiple
FT                   computational evidences; Product type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU02660"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12060"
FT                   /db_xref="GOA:P42253"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR020578"
FT                   /db_xref="SubtiList:BG11176"
FT                   /db_xref="UniProtKB/Swiss-Prot:P42253"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB12060.2"
FT                   /translation="MEHLPEQYRQLFPTLQTHTMLASCSQSALAEPVSRAIQDYYDSLL
FT                   YKGTNWKEAIEKTEFARNEFAKLIGAEPDEVAIVPSVSDALVSVASSLTAFGKKHVVYT
FT                   DMDFPAVPHVWQAHSDYTVSVIPSIDGVLPLEQYETHISDETVLTCVPHVHYRDGYVQD
FT                   IKAIAEISQRKGSLLFVDAYQSAGHIPIDVKEWGVDMLAAGTRKYLLGIPGVAFLYVRK
FT                   ELADALKPKASAWFGRESGFDGAYAKVARRFQTGTPAFISVYAAAAALSLLNHIGVSHI
FT                   RDHVKTICADAVQYAAEKGLQLAAAQGGIQPGMVAIRDERASETAGLLKKKKVICAPRE
FT                   NVIRLAPHFYNTKEEMRHAIDEIAAKTIHK"
FT   gene            complement(288653..290092)
FT                   /gene="lmrB"
FT                   /locus_tag="BSU_02670"
FT                   /old_locus_tag="BSU02670"
FT   CDS_pept        complement(288653..290092)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lmrB"
FT                   /locus_tag="BSU_02670"
FT                   /old_locus_tag="BSU02670"
FT                   /product="flavonoid efflux transporter; drug-export
FT                   protein"
FT                   /function="16.1: Circulate"
FT                   /function="16.8: Protect"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 15317768, 15849754, 16850406,
FT                   17483215; Product type t: transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BSU02670"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12061"
FT                   /db_xref="GOA:O35018"
FT                   /db_xref="InterPro:IPR004638"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="SubtiList:BG12613"
FT                   /db_xref="UniProtKB/Swiss-Prot:O35018"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:15317768, 15849754, 16850406, 17483215"
FT                   /protein_id="CAB12061.1"
FT                   /translation="MILETTAKASQQYKVMPIMISLLLAGFIGMFSETALNIALTDLMK
FT                   ELNITAATVQWLTTGYLLVLGILVPVSGLLLQWFTTRQLFTVSLIFSILGTFIAALAPS
FT                   FSFLLAARIVQALGTGLLLPLMFNTILVIFPPHKRGAAMGTIGLVIMFAPAIGPTFSGL
FT                   VLEHLNWHWIFWISLPFLVLALVFGIAYMQNVSETTKPKIDVLSIILSTIGFGGIVFGF
FT                   SNAGEGSGGWSSPTVIVSLIVGVVGLILFSIRQLTMKQPMMNLRAFKYPMFILGVIMVF
FT                   ICMMVILSSMLLLPMYLQGGLVLTAFASGLVLLPGGILNGFMSPVTGRLFDKYGPKWLV
FT                   IPGFVIVTVVLWFFSNVTTTSTAVLIIILHTCLMIGISMIMMPAQTNGLNQLPREFYPD
FT                   GTAIMNTLQQMAGAIGTAVAVSIMAAGQHDYMSTVKNPADPAVIPQALTAGVQHAFVFA
FT                   MIVAIIGLIGAFFMKRVKVDH"
FT   gene            complement(290132..290698)
FT                   /gene="lmrA"
FT                   /locus_tag="BSU_02680"
FT                   /old_locus_tag="BSU02680"
FT   CDS_pept        complement(290132..290698)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lmrA"
FT                   /locus_tag="BSU_02680"
FT                   /old_locus_tag="BSU02680"
FT                   /product="transcriptional repressor of lmrAB and yxaGH
FT                   operons (flavonoid and antibiotic resistance)"
FT                   /function="16.3: Control"
FT                   /function="16.8: Protect"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 12718394, 15317768, 17483215;
FT                   Product type r: regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BSU02680"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12062"
FT                   /db_xref="GOA:O34619"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="SubtiList:BG12612"
FT                   /db_xref="UniProtKB/Swiss-Prot:O34619"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:12718394, 15317768, 17483215"
FT                   /protein_id="CAB12062.1"
FT                   /translation="MSYGDSREKILSAATRLFQLQGYYGTGLNQIIKESGAPKGSLYYH
FT                   FPGGKEQLAIEAVNEMKEYIRQKIADCMEACTDPAEGIQAFLKELSCQFSCTEDIEGLP
FT                   VGLLAAETSLKSEPLREACHEAYKEWASVYEEKLRQTGCSESRAKEASTVVNAMIEGGI
FT                   LLSLTAKNSTPLLHISSCIPDLLKR"
FT   gene            290915..292042
FT                   /gene="ansZ"
FT                   /locus_tag="BSU_02690"
FT                   /old_locus_tag="BSU02690"
FT   CDS_pept        290915..292042
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ansZ"
FT                   /locus_tag="BSU_02690"
FT                   /old_locus_tag="BSU02690"
FT                   /product="L-asparaginase 2 (putative lipoprotein)"
FT                   /function="16.11: Scavenge (Catabolism)"
FT                   /function="16.6: Maintain"
FT                   /EC_number="3.5.1.1"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 11914346, 17686772; Product
FT                   type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU02690"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12063"
FT                   /db_xref="GOA:O34482"
FT                   /db_xref="InterPro:IPR004550"
FT                   /db_xref="InterPro:IPR006034"
FT                   /db_xref="InterPro:IPR020827"
FT                   /db_xref="InterPro:IPR027473"
FT                   /db_xref="InterPro:IPR027474"
FT                   /db_xref="InterPro:IPR027475"
FT                   /db_xref="InterPro:IPR036152"
FT                   /db_xref="InterPro:IPR037152"
FT                   /db_xref="InterPro:IPR040919"
FT                   /db_xref="SubtiList:BG12755"
FT                   /db_xref="UniProtKB/Swiss-Prot:O34482"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:11914346, 17686772"
FT                   /protein_id="CAB12063.1"
FT                   /translation="MKKQRMLVLFTALLFVFTGCSHSPETKESPKEKAQTQKVSSASAS
FT                   EKKDLPNIRILATGGTIAGADQSKTSTTEYKAGVVGVESLIEAVPEMKDIANVSGEQIV
FT                   NVGSTNIDNKILLKLAKRINHLLASDDVDGIVVTHGTDTLEETAYFLNLTVKSDKPVVI
FT                   VGSMRPSTAISADGPSNLYNAVKVAGAPEAKGKGTLVVLNDRIASARYVTKTNTTTTDT
FT                   FKSEEMGFVGTIADDIYFNNEITRKHTKDTDFSVSNLDELPQVDIIYGYQNDGSYLFDA
FT                   AVKAGAKGIVFAGSGNGSLSDAAEKGADSAVKKGVTVVRSTRTGNGVVTPNQDYAEKDL
FT                   LASNSLNPQKARMLLMLALTKTNDPQKIQAYFNEY"
FT   gene            292205..292843
FT                   /gene="estA"
FT                   /locus_tag="BSU_02700"
FT                   /old_locus_tag="BSU02700"
FT   CDS_pept        292205..292843
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="estA"
FT                   /locus_tag="BSU_02700"
FT                   /old_locus_tag="BSU02700"
FT                   /product="secreted alkaliphilic lipase"
FT                   /function="16.11: Scavenge (Catabolism)"
FT                   /function="16.8: Protect"
FT                   /EC_number="3.1.1.3"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 8396026, 15812018, 18053819,
FT                   11029590, 24827611, 28963005; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU02700"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12064"
FT                   /db_xref="GOA:P37957"
FT                   /db_xref="InterPro:IPR002918"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="PDB:1I6W"
FT                   /db_xref="PDB:1ISP"
FT                   /db_xref="PDB:1R4Z"
FT                   /db_xref="PDB:1R50"
FT                   /db_xref="PDB:1T2N"
FT                   /db_xref="PDB:1T4M"
FT                   /db_xref="PDB:2QXT"
FT                   /db_xref="PDB:2QXU"
FT                   /db_xref="PDB:3D2A"
FT                   /db_xref="PDB:3D2B"
FT                   /db_xref="PDB:3D2C"
FT                   /db_xref="PDB:3QMM"
FT                   /db_xref="PDB:3QZU"
FT                   /db_xref="PDB:5CRI"
FT                   /db_xref="PDB:5CT4"
FT                   /db_xref="PDB:5CT5"
FT                   /db_xref="PDB:5CT6"
FT                   /db_xref="PDB:5CT8"
FT                   /db_xref="PDB:5CT9"
FT                   /db_xref="PDB:5CTA"
FT                   /db_xref="PDB:5CUR"
FT                   /db_xref="SubtiList:BG10679"
FT                   /db_xref="UniProtKB/Swiss-Prot:P37957"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:8396026, 15812018, 18053819, 11029590, 24827611,
FT                   28963005"
FT                   /protein_id="CAB12064.1"
FT                   /translation="MKFVKRRIIALVTILMLSVTSLFALQPSAKAAEHNPVVMVHGIGG
FT                   ASFNFAGIKSYLVSQGWSRDKLYAVDFWDKTGTNYNNGPVLSRFVQKVLDETGAKKVDI
FT                   VAHSMGGANTLYYIKNLDGGNKVANVVTLGGANRLTTGKALPGTDPNQKILYTSIYSSA
FT                   DMIVMNYLSRLDGARNVQIHGVGHIGLLYSSQVNSLIKEGLNGGGQNTN"
FT   gene            complement(292881..293264)
FT                   /gene="yczC"
FT                   /locus_tag="BSU_02710"
FT                   /old_locus_tag="BSU02710"
FT   CDS_pept        complement(292881..293264)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yczC"
FT                   /locus_tag="BSU_02710"
FT                   /old_locus_tag="BSU02710"
FT                   /product="putative integral membrane protein of unknown
FT                   function"
FT                   /note="Evidence 4: Unknown function but conserved in other
FT                   organisms; PubMedId: 15849754, 16850406; Product type m:
FT                   membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:BSU02710"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12065"
FT                   /db_xref="GOA:O31469"
FT                   /db_xref="InterPro:IPR010432"
FT                   /db_xref="SubtiList:BG12778"
FT                   /db_xref="UniProtKB/Swiss-Prot:O31469"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB12065.1"
FT                   /translation="MELAGFMLRACALLLDVIIAAAVILAAGFTFGDGSAGVIIVAILM
FT                   LIVYPLLMPLTNWKGTLGKKIIGLQIVRDETYKKISFPQAIVRYLIAWVHVFSRLIYLT
FT                   AAFTKKKQTVHDMAAKTIVLKAE"
FT   gene            293499..294575
FT                   /gene="yccF"
FT                   /locus_tag="BSU_02720"
FT                   /old_locus_tag="BSU02720"
FT   CDS_pept        293499..294575
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yccF"
FT                   /locus_tag="BSU_02720"
FT                   /old_locus_tag="BSU02720"
FT                   /product="conserved protein of unknown function"
FT                   /note="Evidence 4: Unknown function but conserved in other
FT                   organisms"
FT                   /db_xref="EnsemblGenomes-Gn:BSU02720"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12066"
FT                   /db_xref="GOA:O34478"
FT                   /db_xref="InterPro:IPR004027"
FT                   /db_xref="InterPro:IPR007889"
FT                   /db_xref="InterPro:IPR036915"
FT                   /db_xref="SubtiList:BG12756"
FT                   /db_xref="UniProtKB/Swiss-Prot:O34478"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB12066.1"
FT                   /translation="MGKVKRNAPCPCGSGKKYKKCCGSKVVDFPAELAAKEAKQIQEDL
FT                   VEYAFTVHRESISGFINQHDFLSAMDRQTKDISVFNLGIWGIFFHPLAGEKTIFEEYLQ
FT                   KKGDSITRPKTREIVESWQSMTPALLLLKDLKEGIIHFEDVITAKQFEVEMDASNQDLP
FT                   PVGSLILGYPIHEAEKAEFFMQFTIFPVKRTEALISKVKKYADAAVKDGKTPEDFMKQE
FT                   FNNVLFALLAEKDEEPQAEKAEVSTVEWANDLEKETAAAIEEGMSGEEYPTELIPAVID
FT                   IWKTFCEKKSPVIRKPEAFAAAVEYYVNAISLNGASVSQAKLAKKYGVSASTISSRYKE
FT                   IESTLQDEADRFAQALSS"
FT   gene            complement(294615..295571)
FT                   /gene="natK"
FT                   /locus_tag="BSU_02730"
FT                   /old_locus_tag="BSU02730"
FT   CDS_pept        complement(294615..295571)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="natK"
FT                   /locus_tag="BSU_02730"
FT                   /old_locus_tag="BSU02730"
FT                   /product="two-component sensor histidine kinase [NatR]"
FT                   /function="16.12: Sense"
FT                   /function="16.3: Control"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 11717295, 17322186; Product
FT                   type rc: receptor"
FT                   /db_xref="EnsemblGenomes-Gn:BSU02730"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12067"
FT                   /db_xref="GOA:P70954"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR032834"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="SubtiList:BG11997"
FT                   /db_xref="UniProtKB/Swiss-Prot:P70954"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:11717295, 17322186"
FT                   /protein_id="CAB12067.1"
FT                   /translation="MITLFQCLYLILFSFICYQGAAAFSHSTAASWLAAALGAAAAGLY
FT                   IWNTKRVWKHCSSGLCAWIAVIQVMSVGVVLIGTDIMPVLCVIAIFAGCEGLRIGQSAL
FT                   QARLSDQIDKLTQAEQHANQMLIDVRSRNHDTMKHITAIKSAQPKADTQAYIQNWADQY
FT                   SQYDRFLKGENAYVAGVLYDFLEKARASNVSVSLHMHTPLSSLPFSPADQVSLVGNILE
FT                   NALDSAAEAREKAEIKLETSLRSGLYVLTCENSTPGMDPKVLDTIYQSFGRSTKNGAHE
FT                   GMGTYIIQKLVKGAFGRLDFTYRHPIFRLEIKIPFQK"
FT   gene            complement(295584..296285)
FT                   /gene="natR"
FT                   /locus_tag="BSU_02740"
FT                   /old_locus_tag="BSU02740"
FT   CDS_pept        complement(295584..296285)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="natR"
FT                   /locus_tag="BSU_02740"
FT                   /old_locus_tag="BSU02740"
FT                   /product="two-component response regulator [NatK]"
FT                   /function="16.3: Control"
FT                   /function="16.8: Protect"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 11717295, 17322186; Product
FT                   type r: regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BSU02740"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12068"
FT                   /db_xref="GOA:P70955"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR007492"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="SubtiList:BG11998"
FT                   /db_xref="UniProtKB/Swiss-Prot:P70955"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:11717295, 17322186"
FT                   /protein_id="CAB12068.1"
FT                   /translation="MVKVGLVDDYRVDLEKLEAIVSRMQDVEIVFSTDSAKEAYRRVKN
FT                   GDIDLLLADIEMPHMSGYELADLIKSHSLDVDVIFVTGHGGYAVHAFDLNVHDYIMKPY
FT                   YADRLAASFDRYLKKKTETSLNGRILIKQKSEMHVLQKKDIIFAERTGRSTTIVTTAEE
FT                   VQTYQTLNDIKGDLPEKDFLRSHRSFIINIHYIKHFSAYTKHSFTVSFEGTSKKAMITK
FT                   QQLDYFQNYYF"
FT   gene            296429..297169
FT                   /gene="natA"
FT                   /locus_tag="BSU_02750"
FT                   /old_locus_tag="BSU02750"
FT   CDS_pept        296429..297169
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="natA"
FT                   /locus_tag="BSU_02750"
FT                   /old_locus_tag="BSU02750"
FT                   /product="Na+ ABC efflux transporter (ATP-binding protein)"
FT                   /function="16.1: Circulate"
FT                   /function="16.8: Protect"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 10356997, 17322186; Product
FT                   type t: transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BSU02750"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12069"
FT                   /db_xref="GOA:P46903"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="SubtiList:BG11338"
FT                   /db_xref="UniProtKB/Swiss-Prot:P46903"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:10356997, 17322186"
FT                   /protein_id="CAB12069.1"
FT                   /translation="MITLTDCSRRFQDKKKVVKAVRDVSLTIEKGEVVGILGENGAGKT
FT                   TMLRMIASLLEPSQGVITVDGFDTVKQPAEVKQRIGVLFGGETGLYDRMTAKENLQYFG
FT                   RLYGLNRHEIKARIEDLSKRFGMRDYMNRRVGGFSKGMRQKVAIARALIHDPDIILFDE
FT                   PTTGLDITSSNIFREFIQQLKREQKTILFSSHIMEEVQALCDSVIMIHSGEVIYRGALE
FT                   SLYESERSEDLNYIFMSKLVRGIS"
FT   gene            297170..298330
FT                   /gene="natB"
FT                   /locus_tag="BSU_02760"
FT                   /old_locus_tag="BSU02760"
FT   CDS_pept        297170..298330
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="natB"
FT                   /locus_tag="BSU_02760"
FT                   /old_locus_tag="BSU02760"
FT                   /product="Na+ ABC efflux transporter (permease)"
FT                   /function="16.1: Circulate"
FT                   /function="16.8: Protect"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 10356997, 15849754, 16850406,
FT                   17322186; Product type t: transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BSU02760"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12070"
FT                   /db_xref="GOA:P46904"
FT                   /db_xref="InterPro:IPR032688"
FT                   /db_xref="SubtiList:BG11339"
FT                   /db_xref="UniProtKB/Swiss-Prot:P46904"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:10356997, 15849754, 16850406, 17322186"
FT                   /protein_id="CAB12070.1"
FT                   /translation="MLSHIYKKEMIDALRDRKTILLTILVPMIMMLGLVFFYESMLSDK
FT                   GEQYTLAVGHSLPPALESKLNEIDEISVKTFAKPEEAVDEGKADAYLNVPKEFDSYVNS
FT                   MTPFKVDVYGNSIDQGSSNAMQLVQSALDQYKNEIVQQRLTNKHIDQSVIQPFTIQQKE
FT                   ADEEKGTSAIMLSAILPMLILTSIVSGAMPIALDIMAGEKDRKSIEALLLTPVSRNKVL
FT                   VGKWLAVSTFGVASGVFALVFLILSTVLFTENLKTAFQLGDHMWSVIGASALIIVLSAL
FT                   LISAMELFISIMSSSVKEAQSYMSLVVFLPVFPMFFIFSKAPNQFDLSYFLIPFLNLHA
FT                   LFKQLLFGMVDPATILSTSGTIAVLIAIFFLLARACFLKDKWVLPK"
FT   gene            298466..299398
FT                   /gene="yccK"
FT                   /locus_tag="BSU_02770"
FT                   /old_locus_tag="BSU02770"
FT   CDS_pept        298466..299398
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yccK"
FT                   /locus_tag="BSU_02770"
FT                   /old_locus_tag="BSU02770"
FT                   /product="putative ion channel associated aldo-keto
FT                   reductase"
FT                   /function="16.1: Circulate"
FT                   /EC_number="1.-.-.-"
FT                   /note="Evidence 3: Putative function from multiple
FT                   computational evidences; PubMedId: 17322186, 24330391;
FT                   Product type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU02770"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12071"
FT                   /db_xref="GOA:P46905"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="SubtiList:BG11340"
FT                   /db_xref="UniProtKB/Swiss-Prot:P46905"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB12071.1"
FT                   /translation="MDQTRTLGKTKLKVKRIGFGANAVGGHNLFPNLNDETGKDLVRTA
FT                   LDGGVNFIDTAFIYGLGRSEELIGEVVQERGVRNELIIATKGAHKEVDGSIELDNSREF
FT                   LRSEVEKSLKRLKTDYIDLYYVHFPDGKTPLAEVAGTLKELKDEGKIKAIGASNLDYQQ
FT                   LQDFNADGYLEVFQAEYSLIQRDAEKELLPYCEKQGISFIPYFPLASGLLTGKFTQDTV
FT                   FDDFRKDKPQFQGETFIHNLKKVDKLKAVAEEKQADTAHVALAWLLTRPAIDAIIPGAK
FT                   RPEQLQDNLKTLNIELTEDEVNFISDIFK"
FT   gene            complement(299438..300502)
FT                   /gene="ycdA"
FT                   /locus_tag="BSU_02780"
FT                   /old_locus_tag="BSU02780"
FT   CDS_pept        complement(299438..300502)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycdA"
FT                   /locus_tag="BSU_02780"
FT                   /old_locus_tag="BSU02780"
FT                   /product="lipoprotein involved in swarming behaviour"
FT                   /note="Evidence 1b: Function from experimental evidences in
FT                   the studied species; PubMedId: 22496484; Product type lp:
FT                   lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:BSU02780"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12072"
FT                   /db_xref="GOA:O34538"
FT                   /db_xref="InterPro:IPR029050"
FT                   /db_xref="InterPro:IPR029051"
FT                   /db_xref="InterPro:IPR031343"
FT                   /db_xref="PDB:4R4G"
FT                   /db_xref="SubtiList:BG12757"
FT                   /db_xref="UniProtKB/Swiss-Prot:O34538"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB12072.1"
FT                   /translation="MFQKKTYAVFLILLLMMFTAACSGSKTSAEKKESETEKSSDIAQV
FT                   KIKDVSYTLPSKYDKSTSDDQLVLKVNVAVKNTGKDPLNVDSMDFTLYQGDTKMSDTDP
FT                   EDYSEKLQGSTINADKSVEGNLFFVVDKGKQYELNYTPESYGDKKPKSVTFKIDGKDKK
FT                   ILATADKLQDSAKALSAYVDVLLFGKDNADFEKITGANKNEIVNDFNESAKDGYLSASG
FT                   LSSTYADSKALDNIVNGIKEGLSKNSSIQAKTTSISKDEAIVEATVKPVDASSLSDRIE
FT                   DKVKDYYSKNSSASYEEAVKYALQVYPEEFKKLGPASSEKTVEVKMKKNDIDQWQLDMD
FT                   DYRAAELVEAFIKE"
FT   gene            complement(300525..300656)
FT                   /locus_tag="BSU_02785"
FT                   /old_locus_tag="BSU02785"
FT   CDS_pept        complement(300525..300656)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSU_02785"
FT                   /old_locus_tag="BSU02785"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5: Unknown function"
FT                   /db_xref="UniProtKB/TrEMBL:A0A2K4Z9F5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="SOX90540.1"
FT                   /translation="MTKEGGVSRKSGENREKRTDFFGYMMLIHSKRSISQRQKTPLS"
FT   gene            300830..302248
FT                   /gene="ycdB"
FT                   /locus_tag="BSU_02790"
FT                   /old_locus_tag="BSU02790"
FT   CDS_pept        300830..302248
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycdB"
FT                   /locus_tag="BSU_02790"
FT                   /old_locus_tag="BSU02790"
FT                   /product="conserved protein of unknown function"
FT                   /function="16.6: Maintain"
FT                   /function="16.11: Scavenge (Catabolism)"
FT                   /note="Evidence 4: Unknown function but conserved in other
FT                   organisms"
FT                   /db_xref="EnsemblGenomes-Gn:BSU02790"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12073"
FT                   /db_xref="InterPro:IPR032599"
FT                   /db_xref="SubtiList:BG12758"
FT                   /db_xref="UniProtKB/Swiss-Prot:O34621"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB12073.1"
FT                   /translation="MKGAAFVKKEGLKQKALEIGRVPTHLKLEIEDYGGDDKRAHFCWA
FT                   DPQDENTGIIVELGPDGELESLSRDIEPESGERLSEEKLEDIMRQFVETHHPGALSAFV
FT                   REENDRAYGDKVRFSYVQMEAGLPLPMSGFMADVSLSGEIVYFRYYGEAGSIIKPKRVA
FT                   DVEEALAFIKKDVEFDLLFEVLHRSVYKNGDDQPHLVYEPEGRAITVPADLVQEEQAVD
FT                   DDDDYREPESFPLPLFEGIREKADPDSMIGIENGFVKEREADLGDGRIGIVWRNPDDPV
FT                   YQPADKSMDSWFKGRTHQVLKTIYNKETGKLEGVMSFMEKKGPLTVTLAECEKIALRFL
FT                   FALFPNADQYFRIRYDEKDEEENAVAGFTFEAHCHGVPLRFGQIRICVSRQTGYITVYM
FT                   GPDIDPNKLATIDPVPAISVEQAKSIFWQHFKVELGWEREYGDDEEHSYRLVYKPVYPH
FT                   FIDAHTGEPVFSIW"
FT   gene            302435..303796
FT                   /gene="ycdC"
FT                   /locus_tag="BSU_02800"
FT                   /old_locus_tag="BSU02800"
FT   CDS_pept        302435..303796
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycdC"
FT                   /locus_tag="BSU_02800"
FT                   /old_locus_tag="BSU02800"
FT                   /product="conserved protein of unknown function"
FT                   /function="16.6: Maintain"
FT                   /function="16.11: Scavenge (Catabolism)"
FT                   /note="Evidence 4: Unknown function but conserved in other
FT                   organisms"
FT                   /db_xref="EnsemblGenomes-Gn:BSU02800"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12074"
FT                   /db_xref="InterPro:IPR032599"
FT                   /db_xref="SubtiList:BG12759"
FT                   /db_xref="UniProtKB/Swiss-Prot:O34772"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB12074.1"
FT                   /translation="MVNKQLKKKAQEIGNVPTHYELEIEDYDQKQKKYGQAYFIWKDPK
FT                   DPEKHITVELRNDGALLTFSTTVHSETDKKLPDAELKLTALQFAAANHPGTFMNFHFQG
FT                   KEERGQHIRFVYTKMELGLPIPNSGFLIDMTRSGQIVHFLYYGEGHKAEVPTEFVAKEK
FT                   VVSHYLNTMSFELMYDVIDGEQEPRLVYEPILPGYSYPADVDEIVPDQHIADERIENTA
FT                   PLPPLQNKEEVDIFALLGFTSDMQKVSERDFGEQIGSTWRRGAAPERKDLSIGSYFETR
FT                   NKNTIKMKTDKRTGKLKAALSFMDWRNNLQCSTEECQEIALQFLYALYPRAAEFFRVNP
FT                   VRIDERGRVRNHFSVWYKGVPLRFGAARIIVNPETGLIDAFMAPDIEPEQLEAINHRPD
FT                   VSAEEAKEAFLAAFDVKLEWQPDFTAGSDQHCKLVYKPVYPSYIDAHIRKKKRL"
FT   gene            complement(303804..304307)
FT                   /gene="cwlK"
FT                   /locus_tag="BSU_02810"
FT                   /old_locus_tag="BSU02810"
FT   CDS_pept        complement(303804..304307)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cwlK"
FT                   /locus_tag="BSU_02810"
FT                   /old_locus_tag="BSU02810"
FT                   /product="murein L,D:-endopeptidase"
FT                   /function="16.11: Scavenge (Catabolism)"
FT                   /EC_number="3.4.-.-"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 17588176; Product type e:
FT                   enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU02810"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12075"
FT                   /db_xref="GOA:O34360"
FT                   /db_xref="InterPro:IPR009045"
FT                   /db_xref="InterPro:IPR039561"
FT                   /db_xref="SubtiList:BG12760"
FT                   /db_xref="UniProtKB/Swiss-Prot:O34360"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:17588176"
FT                   /protein_id="CAB12075.1"
FT                   /translation="MNLPAKTFVILCILFLLDLCFSYIRHEWHSQNALQDMPVPSDLHP
FT                   IVKQNADALKAAAANKGIDVVITEGFRSFKEQDELYKQGRTKKGNIVTYARGGESYHNY
FT                   GLAIDFALQKKDGSIIWDMEYDGNQNGKSDWLEVVEIAKTLGFEWGGDWKRFKDYPHLE
FT                   MIPN"
FT   gene            304430..305551
FT                   /gene="rapJ"
FT                   /locus_tag="BSU_02820"
FT                   /old_locus_tag="BSU02820"
FT   CDS_pept        304430..305551
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rapJ"
FT                   /locus_tag="BSU_02820"
FT                   /old_locus_tag="BSU02820"
FT                   /product="response regulator aspartate phosphatase"
FT                   /function="16.3: Control"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 16816200; Product type e:
FT                   enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU02820"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12076"
FT                   /db_xref="GOA:O34327"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR040702"
FT                   /db_xref="PDB:4GYO"
FT                   /db_xref="SubtiList:BG12663"
FT                   /db_xref="UniProtKB/Swiss-Prot:O34327"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:16816200"
FT                   /protein_id="CAB12076.1"
FT                   /translation="MRAKIPSEEVAVKLNEWYKLIRAFEADQAEALKQEIEYDLEDMEE
FT                   NQDLLLYFSLMEFRHRIMLDKLMPVKDSDTKPPFSDMLNEIESNQQKLTGLLEYYFYYF
FT                   RGMYEFKQKNFILAIDHYKHAEEKLEYVEDEIEKAEFLFKVAEVYYHIKQTYFSMNYAS
FT                   QALDIYTKYELYGRRRVQCEFIIAGNLTDVYHHEKALTHLCSALEHARQLEEAYMIAAA
FT                   YYNVGHCKYSLGDYKEAEGYFKTAAAIFEEHNFQQAVQAVFSLTHIYCKEGKYDKAVEA
FT                   YDRGIKSAAEWEDDMYLTKFRLIHELYLGSGDLNVLTECFDLLESRQLLADAEDLLHDT
FT                   AERFNQLEHYESAAFFYRRLMNIKKKLAEQRFQ"
FT   gene            305658..306434
FT                   /gene="ycdF"
FT                   /locus_tag="BSU_02830"
FT                   /old_locus_tag="BSU02830"
FT   CDS_pept        305658..306434
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycdF"
FT                   /locus_tag="BSU_02830"
FT                   /old_locus_tag="BSU02830"
FT                   /product="putative oxidoreductase"
FT                   /function="16.11: Scavenge (Catabolism)"
FT                   /EC_number="1.1.1.-"
FT                   /note="Evidence 3: Putative function from multiple
FT                   computational evidences; PubMedId: 10220166, 11948145,
FT                   15805528; Product type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU02830"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12077"
FT                   /db_xref="GOA:P80869"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="SubtiList:BG12761"
FT                   /db_xref="UniProtKB/Swiss-Prot:P80869"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB12077.1"
FT                   /translation="MYKDLTGKTAIVTGSSKGIGKAIAERFGKEKMNVVVNYHSDPSGA
FT                   DETLEIIKQNGGKAVSVEADVSKEEGIQALLDTALEHFGTLDVMVNNSGFNGVEAMPHE
FT                   MSLEDWQRVIDVNVTGTFLGAKAALNHMMKNNIKGNVLNISSVHQQIPRPVNVQYSTSK
FT                   GGIKMMTETLALNYADKGIRVNAIAPGTIATESNVDTKKEESRQKQLKKIPMKAFGKPE
FT                   EVAAAAAWLVSEEASYVTGATLFVDGGMTLYPSQLE"
FT   gene            306459..308144
FT                   /gene="ycdG"
FT                   /locus_tag="BSU_02840"
FT                   /old_locus_tag="BSU02840"
FT   CDS_pept        306459..308144
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycdG"
FT                   /locus_tag="BSU_02840"
FT                   /old_locus_tag="BSU02840"
FT                   /product="putative oligo-carbohydrate hydrolase"
FT                   /function="16.11: Scavenge (Catabolism)"
FT                   /EC_number="3.2.1.10"
FT                   /note="Evidence 3: Putative function from multiple
FT                   computational evidences; PubMedId: 11544224; Product type
FT                   e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU02840"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12078"
FT                   /db_xref="GOA:O34364"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="SubtiList:BG12762"
FT                   /db_xref="UniProtKB/Swiss-Prot:O34364"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB12078.1"
FT                   /translation="MKTDWWKDAVVYQIYPRSFQDSNGDGIGDLRGIISRLDYIKELGA
FT                   DVIWICPIYPSPNVDYGYDVTNHKAIMDSYGTMDDFHELLDQVHQRGLKLVMDFVLNHT
FT                   SVEHPWFKEAELDKNSKYRSYYYWRPGTKNGPPTDWLSNYGCPVWQYEEHTGEYYLHMN
FT                   AVKQADLNWENPEVRQAVYDMMKFWLDKGVDGLRIDQLHLISKKEYLPSYEDYINQQAE
FT                   PKPFQPNGERIHDYLKEITDEVFSHYDVMSVGEVGSVTPEEGLKYTGTDKHELNMIFHF
FT                   QHMELDQQPGKEHWDLKPLELSDLKSVLTKWQKKLEHQGWNTLFWCNHDQPRIVSRFGD
FT                   DGEYRKASAKMLAAVIYFMKGTPYIYQGEEIGMTNAPFTRIEDYKDIQTINMYHKRVFE
FT                   KGYDPNDVMRSILAKSRDHARTPMQWNSGKNAGFTDGTPWLKVNPNFTAINVEEAQGDP
FT                   DSVLNYYKKLISLRKQYADLMKGSFDLLLPDDPQLFVYMRENSKQQLLSVNNFSKEQAV
FT                   FQWPKNCGKAQASLLLSNYNNDDLDDEMVFRPYESRVYLLDKTN"
FT   gene            308332..309291
FT                   /gene="znuA"
FT                   /locus_tag="BSU_02850"
FT                   /old_locus_tag="BSU02850"
FT   CDS_pept        308332..309291
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="znuA"
FT                   /locus_tag="BSU_02850"
FT                   /old_locus_tag="BSU02850"
FT                   /product="Zn(II)-binding lipoprotein"
FT                   /function="16.1: Circulate"
FT                   /note="Evidence 2a: Function from experimental evidences in
FT                   other organisms; PubMedId: 9379902, 12426338, 14730579,
FT                   21813502; Product type lp: lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:BSU02850"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12079"
FT                   /db_xref="GOA:O34966"
FT                   /db_xref="InterPro:IPR006127"
FT                   /db_xref="InterPro:IPR006128"
FT                   /db_xref="InterPro:IPR006129"
FT                   /db_xref="PDB:2O1E"
FT                   /db_xref="SubtiList:BG12763"
FT                   /db_xref="UniProtKB/Swiss-Prot:O34966"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB12079.1"
FT                   /translation="MFKKWSGLFVIAACFLLVAACGNSSTKGSADSKGDKLHVVTTFYP
FT                   MYEFTKQIVKDKGDVDLLIPSSVEPHDWEPTPKDIANIQDADLFVYNSEYMETWVPSAE
FT                   KSMGQGHAVFVNASKGIDLMEGSEEEHEEHDHGEHEHSHAMDPHVWLSPVLAQKEVKNI
FT                   TAQIVKQDPDNKEYYEKNSKEYIAKLQDLDKLYRTTAKKAEKKEFITQHTAFGYLAKEY
FT                   GLKQVPIAGLSPDQEPSAASLAKLKTYAKEHNVKVIYFEEIASSKVADTLASEIGAKTE
FT                   VLNTLEGLSKEEQDKGLGYIDIMKQNLDALKDSLLVKS"
FT   gene            309347..310042
FT                   /gene="znuC"
FT                   /locus_tag="BSU_02860"
FT                   /old_locus_tag="BSU02860"
FT   CDS_pept        309347..310042
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="znuC"
FT                   /locus_tag="BSU_02860"
FT                   /old_locus_tag="BSU02860"
FT                   /product="Zn(II) transporter (ATP-binding protein)"
FT                   /function="16.1: Circulate"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 9379902, 9811636, 21813502;
FT                   Product type t: transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BSU02860"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12080"
FT                   /db_xref="GOA:O34946"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="SubtiList:BG12764"
FT                   /db_xref="UniProtKB/Swiss-Prot:O34946"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:9379902, 9811636, 21813502"
FT                   /protein_id="CAB12080.1"
FT                   /translation="MNLVSLKDIVFGYSHTPVLDKVSLDIESGEFVGITGPNGASKSTL
FT                   IKVMLGMLKPWEGTVTISKRNTEGKRLTIGYVPQQISSFNAGFPSTVLELVQSGRYTKG
FT                   KWFKRLNEEDHLEVEKALKMVEMWDLRHRKIGDLSGGQKQKICIARMLASNPDLLMLDE
FT                   PTTAVDYDSRKGFYEFMHHLVKNHNRTVVMVTHEQNEVQQFLDKVIRLERGEKGGWKCL
FT                   TWNSCDELF"
FT   gene            310000..310842
FT                   /gene="znuB"
FT                   /locus_tag="BSU_02870"
FT                   /old_locus_tag="BSU02870"
FT   CDS_pept        310000..310842
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="znuB"
FT                   /locus_tag="BSU_02870"
FT                   /old_locus_tag="BSU02870"
FT                   /product="high affinity Zn(II) ABC transporter (permease)"
FT                   /function="16.1: Circulate"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 15849754, 16850406, 9379902,
FT                   9811636, 21813502; Product type t: transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BSU02870"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12081"
FT                   /db_xref="GOA:O34610"
FT                   /db_xref="InterPro:IPR001626"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="SubtiList:BG12765"
FT                   /db_xref="UniProtKB/Swiss-Prot:O34610"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:15849754, 16850406, 9379902, 9811636, 21813502"
FT                   /protein_id="CAB12081.1"
FT                   /translation="MEMFDLEFMRRAFLAGGMIAVMAPILGVYLVLRRQALMADTLSHI
FT                   SLSGVAIGFFLSTNITAASIVVVTIGAIGIEYMRRAYRTYSEVSIAILMAAGLSFAMFL
FT                   ISLSKGTANMSIDQYLFGSLVTVNQQQVYIISIITLLILLYFIVLRRPLYLLTFDEATA
FT                   KTSGINTNVLSLSFSIVTGLAISVIIPIIGVLLVSALLVLPAAFAIRIAKGFNMVFITA
FT                   ILISLFSVFTGLTSSYQLGTPPGPSITLLLIVLLLIGFAVQGVWTFIKKEAQRKKRSR"
FT   gene            complement(310880..311875)
FT                   /gene="yceB"
FT                   /locus_tag="BSU_02880"
FT                   /old_locus_tag="BSU02880"
FT   CDS_pept        complement(310880..311875)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yceB"
FT                   /locus_tag="BSU_02880"
FT                   /old_locus_tag="BSU02880"
FT                   /product="putative luciferase-like monooxygenase"
FT                   /function="16.11: Scavenge (Catabolism)"
FT                   /note="Evidence 3: Putative function from multiple
FT                   computational evidences; PubMedId: 16428414; Product type
FT                   e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU02880"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12082"
FT                   /db_xref="GOA:O34504"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR019949"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="SubtiList:BG12766"
FT                   /db_xref="UniProtKB/Swiss-Prot:O34504"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB12082.2"
FT                   /translation="MIHLSILDQAPVSKGESPVTTLQHSVELAQLSEQWGYKRYWFAEH
FT                   HSTKGLASTAPEIMIARIAAQTNTIRVGSGGVLLPQYSPFKVAETFRQLEALYPNRIDL
FT                   GVGRSPGGTTKTRLALTDGVKKSLTEFNRQLQDVSYFLTDSLPPDHPYAGIKAAPLIGT
FT                   APELWVLGLGENSARRAAHQGIGYVFGHFINPERGENAFRIYRESFRPSAHFSNPSALF
FT                   TIFVICAKTDEEAEELALSQDLWLLRVGKGLDSRVPSIEEAKAHPYTASDKKLIEENRK
FT                   RMVIGSPTTVKQQLLDLTGCYETNEIMVLCNVFDFEAKKESYERLAELFL"
FT   gene            312159..312758
FT                   /gene="yceC"
FT                   /locus_tag="BSU_02890"
FT                   /old_locus_tag="BSU02890"
FT   CDS_pept        312159..312758
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yceC"
FT                   /locus_tag="BSU_02890"
FT                   /old_locus_tag="BSU02890"
FT                   /product="putative stress adaptation protein (tellurite
FT                   resistance)"
FT                   /function="16.8: Protect"
FT                   /note="Evidence 3: Putative function from multiple
FT                   computational evidences; PubMedId: 24366250; Product type
FT                   f: factor"
FT                   /db_xref="EnsemblGenomes-Gn:BSU02890"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12083"
FT                   /db_xref="GOA:P81100"
FT                   /db_xref="InterPro:IPR003325"
FT                   /db_xref="SubtiList:BG12767"
FT                   /db_xref="UniProtKB/Swiss-Prot:P81100"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB12083.1"
FT                   /translation="MAISLEKGQRIDLTKGKAGLSKLMVGLGWDPVSSGGGFFSKLLGG
FT                   GGPNIDCDASVLMLENGKFTDKKNLIYFGNLKSRCGGVQHTGDNLTGDGAGDDEQIMID
FT                   LDKVPGNIDKLVFVVNIYDCVRRKQDFGMIQNAFIRVVDQSNHEEMLKYNLRDNYAGRT
FT                   SLITAEIYRSGSEWKFAAVGEGTNDTRLEDIISRYV"
FT   gene            312780..313361
FT                   /gene="yceD"
FT                   /locus_tag="BSU_02900"
FT                   /old_locus_tag="BSU02900"
FT   CDS_pept        312780..313361
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yceD"
FT                   /locus_tag="BSU_02900"
FT                   /old_locus_tag="BSU02900"
FT                   /product="putative stress adaptation protein (tellurite
FT                   resistance)"
FT                   /function="16.8: Protect"
FT                   /note="Evidence 3: Putative function from multiple
FT                   computational evidences; PubMedId: 22720735, 24366250;
FT                   Product type f: factor"
FT                   /db_xref="EnsemblGenomes-Gn:BSU02900"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12084"
FT                   /db_xref="InterPro:IPR003325"
FT                   /db_xref="SubtiList:BG12768"
FT                   /db_xref="UniProtKB/Swiss-Prot:P80875"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB12084.1"
FT                   /translation="MTISLAKGQKVDLTKTNPGLSKVVVGLGWDTNKYDGGHDFDLDSS
FT                   VFLLDAAGKCASPNDFIFYNQLEGGNGSVVHSGDNLTGAGEGDDENVKVNLSAVPANID
FT                   KISFVITIHDAEARSQNFGQVSNAFVRIVNEETNEELIRYDLAEDFSIETAIIAGELYR
FT                   HNGEWKFSAIGSGYQGGLARIATDYGLQVG"
FT   gene            313396..313974
FT                   /gene="yceE"
FT                   /locus_tag="BSU_02910"
FT                   /old_locus_tag="BSU02910"
FT   CDS_pept        313396..313974
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yceE"
FT                   /locus_tag="BSU_02910"
FT                   /old_locus_tag="BSU02910"
FT                   /product="putative stress adaptation protein (tellurite
FT                   resistance)"
FT                   /function="16.8: Protect"
FT                   /note="Evidence 3: Putative function from multiple
FT                   computational evidences; PubMedId: 22720735, 24366250,
FT                   25355936; Product type f: factor"
FT                   /db_xref="EnsemblGenomes-Gn:BSU02910"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12085"
FT                   /db_xref="InterPro:IPR003325"
FT                   /db_xref="SubtiList:BG12769"
FT                   /db_xref="UniProtKB/Swiss-Prot:O34384"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB12085.1"
FT                   /translation="MAIQLSKGQRIDLTKTNPGLTKAVIGLGWDTNKYSGGHDFDLDAS
FT                   AFLVDAHDNCVNDLDFVFYNNLEHPSGGVIHTGDNRTGEGDGDDEQIIVDFSKIPAHIE
FT                   KIGITVTIHDAEARSQNFGQVSNAFVRVVDEETQNELLRFDLGEDFSIETAVVVCELYR
FT                   HGGEWKFNAIGSGFSGGLAALCRNYGLQV"
FT   gene            314025..314798
FT                   /gene="yceF"
FT                   /locus_tag="BSU_02920"
FT                   /old_locus_tag="BSU02920"
FT   CDS_pept        314025..314798
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yceF"
FT                   /locus_tag="BSU_02920"
FT                   /old_locus_tag="BSU02920"
FT                   /product="putative stress adaptation transporter (tellurite
FT                   resistance)"
FT                   /function="16.1: Circulate"
FT                   /function="16.8: Protect"
FT                   /note="Evidence 3: Putative function from multiple
FT                   computational evidences; PubMedId: 15849754, 16850406,
FT                   22720735, 24366250; Product type t: transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BSU02920"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12086"
FT                   /db_xref="GOA:O34447"
FT                   /db_xref="InterPro:IPR005496"
FT                   /db_xref="InterPro:IPR022493"
FT                   /db_xref="SubtiList:BG12770"
FT                   /db_xref="UniProtKB/Swiss-Prot:O34447"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB12086.1"
FT                   /translation="MDFLHHILSTYASFFDWKMWGEVLTDPVSWGLIGSLVVLEGLLSA
FT                   DNALVLAVMVKHLPEKQRKKALTYGLFGAYIFRFIFIGLGMLLIKFWWIKVLGALYLAW
FT                   LVIKHFWIGEKEEEADGMKKNSWMVRTFGIFWATVISVELMDLAFSVDSILAAFAVSEK
FT                   VWVLLIGGMLGILMMRTVAKVFLVLIDKIPELENTAFVLIGIIALKMAGSAFHYEMPHS
FT                   VFFIIIIAAFAVTLIIHYINKQKQVREQTAASKEE"
FT   gene            314883..316496
FT                   /gene="yceG"
FT                   /locus_tag="BSU_02930"
FT                   /old_locus_tag="BSU02930"
FT   CDS_pept        314883..316496
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yceG"
FT                   /locus_tag="BSU_02930"
FT                   /old_locus_tag="BSU02930"
FT                   /product="putative toxic compound adaptation protein
FT                   (tellurite resistance)"
FT                   /note="Evidence 3: Putative function from multiple
FT                   computational evidences; PubMedId: 24366250; Product type
FT                   f: factor"
FT                   /db_xref="EnsemblGenomes-Gn:BSU02930"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12087"
FT                   /db_xref="InterPro:IPR025647"
FT                   /db_xref="SubtiList:BG12771"
FT                   /db_xref="UniProtKB/Swiss-Prot:O34809"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB12087.1"
FT                   /translation="MRQEELTIHKALPADGDWKSLLFQPLPERDHYETAQGLSFSRLAG
FT                   QILGTPIDETDYYNELYELSVNDRITILSETLDKTIEPETFQKLQHIHSINQKEKGLSV
FT                   SRFVAFLDGEKLIAKHSNPLMHRHLRKALMTLLHTFADSHEKGLNHPDFRRVLLDVSKF
FT                   SLNHLNPWLEKTDIEREMPKVVWYGDATKSQLYFLYYLMLVGCDVLLFHPAGTDQLALV
FT                   DPKQELGFTEKLPDVSELQPFPKEKPDRKSTVAYRSTKEIEHVLNHEESMLYKPWQFRD
FT                   HTPVSVTLKTTYDELFLITKERAFIRPNFKADKHSIEIPNVFAKIMGVSKDNKEYWNRL
FT                   HTLADYQETEMVRSFPFTEEIKSNYQFHYSHALDQEGNIDPDKLMASNVWQYKQLPAGV
FT                   QTAIAKTISRMCRYPRLKALHQEQVKDVQIYLFKQTTNLPANLLKLIQMFDYAQTVPKL
FT                   VLYHTEMSGGLTRSDAAALLFLNEIGIDIIIYNPPGHQDIEQFIEEDQYDIHWLDDMVF
FT                   QQDYKEPSLVKRLFRTITQK"
FT   gene            316512..317603
FT                   /gene="yceH"
FT                   /locus_tag="BSU_02940"
FT                   /old_locus_tag="BSU02940"
FT   CDS_pept        316512..317603
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yceH"
FT                   /locus_tag="BSU_02940"
FT                   /old_locus_tag="BSU02940"
FT                   /product="putative reactive oxygen species resistance
FT                   protein"
FT                   /note="Evidence 3: Putative function from multiple
FT                   computational evidences; PubMedId: 22720735, 24366250;
FT                   Product type f: factor"
FT                   /db_xref="EnsemblGenomes-Gn:BSU02940"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12088"
FT                   /db_xref="InterPro:IPR008863"
FT                   /db_xref="SubtiList:BG12772"
FT                   /db_xref="UniProtKB/Swiss-Prot:O34833"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB12088.1"
FT                   /translation="MTTENQNPLVLDKNEEISQQKADDIRLQLRQEPEVKRLAQQIDVK
FT                   NQMELLEYGKEPAVEISKFSDRILGMMKTTSVTDSGTMLTQLGKIMDRFDKNDFDEPKG
FT                   LMAKIFKRGGSMIEKIFKKYQTLGGEIEKIHVEISKYKDEMTKTNYTLDEMYENNIKYY
FT                   MELEKYVVAGQMKLEEMQSILPSYEEKAASGNQLAQMQLDTLRNGIQALEERVYDLDMA
FT                   RMVALQTAPQIRLLQRGNAKLIGKINSAFIITIPIFKNGIIQAVTVKRQKLVADSMSEL
FT                   DRRTNEMLKRNAENISSQSVEIARMAGRPSIDIETIESSWNTIVSGMQETKQIEEENKR
FT                   LREDGARRIAQLQDNIKKAALQQ"
FT   gene            317725..318927
FT                   /gene="niaP"
FT                   /locus_tag="BSU_02950"
FT                   /old_locus_tag="BSU02950"
FT   CDS_pept        317725..318927
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="niaP"
FT                   /locus_tag="BSU_02950"
FT                   /old_locus_tag="BSU02950"
FT                   /product="niacin permease"
FT                   /function="16.1: Circulate"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 15849754, 16850406, 18276644,
FT                   21953179; Product type t: transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BSU02950"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12089"
FT                   /db_xref="GOA:O34691"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="SubtiList:BG12773"
FT                   /db_xref="UniProtKB/Swiss-Prot:O34691"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:15849754, 16850406, 18276644, 21953179"
FT                   /protein_id="CAB12089.1"
FT                   /translation="MGKQQPISQRKLLGVAGLGWLFDAMDVGILSFIIAALHVEWNLSP
FT                   EEMKWIGSVNSIGMAAGAFLFGLLADRIGRKKVFIITLLCFSIGSGISAFVTSLSAFLI
FT                   LRFVIGMGLGGELPVASTLVSEAVVPEKRGRVIVLLESFWAVGWLAAALISYFVIPSFG
FT                   WQAALLLTALTAFYALYLRTSLPDSPKYESLSAKKRSMWENVKSVWARQYIRPTVMLSI
FT                   VWFCVVFSYYGMFLWLPSVMLLKGFSMIQSFEYVLLMTLAQLPGYFSAAWLIEKAGRKW
FT                   ILVVYLIGTAGSAYFFGTADSLSLLLTAGVLLSFFNLGAWGVLYAYTPEQYPTAIRATG
FT                   SGTTAAFGRIGGIFGPLLVGTLAARHISFSVIFSIFCIAILLAVACILIMGKETKQTEL
FT                   E"
FT   gene            complement(319180..320352)
FT                   /gene="yceJ"
FT                   /locus_tag="BSU_02960"
FT                   /old_locus_tag="BSU02960"
FT   CDS_pept        complement(319180..320352)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yceJ"
FT                   /locus_tag="BSU_02960"
FT                   /old_locus_tag="BSU02960"
FT                   /product="putative carbohydrate transporter (possibly
FT                   exporter)"
FT                   /function="16.1: Circulate"
FT                   /function="16.8: Protect"
FT                   /note="Evidence 3: Putative function from multiple
FT                   computational evidences; PubMedId: 15849754, 16850406;
FT                   Product type t: transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BSU02960"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12090"
FT                   /db_xref="GOA:O34724"
FT                   /db_xref="InterPro:IPR001958"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="SubtiList:BG12774"
FT                   /db_xref="UniProtKB/Swiss-Prot:O34724"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB12090.1"
FT                   /translation="MNRIWLFFSVMFVIGTDTFLLSPLLPLLQDQFHVSTDLSGWMVSA
FT                   YALGYALFAFIAGPISDRLNRKTVMLWGLAGFIVSTFLCGIAPSFAAMCLFRFAAGVSA
FT                   AFVTPQIWASIPVIVQPSQIIKGMGIATAGLAASQMLGLPIGGFLASFTWHTPFFVLSA
FT                   CSLILLLILAAVMPGIRPSEPLARPSIVNPYRELFSLPKTSVILLAYFLFQTGNFASFS
FT                   FLGTWLSADYHLTVSQIGAAMLVLGLGNMLGSLIGSRVSEKLGMFKTLISGMLLMGALY
FT                   FALPFFPNLFLVEAGFFLTFFTAGIIFPLMMGVFQSIAPNARGTIASLSNAAMYAGTTV
FT                   GTSIAGFLYQSTQHFGAVTGFTAILFILSMTLYQTISKTGKRQSTARAQL"
FT   gene            complement(320421..320723)
FT                   /gene="yceK"
FT                   /locus_tag="BSU_02970"
FT                   /old_locus_tag="BSU02970"
FT   CDS_pept        complement(320421..320723)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yceK"
FT                   /locus_tag="BSU_02970"
FT                   /old_locus_tag="BSU02970"
FT                   /product="putative transcriptional regulator (ArsR family)"
FT                   /function="16.3: Control"
FT                   /note="Evidence 3: Putative function from multiple
FT                   computational evidences; Product type r: regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BSU02970"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12091"
FT                   /db_xref="GOA:O34464"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="SubtiList:BG12775"
FT                   /db_xref="UniProtKB/Swiss-Prot:O34464"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB12091.1"
FT                   /translation="MYYSFMTMKQSDDQIRAQIFKALSDESRLAIIRTLYVSGKELSCG
FT                   EVGEKCNIVKTTASYHFKTLREAGLTATRKDSRTKYVSLREDTFQTYLPGFLETL"
FT   gene            321013..322269
FT                   /gene="opuAA"
FT                   /locus_tag="BSU_02980"
FT                   /old_locus_tag="BSU02980"
FT   CDS_pept        321013..322269
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="opuAA"
FT                   /locus_tag="BSU_02980"
FT                   /old_locus_tag="BSU02980"
FT                   /product="L-proline betaine and betonicine ABC transporter
FT                   (ATP-binding protein)"
FT                   /function="16.1: Circulate"
FT                   /function="16.8: Protect"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 7622480, 16225868, 16645306,
FT                   25012968; Product type t: transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BSU02980"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12092"
FT                   /db_xref="GOA:P46920"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005892"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="SubtiList:BG11370"
FT                   /db_xref="UniProtKB/Swiss-Prot:P46920"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:7622480, 16225868, 16645306, 25012968"
FT                   /protein_id="CAB12092.2"
FT                   /translation="MSVDEKPIKIKVEKVSKIFGKQTKKAVQMLANGKTKKEILKATGS
FT                   TVGVNQADFEVYDGEIFVIMGLSGSGKSTLVRMLNRLIEPTAGNIYIDGDMITNMSKDQ
FT                   LREVRRKKISMVFQKFALFPHRTILENTEYGLELQGVDKQERQQKALESLKLVGLEGFE
FT                   HQYPDQLSGGMQQRVGLARALTNDPDILLMDEAFSALDPLIRKDMQDELLDLHDNVGKT
FT                   IIFITHDLDEALRIGDRIVLMKDGNIVQIGTPEEILMNPSNEYVEKFVEDVDLSKVLTA
FT                   GHIMKRAETVRIDKGPRVALTLMKNLGISSIYAVDKQKKLLGVIYASDAKKAAESDLSL
FT                   QDILNTEFTTVPENTYLTEIFDVVSDANIPIAVVDEKQRMKGIVVRGALIGALAGNNEY
FT                   INAEGTNEQTQDPSAQEVK"
FT   gene            322271..323119
FT                   /gene="opuAB"
FT                   /locus_tag="BSU_02990"
FT                   /old_locus_tag="BSU02990"
FT   CDS_pept        322271..323119
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="opuAB"
FT                   /locus_tag="BSU_02990"
FT                   /old_locus_tag="BSU02990"
FT                   /product="L-proline betaine and betonicine ABC transporter
FT                   (permease)"
FT                   /function="16.1: Circulate"
FT                   /function="16.8: Protect"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 8752321, 15849754, 16225868,
FT                   16645306, 16850406, 25012968; Product type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BSU02990"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12093"
FT                   /db_xref="GOA:P46921"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="SubtiList:BG11371"
FT                   /db_xref="UniProtKB/Swiss-Prot:P46921"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:8752321, 15849754, 16225868, 16645306, 16850406,
FT                   25012968"
FT                   /protein_id="CAB12093.1"
FT                   /translation="MDRLPRIPLADIIDRFVDWITMTFGGFFDGIANGLAAFVNGIVTG
FT                   LGFIPSILLTIIFAALAWWISTRGIALFTLIGFLLIDYLGYWDPMLQTLALVLTSVIIS
FT                   IVVGVPIGIWASQKETVRRIVTPILDLMQTMPAFVYLLPAIFFFNIGVVPGVVASVIFA
FT                   MPPTIRMTVLGIKQVPADLIEATEAFGSTTAQRLFKVQLPLATKTILAGINQSIMLALS
FT                   MVVIAAMVGAPGLGSEVYSAVTQLKTGVGVEAGIAIVIVAITLDRITQNIKVKKKSRGN
FT                   A"
FT   gene            323119..324000
FT                   /gene="opuAC"
FT                   /locus_tag="BSU_03000"
FT                   /old_locus_tag="BSU03000"
FT   CDS_pept        323119..324000
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="opuAC"
FT                   /locus_tag="BSU_03000"
FT                   /old_locus_tag="BSU03000"
FT                   /product="L-proline betaine and betonicine ABC transporter
FT                   ABC transporter (glycine betaine-binding lipoprotein)"
FT                   /function="16.1: Circulate"
FT                   /function="16.8: Protect"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 7622480, 16225868, 16645306,
FT                   25012968; Product type lp: lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:BSU03000"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12094"
FT                   /db_xref="GOA:P46922"
FT                   /db_xref="InterPro:IPR007210"
FT                   /db_xref="PDB:2B4L"
FT                   /db_xref="PDB:2B4M"
FT                   /db_xref="PDB:3CHG"
FT                   /db_xref="PDB:5NXX"
FT                   /db_xref="SubtiList:BG11372"
FT                   /db_xref="UniProtKB/Swiss-Prot:P46922"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:7622480, 16225868, 16645306, 25012968"
FT                   /protein_id="CAB12094.1"
FT                   /translation="MLKKIIGIGVSAMLALSLAACGSENDENASAAEQVNKTIIGIDPG
FT                   SGIMSLTDKAMKDYDLNDWTLISASSAAMTATLKKSYDRKKPIIITGWTPHWMFSRYKL
FT                   KYLDDPKQSYGSAEEIHTITRKGFSKEQPNAAKLLSQFKWTQDEMGEIMIKVEEGEKPA
FT                   KVAAEYVNKHKDQIAEWTKGVQKVKGDKINLAYVAWDSEIASTNVIGKVLEDLGYEVTL
FT                   TQVEAGPMWTAIATGSADASLSAWLPNTHKAYAAKYKGKYDDIGTSMTGVKMGLVVPQY
FT                   MKNVNSIEDLKK"
FT   gene            complement(324038..325189)
FT                   /gene="amhX"
FT                   /locus_tag="BSU_03010"
FT                   /old_locus_tag="BSU03010"
FT   CDS_pept        complement(324038..325189)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="amhX"
FT                   /locus_tag="BSU_03010"
FT                   /old_locus_tag="BSU03010"
FT                   /product="putative amidohydrolase"
FT                   /function="16.11: Scavenge (Catabolism)"
FT                   /EC_number="3.5.1.-"
FT                   /note="Evidence 3: Putative function from multiple
FT                   computational evidences; PubMedId: 8768514; Product type e:
FT                   enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU03010"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12095"
FT                   /db_xref="GOA:P54983"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR017439"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="InterPro:IPR037484"
FT                   /db_xref="SubtiList:BG11789"
FT                   /db_xref="UniProtKB/Swiss-Prot:P54983"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB12095.2"
FT                   /translation="MQKLSEEMKQTIMDIFEHLHANPEVSWKEYETTSFLKQKLEDLGC
FT                   RTRTFSDCTGVVGEIGSGSPVVAVRADIDALWQEVNGTFRANHSCGHDSHMTMALGTLM
FT                   LLKKQPELPKGTIRFIFQPAEEKGGGALKMIEEGVLDDIDYLYGVHVRPIQETQNGRCA
FT                   PSILHGSSQHIEGTIIGEEAHGARPHLGKNSIEIAAFLVHKLGLIHIDPQIPHTVKMTK
FT                   LQAGGESSNIIPGKASFSLDLRAQTNEAMEALIAETERACEAAAAAFGAKIELHKEHSL
FT                   PAATQNKEAEAIMAEAITEIIGAERLDDPLVTTGGEDFHFYAVKVPNLKTTMLGLGCGL
FT                   QPGLHHPHMTFDRNAMFTGIHILANAVLKTFQKAESLAAANAS"
FT   gene            325339..326772
FT                   /gene="ycgA"
FT                   /locus_tag="BSU_03020"
FT                   /old_locus_tag="BSU03020"
FT   CDS_pept        325339..326772
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycgA"
FT                   /locus_tag="BSU_03020"
FT                   /old_locus_tag="BSU03020"
FT                   /product="putative branched chain amino acid permease"
FT                   /note="Evidence 3: Putative function from multiple
FT                   computational evidences; PubMedId: 15849754, 16850406,
FT                   21747963, 21764931; Product type t: transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BSU03020"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12096"
FT                   /db_xref="GOA:P55908"
FT                   /db_xref="InterPro:IPR018385"
FT                   /db_xref="SubtiList:BG11999"
FT                   /db_xref="UniProtKB/Swiss-Prot:P55908"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB12096.2"
FT                   /translation="MSMPAAETQPKKKRMTFKMPDAYVLLFMIAFICAIASYIVPAGEF
FT                   DRVTKGDVTTAVPGSYHSIEQSPVRLISFFTSLQDGMVGSAPIIFLILFTGGTIAILEK
FT                   TGAINGLIYNVISKFRTKQLLFICIVGALFSILGTTGIVVNSVIGFIPIGLIVARSLKW
FT                   DAVAGAAVIYIGCYAGFNSTILSPSPLGLSQSIAELPLFSGIGLRVVIYICFLLSSIIY
FT                   IYLYTRKLKKSKDASVLGTDWFPAAGMGEAGKEEDQSVPFTVRHKLILAVAGLSLVGFL
FT                   YGALKLGWSDSQMAATFIFISVLAGLIGGLAANDIAKTFITGCQSLVYGALIVGMARSI
FT                   SVILENGKLLDTVVNALASLLDGFSPIAGAIGMYIASALLHFLISSGSGEAVVFIPILA
FT                   PLADLMGITRQVAVEAVMLGEGVVNCVNPTSGVLMAVLAASGIPYVKWLRFMVPLALIW
FT                   FLIGLVFIVIGVMINWGPF"
FT   gene            326888..327469
FT                   /gene="ycgB"
FT                   /locus_tag="BSU_03030"
FT                   /old_locus_tag="BSU03030"
FT   CDS_pept        326888..327469
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycgB"
FT                   /locus_tag="BSU_03030"
FT                   /old_locus_tag="BSU03030"
FT                   /product="putative integral inner membrane protein of
FT                   unknown function"
FT                   /note="Evidence 4: Unknown function but conserved in other
FT                   organisms; PubMedId: 15849754, 16850406, 22720735; Product
FT                   type m: membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:BSU03030"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12097"
FT                   /db_xref="SubtiList:BG12000"
FT                   /db_xref="UniProtKB/Swiss-Prot:P55909"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB12097.2"
FT                   /translation="MNNLRNRLSGVNGKNKRVKEKEQKIWSEIGMIAGAFALLDVIIRG
FT                   IMFEFPFKEWAASLVFLFIIILYYCIRAAASGMLMPRIDTKEELQKRVKQQRIESIAVA
FT                   FAVVVLTMYDRGIPHTFFAWLKMILLFIVCGGVLFLLRYVIVKLAYRRAVKEEIKKKSS
FT                   FLFGKRGKRSQFRAAFFIGTLICIHSAKLF"
FT   gene            327618..329597
FT                   /gene="amyE"
FT                   /locus_tag="BSU_03040"
FT                   /old_locus_tag="BSU03040"
FT   CDS_pept        327618..329597
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="amyE"
FT                   /locus_tag="BSU_03040"
FT                   /old_locus_tag="BSU03040"
FT                   /product="alpha-amylase"
FT                   /function="16.11: Scavenge (Catabolism)"
FT                   /EC_number="3.2.1.1"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 3117969, 9353930; Product
FT                   type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU03040"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12098"
FT                   /db_xref="GOA:P00691"
FT                   /db_xref="InterPro:IPR006046"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR031319"
FT                   /db_xref="InterPro:IPR031965"
FT                   /db_xref="PDB:1BAG"
FT                   /db_xref="PDB:1UA7"
FT                   /db_xref="SubtiList:BG10473"
FT                   /db_xref="UniProtKB/Swiss-Prot:P00691"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:3117969, 9353930"
FT                   /protein_id="CAB12098.2"
FT                   /translation="MFAKRFKTSLLPLFAGFLLLFHLVLAGPAAASAETANKSNELTAP
FT                   SIKSGTILHAWNWSFNTLKHNMKDIHDAGYTAIQTSPINQVKEGNQGDKSMSNWYWLYQ
FT                   PTSYQIGNRYLGTEQEFKEMCAAAEEYGIKVIVDAVINHTTSDYAAISNEVKSIPNWTH
FT                   GNTQIKNWSDRWDVTQNSLLGLYDWNTQNTQVQSYLKRFLDRALNDGADGFRFDAAKHI
FT                   ELPDDGSYGSQFWPNITNTSAEFQYGEILQDSASRDAAYANYMDVTASNYGHSIRSALK
FT                   NRNLGVSNISHYASDVSADKLVTWVESHDTYANDDEESTWMSDDDIRLGWAVIASRSGS
FT                   TPLFFSRPEGGGNGVRFPGKSQIGDRGSALFEDQAITAVNRFHNVMAGQPEELSNPNGN
FT                   NQIFMNQRGSHGVVLANAGSSSVSINTATKLPDGRYDNKAGAGSFQVNDGKLTGTINAR
FT                   SVAVLYPDDIAKAPHVFLENYKTGVTHSFNDQLTITLRADANTTKAVYQINNGPETAFK
FT                   DGDQFTIGKGDPFGKTYTIMLKGTNSDGVTRTEKYSFVKRDPASAKTIGYQNPNHWSQV
FT                   NAYIYKHDGSRVIELTGSWPGKPMTKNADGIYTLTLPADTDTTNAKVIFNNGSAQVPGQ
FT                   NQPGFDYVLNGLYNDSGLSGSLPH"
FT   gene            329774..330739
FT                   /gene="lctE"
FT                   /locus_tag="BSU_03050"
FT                   /old_locus_tag="BSU03050"
FT   CDS_pept        329774..330739
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lctE"
FT                   /locus_tag="BSU_03050"
FT                   /old_locus_tag="BSU03050"
FT                   /product="L-lactate dehydrogenase"
FT                   /function="16.10: Respire"
FT                   /EC_number="1.1.1.27"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 10809684, 16207915, 19383131;
FT                   Product type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU03050"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12099"
FT                   /db_xref="GOA:P13714"
FT                   /db_xref="InterPro:IPR001236"
FT                   /db_xref="InterPro:IPR001557"
FT                   /db_xref="InterPro:IPR011304"
FT                   /db_xref="InterPro:IPR015955"
FT                   /db_xref="InterPro:IPR018177"
FT                   /db_xref="InterPro:IPR022383"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="PDB:3PQD"
FT                   /db_xref="PDB:3PQE"
FT                   /db_xref="PDB:3PQF"
FT                   /db_xref="SubtiList:BG19003"
FT                   /db_xref="UniProtKB/Swiss-Prot:P13714"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:10809684, 16207915, 19383131"
FT                   /protein_id="CAB12099.2"
FT                   /translation="MMNKHVNKVALIGAGFVGSSYAFALINQGITDELVVIDVNKEKAM
FT                   GDVMDLNHGKAFAPQPVKTSYGTYEDCKDADIVCICAGANQKPGETRLELVEKNLKIFK
FT                   GIVSEVMASGFDGIFLVATNPVDILTYATWKFSGLPKERVIGSGTTLDSARFRFMLSEY
FT                   FGAAPQNVHAHIIGEHGDTELPVWSHANVGGVPVSELVEKNDAYKQEELDQIVDDVKNA
FT                   AYHIIEKKGATYYGVAMSLARITKAILHNENSILTVSTYLDGQYGADDVYIGVPAVVNR
FT                   GGIAGITELNLNEKEKEQFLHSAGVLKNILKPHFAEQKVN"
FT   gene            330771..332396
FT                   /gene="lctP"
FT                   /locus_tag="BSU_03060"
FT                   /old_locus_tag="BSU03060"
FT   CDS_pept        330771..332396
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lctP"
FT                   /locus_tag="BSU_03060"
FT                   /old_locus_tag="BSU03060"
FT                   /product="L-lactate permease"
FT                   /function="16.1: Circulate"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 10809684, 15849754, 16428414,
FT                   16850406; Product type t: transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BSU03060"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12100"
FT                   /db_xref="GOA:P55910"
FT                   /db_xref="InterPro:IPR003804"
FT                   /db_xref="SubtiList:BG12001"
FT                   /db_xref="UniProtKB/Swiss-Prot:P55910"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:10809684, 15849754, 16428414, 16850406"
FT                   /protein_id="CAB12100.2"
FT                   /translation="MWEQLYDPFGNEYVSALVALTPILFFLLALTVLKMKGILAAFLTL
FT                   AVSFFVSVWAFHMPVEKAISSVLLGIGSGLWPIGYIVLMAVWLYKIAVKTGKFTIIRSS
FT                   IAGISPDQRLQLLLIGFCFNAFLEGAAGFGVPIAISAALLVELGFKPLKAAALCLIANA
FT                   ASGAFGAIGIPVITGAQIGDLSALELSRTLMWTLPMISFLIPFLLVFLLDRMKGIKQTW
FT                   PALLVVSGGYTAVQTLTMAVLGPELANILAALFSMGGLALFLRKWQPKEIYREEGAGDA
FT                   GEKKAYRAADIAKAWSPFYILTAAITIWSLPAFKALFQEGGLLYQSTLLFKMPFLHQQI
FT                   MKMPPIAPSAMPLDAVFKVDLLSATGTAILAAVIVTGLFSKKFSSRDAFASLKETGKEL
FT                   WVPIMTICFVMGFANLANFAGLSSSIGLALAKTGDLFPFVSPVLGWIGVFITGSVVSNN
FT                   ALFGHLQVVTGAQIGAGSDLLLAANTAGGVMAKLVSPQSIAIAAAAVGQTGKESKLFKR
FT                   TVAYSLILLLIICIWTFILARLGV"
FT   gene            complement(332441..333979)
FT                   /gene="mdr"
FT                   /locus_tag="BSU_03070"
FT                   /old_locus_tag="BSU03070"
FT   CDS_pept        complement(332441..333979)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mdr"
FT                   /locus_tag="BSU_03070"
FT                   /old_locus_tag="BSU03070"
FT                   /product="multidrug-efflux transporter"
FT                   /function="16.1: Circulate"
FT                   /function="16.8: Protect"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 9023234, 15489457, 15849754,
FT                   16850406, 21690368; Product type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BSU03070"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12101"
FT                   /db_xref="GOA:P96712"
FT                   /db_xref="InterPro:IPR001411"
FT                   /db_xref="InterPro:IPR004638"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="SubtiList:BG12002"
FT                   /db_xref="UniProtKB/Swiss-Prot:P96712"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:9023234, 15489457, 15849754, 16850406, 21690368"
FT                   /protein_id="CAB12101.2"
FT                   /translation="MDTTTAKQASTKFVVLGLLLGILMSAMDNTIVATAMGNIVADLGS
FT                   FDKFAWVTASYMVAVMAGMPIYGKLSDMYGRKRFFLFGLIFFLIGSALCGIAQTMNQLI
FT                   IFRAIQGIGGGALLPIAFTIIFDLFPPEKRGKMSGMFGAVFGLSSVLGPLLGAIITDSI
FT                   SWHWVFYINVPIGALSLFFIIRYYKESLEHRKQKIDWGGAITLVVSIVCLMFALELGGK
FT                   TYDWNSIQIIGLFIVFAVFFIAFFIVERKAEEPIISFWMFKNRLFATAQILAFLYGGTF
FT                   IILAVFIPIFVQAVYGSSATSAGFILTPMMIGSVIGSMIGGIFQTKASFRNLMLISVIA
FT                   FFIGMLLLSNMTPDTARVWLTVFMMISGFGVGFNFSLLPAASMNDLEPRFRGTANSTNS
FT                   FLRSFGMTLGVTIFGTVQTNVFTNKLNDAFSGMKGSAGSGAAQNIGDPQEIFQAGTRSQ
FT                   IPDAILNRIIDAMSSSITYVFLLALIPIVLAAVTILFMGKARVKTTAEMTKKAN"
FT   gene            334092..334556
FT                   /gene="ycgE"
FT                   /locus_tag="BSU_03080"
FT                   /old_locus_tag="BSU03080"
FT   CDS_pept        334092..334556
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycgE"
FT                   /locus_tag="BSU_03080"
FT                   /old_locus_tag="BSU03080"
FT                   /product="putative transcriptional regulator"
FT                   /function="16.3: Control"
FT                   /note="Evidence 3: Putative function from multiple
FT                   computational evidences; Product type r: regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BSU03080"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12102"
FT                   /db_xref="GOA:O31472"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="SubtiList:BG12003"
FT                   /db_xref="UniProtKB/Swiss-Prot:O31472"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB12102.2"
FT                   /translation="MSTRNSRSELEKTAVQLFRKLGTRTVLFHQAAAQALGLFPTDLKS
FT                   ADILNEAGPMTAGELGKKTGLSTGSVTALVDRLEKAGYVAREKDPNDRRRVVIVPLTAS
FT                   KKHIKDLFRPLSESTMDLCREYTEEELELIFSFVGKAADIMEEELERLKQ"
FT   gene            334630..335259
FT                   /gene="ycgF"
FT                   /locus_tag="BSU_03090"
FT                   /old_locus_tag="BSU03090"
FT   CDS_pept        334630..335259
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycgF"
FT                   /locus_tag="BSU_03090"
FT                   /old_locus_tag="BSU03090"
FT                   /product="putative aminoacid export permease"
FT                   /note="Evidence 3: Putative function from multiple
FT                   computational evidences; PubMedId: 15849754, 16850406;
FT                   Product type t: transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BSU03090"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12103"
FT                   /db_xref="GOA:P94381"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="SubtiList:BG12004"
FT                   /db_xref="UniProtKB/Swiss-Prot:P94381"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB12103.1"
FT                   /translation="MNIFLSYIVLGLSLSAPVGPVNAAQIDKGIKNGFWHAWIFGLGAM
FT                   TADGLYMLFIYFGLSQFLTAPFVKTFLWLFGFFVLTYTGIETLKNVREPMDVRSSRGKP
FT                   SYRKTFASGFLISLSNPLSILFWLGIYGSILAKTAEAYNMNQLLIYSSGIMIGILIWDF
FT                   CMAITASTFRNLLHEKLLRGLTGIAGVSLLVFGFYFGYQGIKQLLG"
FT   gene            335329..336090
FT                   /gene="ycgG"
FT                   /locus_tag="BSU_03100"
FT                   /old_locus_tag="BSU03100"
FT   CDS_pept        335329..336090
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycgG"
FT                   /locus_tag="BSU_03100"
FT                   /old_locus_tag="BSU03100"
FT                   /product="conserved protein of unknown function (similar to
FT                   phage protein)"
FT                   /note="Evidence 4: Unknown function but conserved in other
FT                   organisms"
FT                   /db_xref="EnsemblGenomes-Gn:BSU03100"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12104"
FT                   /db_xref="InterPro:IPR014988"
FT                   /db_xref="SubtiList:BG12005"
FT                   /db_xref="UniProtKB/Swiss-Prot:P94382"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB12104.2"
FT                   /translation="MVNGIYTKSFLERIQEELPEWQRIAFELLAETLGDDADTFPCIPG
FT                   RQAFLTDQLRIAFAGDPRENRTAEELAPLLAEYGKISRDTGKYASLVVLFDTPEDLAEH
FT                   YSIEAYEELFWRFLNRLSHQDEKEWPEDIPADPEHYKWEFCFDGEPYFILCATPGHEAR
FT                   RSRSFPFFMVTFQPRWVFDDLNGSTAFGRNMSRLIRSRLEAYDQAPIHPQLGWYGGKDN
FT                   REWKQYFLRDDEKQVSKCPFSYLKNMFNKMK"
FT   gene            complement(336092..337432)
FT                   /gene="ycgH"
FT                   /locus_tag="BSU_03110"
FT                   /old_locus_tag="BSU03110"
FT   CDS_pept        complement(336092..337432)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycgH"
FT                   /locus_tag="BSU_03110"
FT                   /old_locus_tag="BSU03110"
FT                   /product="putative amino acid transporter"
FT                   /function="16.1: Circulate"
FT                   /note="Evidence 3: Putative function from multiple
FT                   computational evidences; PubMedId: 15849754, 16850406;
FT                   Product type t: transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BSU03110"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12105"
FT                   /db_xref="GOA:P94383"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="SubtiList:BG12006"
FT                   /db_xref="UniProtKB/Swiss-Prot:P94383"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB12105.2"
FT                   /translation="MSQTKKDQPKGNLAWWQLSLIGVGCTIGTGFFLGSSIAIVKSGFS
FT                   VLLSFLIAGIGTYFVFEQLAKLSAKQPEKGSFCAYARKAFGKWAGFSNGWVYWTSEMLI
FT                   TGSQLTAISLFTKHWFPQVPLWVFASIYAVLGLLIIFTGLSVFEKTENVLAVIKTAAIF
FT                   MFIVIAILALCGILSGGNHGIHVPNKTSEFFPYGAMGLWTGLIYAFYAFGGIEVMGLMA
FT                   VHLKKPEEASKSGKLMLATLAIIYIISIGLALLLVPLHTFTEQDSPFITSLKGYNLEII
FT                   LDIFNGIFIIAGFSTLVASLFAVTTLLCTMADDGDAPKCFTLKEGKKICWPALGLTFAG
FT                   LVLSIILSLVLPKNIYEHMTTAAGLMLLYTWLFILFSSKKLTDPEGMGKTQIYLAMVLI
FT                   AAAVSGTLFEKSSRPGFFVSIGFLVIIAIVTMIYQKKQGHKDRPASP"
FT   gene            337562..338158
FT                   /gene="ycgI"
FT                   /locus_tag="BSU_03120"
FT                   /old_locus_tag="BSU03120"
FT   CDS_pept        337562..338158
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycgI"
FT                   /locus_tag="BSU_03120"
FT                   /old_locus_tag="BSU03120"
FT                   /product="xenotiotic metabolite methyltransferase"
FT                   /function="16.8: Protect"
FT                   /note="Evidence 1b: Function from experimental evidences in
FT                   the studied species; PubMedId: 16433904, 28898812; Product
FT                   type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU03120"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12106"
FT                   /db_xref="InterPro:IPR018959"
FT                   /db_xref="SubtiList:BG12007"
FT                   /db_xref="UniProtKB/Swiss-Prot:O31473"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB12106.3"
FT                   /translation="MTQQYIVEPKKGLGLKLKKGQILKVVDVEGQQVADFVAYHAKDFY
FT                   EHLDQGATIDANHSIHVKVNDHLYSNLYKPMLTLIEDTVGKHDLLLPACRPDMNRLLYG
FT                   KQKDEFQDTCYDNMNRALEQFGVPKPHMHYPFAIFMNTVLDEKGNLSVETPLSNAGDYV
FT                   RLRAEMDLIVAFSSCPIEKGKCNGDSVTSIRVEVS"
FT   gene            338288..339106
FT                   /gene="nadE"
FT                   /locus_tag="BSU_03130"
FT                   /old_locus_tag="BSU03130"
FT   CDS_pept        338288..339106
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nadE"
FT                   /locus_tag="BSU_03130"
FT                   /old_locus_tag="BSU03130"
FT                   /product="ammonium-dependent NAD+ synthetase"
FT                   /function="16.2: Construct biomass (Anabolism)"
FT                   /EC_number="6.3.1.5"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 7890752, 9271869, 12682299,
FT                   19204287; Product type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU03130"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12107"
FT                   /db_xref="GOA:P08164"
FT                   /db_xref="InterPro:IPR003694"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR022310"
FT                   /db_xref="InterPro:IPR022926"
FT                   /db_xref="PDB:1EE1"
FT                   /db_xref="PDB:1FYD"
FT                   /db_xref="PDB:1IFX"
FT                   /db_xref="PDB:1IH8"
FT                   /db_xref="PDB:1KQP"
FT                   /db_xref="PDB:1NSY"
FT                   /db_xref="PDB:2NSY"
FT                   /db_xref="SubtiList:BG10694"
FT                   /db_xref="UniProtKB/Swiss-Prot:P08164"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:7890752, 9271869, 12682299, 19204287"
FT                   /protein_id="CAB12107.1"
FT                   /translation="MSMQEKIMRELHVKPSIDPKQEIEDRVNFLKQYVKKTGAKGFVLG
FT                   ISGGQDSTLAGRLAQLAVESIREEGGDAQFIAVRLPHGTQQDEDDAQLALKFIKPDKSW
FT                   KFDIKSTVSAFSDQYQQETGDQLTDFNKGNVKARTRMIAQYAIGGQEGLLVLGTDHAAE
FT                   AVTGFFTKYGDGGADLLPLTGLTKRQGRTLLKELGAPERLYLKEPTADLLDEKPQQSDE
FT                   TELGISYDEIDDYLEGKEVSAKVSEALEKRYSMTEHKRQVPASMFDDWWK"
FT   gene            complement(339156..339749)
FT                   /gene="tmrB"
FT                   /locus_tag="BSU_03140"
FT                   /old_locus_tag="BSU03140"
FT   CDS_pept        complement(339156..339749)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tmrB"
FT                   /locus_tag="BSU_03140"
FT                   /old_locus_tag="BSU03140"
FT                   /product="ATP-binding tunicamycin resistance protein"
FT                   /function="16.8: Protect"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 1624425, 7766032, 15131133,
FT                   27315722; Product type f: factor"
FT                   /db_xref="EnsemblGenomes-Gn:BSU03140"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12108"
FT                   /db_xref="GOA:P12921"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="SubtiList:BG10456"
FT                   /db_xref="UniProtKB/Swiss-Prot:P12921"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:1624425, 7766032, 15131133, 27315722"
FT                   /protein_id="CAB12108.2"
FT                   /translation="MIIWINGAFGSGKTQTAFELHRRLNPSYVYDPEKMGFALRSMVPQ
FT                   EIAKDDFQSYPLWRAFNYSLLASLTDTYRGILIVPMTIVHPEYFNEIIGRLRQEGRIVH
FT                   HFTLMASKETLLKRLRTRAEGKNSWAAKQIDRCVEGLSSPIFEDHIQTDNLSIQDVAEN
FT                   IAARAELPLDPDTRGSLRRFADRLMVKLNHIRIK"
FT   gene            340025..340585
FT                   /gene="aroK"
FT                   /locus_tag="BSU_03150"
FT                   /old_locus_tag="BSU03150"
FT   CDS_pept        340025..340585
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroK"
FT                   /locus_tag="BSU_03150"
FT                   /old_locus_tag="BSU03150"
FT                   /product="shikimate kinase"
FT                   /function="16.2: Construct biomass (Anabolism)"
FT                   /EC_number="2.7.1.71"
FT                   /note="Evidence 2a: Function from experimental evidences in
FT                   other organisms; PubMedId: 170268, 7612934, 27339308;
FT                   Product type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU03150"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12109"
FT                   /db_xref="GOA:P37944"
FT                   /db_xref="InterPro:IPR000623"
FT                   /db_xref="InterPro:IPR023000"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031322"
FT                   /db_xref="SubtiList:BG10457"
FT                   /db_xref="UniProtKB/Swiss-Prot:P37944"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB12109.2"
FT                   /translation="MNAKRAIPVRERNIVLIGFMGVGKTTIGQLVAKKLYRDFIDIDQQ
FT                   IEKDFNMSIPEIFEKKGEDFFRKTEKEYILDICHHKRFKIVSLGGGSFKQEEIRNCCLE
FT                   NCLVLHLDLSWENWKQRADLLIESRPVLHNRSMDEMEQLFNERKVIYDKHNSKVATDNL
FT                   SPEEVADYIVETLKIGWDLYQPM"
FT   gene            complement(340613..341374)
FT                   /gene="ycgJ"
FT                   /locus_tag="BSU_03160"
FT                   /old_locus_tag="BSU03160"
FT   CDS_pept        complement(340613..341374)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycgJ"
FT                   /locus_tag="BSU_03160"
FT                   /old_locus_tag="BSU03160"
FT                   /product="xenotiotic metabolite methyltransferase"
FT                   /EC_number="2.1.1.-"
FT                   /note="Evidence 1b: Function from experimental evidences in
FT                   the studied species; PubMedId: 28898812; Product type e:
FT                   enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU03160"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12110"
FT                   /db_xref="GOA:O31474"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="PDB:1XXL"
FT                   /db_xref="PDB:2GLU"
FT                   /db_xref="SubtiList:BG12008"
FT                   /db_xref="UniProtKB/Swiss-Prot:O31474"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB12110.2"
FT                   /translation="MTNETPFSKNAEMYRDEKVFAEGEDLGLMIKTAECRAEHRVLDIG
FT                   AGAGHTALAFSPYVQECIGVDATKEMVEVASSFAQEKGVENVRFQQGTAESLPFPDDSF
FT                   DIITCRYAAHHFSDVRKAVREVARVLKQDGRFLLVDHYAPEDPVLDEFVNHLNRLRDPS
FT                   HVRESSLSEWQAMFSANQLAYQDIQKWNLPIQYDSWIKRGGTPADREKQIITHLNHASD
FT                   EARDTFCITLNQNGQPISFCLKAILIQGIKR"
FT   gene            341492..342466
FT                   /gene="ycgK"
FT                   /locus_tag="BSU_03170"
FT                   /old_locus_tag="BSU03170"
FT   CDS_pept        341492..342466
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycgK"
FT                   /locus_tag="BSU_03170"
FT                   /old_locus_tag="BSU03170"
FT                   /product="putative transcriptional regulator (LysR family)"
FT                   /function="16.3: Control"
FT                   /note="Evidence 3: Putative function from multiple
FT                   computational evidences; PubMedId: 10939241; Product type
FT                   r: regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BSU03170"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12111"
FT                   /db_xref="GOA:P94387"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="SubtiList:BG12009"
FT                   /db_xref="UniProtKB/Swiss-Prot:P94387"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB12111.2"
FT                   /translation="MDIKVMEYAAEIARRQSFTKAAEHLHIAQPSLSQQIKKLEAELGL
FT                   TLFHRSHGSVTLTPHGRRFIEKAEDIIRSRDDLLREMQERSQGIGHKLSIGIPAVTGRY
FT                   LFPPLLKQFLARYPHVEVQLVEKDPVSLEKMTAKGEVDLSVLSLPIEDERLSITPLLTE
FT                   PVVLAVPKEKQRWMPPELVALIEKALEEDEGRQPCVPIDMVRNVPFILLKEGFGFRRTV
FT                   LDLCAESGFKPNAAFKTSHIETAQSLVANGLGVTMAPNMVRRDKDPGVIYLSIQSAPSR
FT                   TLVFVFLKNRYVSLTAQAFMELSRESLKQTFDEGCLGNKDENI"
FT   gene            342538..343494
FT                   /gene="cah"
FT                   /locus_tag="BSU_03180"
FT                   /old_locus_tag="BSU03180"
FT   CDS_pept        342538..343494
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cah"
FT                   /locus_tag="BSU_03180"
FT                   /old_locus_tag="BSU03180"
FT                   /product="promiscuous acetyl xylan esterase-cephalosporin C
FT                   deacetylase"
FT                   /function="16.8: Protect"
FT                   /function="16.11: Scavenge (Catabolism)"
FT                   /EC_number="3.1.1.41"
FT                   /EC_number="3.1.1.72"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 12842474, 19837798, 21382014;
FT                   Product type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU03180"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12112"
FT                   /db_xref="GOA:P94388"
FT                   /db_xref="InterPro:IPR008391"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="InterPro:IPR039069"
FT                   /db_xref="PDB:1L7A"
FT                   /db_xref="PDB:1ODS"
FT                   /db_xref="PDB:1ODT"
FT                   /db_xref="SubtiList:BG11919"
FT                   /db_xref="UniProtKB/Swiss-Prot:P94388"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:12842474, 19837798, 21382014"
FT                   /protein_id="CAB12112.1"
FT                   /translation="MQLFDLPLDQLQTYKPEKTAPKDFSEFWKLSLEELAKVQAEPDLQ
FT                   PVDYPADGVKVYRLTYKSFGNARITGWYAVPDKEGPHPAIVKYHGYNASYDGEIHEMVN
FT                   WALHGYATFGMLVRGQQSSEDTSISPHGHALGWMTKGILDKDTYYYRGVYLDAVRALEV
FT                   ISSFDEVDETRIGVTGGSQGGGLTIAAAALSDIPKAAVADYPYLSNFERAIDVALEQPY
FT                   LEINSFFRRNGSPETEVQAMKTLSYFDIMNLADRVKVPVLMSIGLIDKVTPPSTVFAAY
FT                   NHLETKKELKVYRYFGHEYIPAFQTEKLAFFKQHLKG"
FT   gene            343578..344360
FT                   /gene="ycgL"
FT                   /locus_tag="BSU_03190"
FT                   /old_locus_tag="BSU03190"
FT   CDS_pept        343578..344360
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycgL"
FT                   /locus_tag="BSU_03190"
FT                   /old_locus_tag="BSU03190"
FT                   /product="conserved protein of unknown function"
FT                   /note="Evidence 4: Unknown function but conserved in other
FT                   organisms"
FT                   /db_xref="EnsemblGenomes-Gn:BSU03190"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12113"
FT                   /db_xref="InterPro:IPR018775"
FT                   /db_xref="SubtiList:BG12010"
FT                   /db_xref="UniProtKB/Swiss-Prot:P94389"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB12113.1"
FT                   /translation="MKQRIIDELKRIEQSYGVKIVYAVESGSRAWGFPSQDSDYDVRFI
FT                   YVPKKEWYFSIEQERDVIEEPIHDLLDISGWELRKTLRLFKKSNPPLLEWLSSDIVYYE
FT                   AFTTAEQLRKLRTEAFKPEASVYHYINMARRNVKDYLQGQEVKIKKYFYVLRPILACQW
FT                   IEKHGTIPPMDFTVLMNELVAEPELKAEMETLLERKRRGEELDLEARIDVIHQFIETEI
FT                   ERIMEAAKELKAEKKDMTSELNRLLLNTVEEVWKDGGS"
FT   gene            344551..345462
FT                   /gene="putB"
FT                   /locus_tag="BSU_03200"
FT                   /old_locus_tag="BSU03200"
FT   CDS_pept        344551..345462
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="putB"
FT                   /locus_tag="BSU_03200"
FT                   /old_locus_tag="BSU03200"
FT                   /product="proline oxidase"
FT                   /function="16.11: Scavenge (Catabolism)"
FT                   /EC_number="1.5.5.2"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 17536821, 2118500, 21840319,
FT                   22139509, 26735940; Product type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU03200"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12114"
FT                   /db_xref="GOA:P94390"
FT                   /db_xref="InterPro:IPR002872"
FT                   /db_xref="InterPro:IPR008219"
FT                   /db_xref="InterPro:IPR015659"
FT                   /db_xref="InterPro:IPR029041"
FT                   /db_xref="SubtiList:BG12011"
FT                   /db_xref="UniProtKB/Swiss-Prot:P94390"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:17536821, 2118500, 21840319, 22139509, 26735940"
FT                   /protein_id="CAB12114.1"
FT                   /translation="MITRDFFLFLSKSGFLNKMARNWGSRVAAGKIIGGNDFNSSIPTI
FT                   RQLNSQGLSVTVDHLGEFVNSAEVARERTEECIQTIATIADQELNSHVSLKMTSLGLDI
FT                   DMDLVYENMTKILQTAEKHKIMVTIDMEDEVRCQKTLDIFKDFRKKYEHVSTVLQAYLY
FT                   RTEKDIDDLDSLNPFLRLVKGAYKESEKVAFPEKSDVDENYKKIIRKQLLNGHYTAIAT
FT                   HDDKMIDFTKQLAKEHGIANDKFEFQMLYGMRSQTQLSLVKEGYNMRVYLPYGEDWYGY
FT                   FMRRLAERPSNIAFAFKGMTKK"
FT   gene            345479..347026
FT                   /gene="putC"
FT                   /locus_tag="BSU_03210"
FT                   /old_locus_tag="BSU03210"
FT   CDS_pept        345479..347026
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="putC"
FT                   /locus_tag="BSU_03210"
FT                   /old_locus_tag="BSU03210"
FT                   /product="1-pyrroline-5-carboxylate dehydrogenase"
FT                   /function="16.11: Scavenge (Catabolism)"
FT                   /EC_number="1.2.1.88"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 11418582, 17183215, 21840319,
FT                   22139509, 25355936; Product type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU03210"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12115"
FT                   /db_xref="GOA:P94391"
FT                   /db_xref="InterPro:IPR005932"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="SubtiList:BG12012"
FT                   /db_xref="UniProtKB/Swiss-Prot:P94391"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:11418582, 17183215, 21840319, 22139509, 25355936"
FT                   /protein_id="CAB12115.2"
FT                   /translation="MTTPYKHEPFTNFQDQNNVEAFKKALATVSEYLGKDYPLVINGER
FT                   VETEAKIVSINPADKEEVVGRVSKASQEHAEQAIQAAAKAFEEWRYTSPEERAAVLFRA
FT                   AAKVRRRKHEFSALLVKEAGKPWNEADADTAEAIDFMEYYARQMIELAKGKPVNSREGE
FT                   KNQYVYTPTGVTVVIPPWNFLFAIMAGTTVAPIVTGNTVVLKPASATPVIAAKFVEVLE
FT                   ESGLPKGVVNFVPGSGAEVGDYLVDHPKTSLITFTGSREVGTRIFERAAKVQPGQQHLK
FT                   RVIAEMGGKDTVVVDEDADIELAAQSIFTSAFGFAGQKCSAGSRAVVHEKVYDQVLERV
FT                   IEITESKVTAKPDSADVYMGPVIDQGSYDKIMSYIEIGKQEGRLVSGGTGDDSKGYFIK
FT                   PTIFADLDPKARLMQEEIFGPVVAFCKVSDFDEALEVANNTEYGLTGAVITNNRKHIER
FT                   AKQEFHVGNLYFNRNCTGAIVGYHPFGGFKMSGTDSKAGGPDYLALHMQAKTISEMF"
FT   gene            347150..348571
FT                   /gene="putP"
FT                   /locus_tag="BSU_03220"
FT                   /old_locus_tag="BSU03220"
FT   CDS_pept        347150..348571
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="putP"
FT                   /locus_tag="BSU_03220"
FT                   /old_locus_tag="BSU03220"
FT                   /product="proline permease"
FT                   /function="16.1: Circulate"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 11902719, 14976255, 15849754,
FT                   16850406, 21840319, 22139509, 24142252; Product type t:
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BSU03220"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12116"
FT                   /db_xref="GOA:P94392"
FT                   /db_xref="InterPro:IPR001734"
FT                   /db_xref="InterPro:IPR011851"
FT                   /db_xref="InterPro:IPR018212"
FT                   /db_xref="InterPro:IPR038377"
FT                   /db_xref="SubtiList:BG12013"
FT                   /db_xref="UniProtKB/Swiss-Prot:P94392"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:11902719, 14976255, 15849754, 16850406, 21840319,
FT                   22139509, 24142252"
FT                   /protein_id="CAB12116.2"
FT                   /translation="MLLIGYFAYKRTSNLTDYMLGGRSLGPAVTALSAGAADMSGWLLM
FT                   GLPGAMFSTGLSGAWIVIGLCLGAWANWLYVAPRLRTYTEKAGNSITIPGFLENRFGDQ
FT                   TKLLRLFSGIVILVFFTFYVSSGMVSGGVLFNSILGMDYHTGLWIVTGVVVAYTLFGGF
FT                   LAVSWTDFVQGIIMFAALILVPIVTFFHTGGAGDTVAEIRSVDPDMFNIFKGTSVLGII
FT                   SLFAWGLGYFGQPHIIVRFMAITSVKEIKRARRIGMGWMILSAVGAVLTGLGGIAYYHQ
FT                   RGMTLKDPETIFIQLGNILFHPIITGFLISAILAAIMSTISSQLLVTSSSLVEDLYKSM
FT                   FRRSASDKELVFLGRLAVLAVSIVALVLAWEKNNTILGLVSYAWAGFGASFGPVVLLSL
FT                   FWKRMTKWGALAGMIVGAATVIIWANAGLSDFLYEMIPGFAASLLSVFFVSILTQAPSQ
FT                   AVTDQFNDYQDTMSQ"
FT   gene            348724..349959
FT                   /gene="putR"
FT                   /locus_tag="BSU_03230"
FT                   /old_locus_tag="BSU03230"
FT   CDS_pept        348724..349959
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="putR"
FT                   /locus_tag="BSU_03230"
FT                   /old_locus_tag="BSU03230"
FT                   /product="transcriptional activator of proline degradation
FT                   operon"
FT                   /function="16.3: Control"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 21840319, 21964733, 22139509;
FT                   Product type r: regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BSU03230"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12117"
FT                   /db_xref="GOA:P94393"
FT                   /db_xref="InterPro:IPR025736"
FT                   /db_xref="InterPro:IPR041522"
FT                   /db_xref="InterPro:IPR042070"
FT                   /db_xref="SubtiList:BG12014"
FT                   /db_xref="UniProtKB/Swiss-Prot:P94393"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:21840319, 21964733, 22139509"
FT                   /protein_id="CAB12117.2"
FT                   /translation="MEELLERVFSFSDVDKLIDFISYELQKPVILESADFFLLAYNSYY
FT                   INHFDSANQQTIFSKKCPVQIFERFLKDGIIEKLKTEPEPFRVNKIESIGLNQRVVVSA
FT                   KHKGEVMGYIWIQELDQNLTDEELDFLYETSFHVGKIIYKTNKLKQEKEEKAEDLIKRA
FT                   IYQQFTSEKELRREAERINTVLPSMFSVVILHAANGDGEAVEDLKENIRSYLNLRDKVS
FT                   HVLTIESNIVIVVASFSQKSSVSSAASEFINKLLTHFHFQKIPTPIYIGIGNEYNHLLK
FT                   LGKSYTEALEVIKAAEITGNQENIPYEYAKLGIYRYLESIEQKNEFLEYENKDLALLKA
FT                   KDEESSTELLKTLEIYLLNNCKTKPAAEQLFIHQNTLNYRIKQITEMTSIDLSDFRTRC
FT                   QLYLDLMLMKKK"
FT   gene            complement(349996..350853)
FT                   /gene="ycgQ"
FT                   /locus_tag="BSU_03240"
FT                   /old_locus_tag="BSU03240"
FT   CDS_pept        complement(349996..350853)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycgQ"
FT                   /locus_tag="BSU_03240"
FT                   /old_locus_tag="BSU03240"
FT                   /product="conserved protein of unknown function"
FT                   /note="Evidence 4: Unknown function but conserved in other
FT                   organisms"
FT                   /db_xref="EnsemblGenomes-Gn:BSU03240"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12118"
FT                   /db_xref="GOA:P94394"
FT                   /db_xref="InterPro:IPR015402"
FT                   /db_xref="SubtiList:BG12015"
FT                   /db_xref="UniProtKB/Swiss-Prot:P94394"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB12118.1"
FT                   /translation="MFRLLVLMGFTFFFYHLHASGNLTKYINMKYAYLSFIAIFLLAIL
FT                   TAVQAYLFIKSPEKSGHHHDHDCGCGHDHEHDHEQNKPFYQRYLIYVVFLFPLVSGIFF
FT                   PIATLDSSIVKTKGFSFKAMESGDHYSQTQYLRPDASLYYAQDSYDKQMKQLFNKYSSK
FT                   KEISLTDDDFLKGMETIYNYPGEFLGRTIEFHGFAYKGNAINKNQLFVLRFGIIHCIAD
FT                   SGVYGMLVEFPKDMDIKDDEWIHIKGTLASEYYQPFKSTLPVVKVTDWNTIKKPDDPYV
FT                   YRGF"
FT   gene            complement(350858..351742)
FT                   /gene="ycgR"
FT                   /locus_tag="BSU_03250"
FT                   /old_locus_tag="BSU03250"
FT   CDS_pept        complement(350858..351742)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycgR"
FT                   /locus_tag="BSU_03250"
FT                   /old_locus_tag="BSU03250"
FT                   /product="putative permease"
FT                   /function="16.1: Circulate"
FT                   /note="Evidence 3: Putative function from multiple
FT                   computational evidences; PubMedId: 15849754, 16850406;
FT                   Product type t: transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BSU03250"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12119"
FT                   /db_xref="GOA:P94395"
FT                   /db_xref="InterPro:IPR005524"
FT                   /db_xref="SubtiList:BG12016"
FT                   /db_xref="UniProtKB/Swiss-Prot:P94395"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB12119.1"
FT                   /translation="MTAQSSFLQLNSIFISILIEAIPFILIGVILSGIIQMFVSEEMIA
FT                   RIMPKNRFLAVLFGALAGVLFPACECGIIPITRRLLLKGVPLHAGVAFMLTAPIINPIV
FT                   LFSTYIAFGNRWSVVFYRGGLALAVSLIIGVILSYQFKDNQLLKPDEPGHHHHHHGTLL
FT                   QKLGGTLRHAIDEFFSVGKYLIIGAFIAAAMQTYVKTSTLLAIGQNDVSSSLVMMGLAF
FT                   VLSLCSEVDAFIASSFSSTFSLGSLIAFLVFGAMVDIKNLLMMLAAFKKRFVFLLITYI
FT                   VVIVLAGSLLVKG"
FT   gene            complement(351842..352696)
FT                   /gene="ycgS"
FT                   /locus_tag="BSU_03260"
FT                   /old_locus_tag="BSU03260"
FT   CDS_pept        complement(351842..352696)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycgS"
FT                   /locus_tag="BSU_03260"
FT                   /old_locus_tag="BSU03260"
FT                   /product="putative aromatic hydrocarbon hydrolase"
FT                   /function="16.11: Scavenge (Catabolism)"
FT                   /EC_number="3.7.1.-"
FT                   /note="Evidence 3: Putative function from multiple
FT                   computational evidences; Product type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU03260"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12120"
FT                   /db_xref="GOA:P94396"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="SubtiList:BG12017"
FT                   /db_xref="UniProtKB/Swiss-Prot:P94396"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB12120.1"
FT                   /translation="MKRRVETITFDGGTLEYSVTGKGTPILVMHGGHSNCYEEFGYTAL
FT                   IEQGYSIITPSRPGYGRTSKEIGKSLANACRFYVKLLDHLQIESVHVIAISAGGPSGIC
FT                   FASHYPERVNTLTLQSAVTKEWLTPKDTEYKLGEILFRPPVEKWIWKLISSLNNAFPRL
FT                   MFRAMSPQFSTLPFQRIKSLMNEKDIEAFRKMNSRQRSGEGFLIDLSQTAAVSLKDLQA
FT                   IICPVLIMQSVYDGLVDLSHAHHAKEHIRGAVLCLLHSWGHLIWLGKEAAETGSILLGF
FT                   LES"
FT   gene            352858..353868
FT                   /gene="ffoR"
FT                   /locus_tag="BSU_03270"
FT                   /old_locus_tag="BSU03270"
FT   CDS_pept        352858..353868
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ffoR"
FT                   /locus_tag="BSU_03270"
FT                   /old_locus_tag="BSU03270"
FT                   /product="Fur-regulated NADPH:ferredoxin oxidoreductase"
FT                   /function="16.6: Maintain"
FT                   /function="16.8: Protect"
FT                   /EC_number="1.8.1.-"
FT                   /EC_number="1.18.1.-"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 16672620, 25826316; Product
FT                   type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU03270"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12121"
FT                   /db_xref="GOA:O31475"
FT                   /db_xref="InterPro:IPR022890"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="PDB:5XHU"
FT                   /db_xref="SubtiList:BG12018"
FT                   /db_xref="UniProtKB/Swiss-Prot:O31475"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:16672620, 25826316"
FT                   /protein_id="CAB12121.1"
FT                   /translation="MAENQEVYDVTIIGGGPIGLFTAFYCGMRELKTKVIEFLPKLGGK
FT                   VSLFFPEKIIRDIGGIPGIAGKQLIEQLKEQAATFDPDIVLNQRVTGFERLDDGTIVLT
FT                   GSEGKKHYTRTVILACGMGTLEVNEFDSEDAARYAGKNLHYGVEKLDAFKGKRVVISGG
FT                   GDTAVDWANELEPIAASVTVVHRREEFGGMESSVTKMKQSSVRVLTPYRLEQLNGDEEG
FT                   IKSVTVCHTESGQRKDIEIDELIINHGFKIDLGPMMEWGLEIEEGRVKADRHMRTNLPG
FT                   VFVAGDAAFYESKLRLIAGGFTEGPTAVNSAKAYLDPKAENMAMYSTHHKKLVHK"
FT   gene            complement(353900..355351)
FT                   /gene="nasF"
FT                   /locus_tag="BSU_03280"
FT                   /old_locus_tag="BSU03280"
FT   CDS_pept        complement(353900..355351)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nasF"
FT                   /locus_tag="BSU_03280"
FT                   /old_locus_tag="BSU03280"
FT                   /product="uroporphyrin-III C-methyltransferase"
FT                   /function="16.2: Construct biomass (Anabolism)"
FT                   /function="16.10: Respire"
FT                   /EC_number="2.1.1.107"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 9765565, 10217486, 15028686;
FT                   Product type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU03280"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12122"
FT                   /db_xref="GOA:P42437"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR003043"
FT                   /db_xref="InterPro:IPR006366"
FT                   /db_xref="InterPro:IPR012409"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="InterPro:IPR036108"
FT                   /db_xref="SubtiList:BG11098"
FT                   /db_xref="UniProtKB/Swiss-Prot:P42437"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:9765565, 10217486, 15028686"
FT                   /protein_id="CAB12122.1"
FT                   /translation="MIMKNGIVYFVGAGPGDPGLLTIKGKQALKEADVILYDRLANPKL
FT                   LEFASPDCQFIYCGKLPNRHFMKQKEINALLVEKALNGLTVVRLKGGDPSVFGRVGEEA
FT                   DALHEHGIRYEMVPGITSGIAAPLYAGIPVTHRDFASSFAMITAHDKSLKGTPNLDWEG
FT                   LARSVQTLVFYMGVKNLSYICQQLISYGKSPSVPVIVIQWGTWGRQRSVKGTLENIQQK
FT                   VQEHQITNPAIIVIGDIVNFQTHSWFESKPLIGRHLMVVTHGEDEDPLADKLRDSGADL
FT                   IEWPKWRTENMPVNEEILRKIGTFEDVFFTSRRAVCEFFRALASQKIDIRQLTAKLSAA
FT                   SEQAKTELEKRGFLVTAIQPDSEKRLVVGSRHAVENMQKHESCSFYITHENVIDDRFTH
FT                   MIQRTISESPLHMVICPNKLSVQQLINGGEQIGILPEPSASRPPIVCIGDDSAAGIYGF
FT                   TAVQEQDELLAFIHNQHAEKKLLHT"
FT   gene            complement(355412..355732)
FT                   /gene="nasE"
FT                   /locus_tag="BSU_03290"
FT                   /old_locus_tag="BSU03290"
FT   CDS_pept        complement(355412..355732)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nasE"
FT                   /locus_tag="BSU_03290"
FT                   /old_locus_tag="BSU03290"
FT                   /product="assimilatory nitrite reductase subunit"
FT                   /function="16.2: Construct biomass (Anabolism)"
FT                   /function="16.10: Respire"
FT                   /EC_number="1.7.1.4"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 10217486, 15028686, 9765565,
FT                   22103536; Product type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU03290"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12123"
FT                   /db_xref="GOA:P42436"
FT                   /db_xref="InterPro:IPR012748"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="SubtiList:BG11097"
FT                   /db_xref="UniProtKB/Swiss-Prot:P42436"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:10217486, 15028686, 9765565, 22103536"
FT                   /protein_id="CAB12123.1"
FT                   /translation="MVNKDVTKVCIGKIEELPEQLGKTVYIEDKELAVFKLSDGSIRAI
FT                   ENRCPHKGGVLAEGIVSGQYVFCPMHDWKISLEDGIVQEPDHGCVKTYETLIEGEHVYL
FT                   VY"
FT   gene            complement(355764..358181)
FT                   /gene="nasD"
FT                   /locus_tag="BSU_03300"
FT                   /old_locus_tag="BSU03300"
FT   CDS_pept        complement(355764..358181)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nasD"
FT                   /locus_tag="BSU_03300"
FT                   /old_locus_tag="BSU03300"
FT                   /product="assimilatory nitrite reductase subunit"
FT                   /function="16.2: Construct biomass (Anabolism)"
FT                   /function="16.10: Respire"
FT                   /EC_number="1.7.1.4"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 10972836, 15028686, 9765565,
FT                   16428414, 22103536; Product type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU03300"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12124"
FT                   /db_xref="GOA:P42435"
FT                   /db_xref="InterPro:IPR005117"
FT                   /db_xref="InterPro:IPR006066"
FT                   /db_xref="InterPro:IPR006067"
FT                   /db_xref="InterPro:IPR007419"
FT                   /db_xref="InterPro:IPR012744"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR017121"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036136"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR041575"
FT                   /db_xref="InterPro:IPR041854"
FT                   /db_xref="SubtiList:BG11096"
FT                   /db_xref="UniProtKB/Swiss-Prot:P42435"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:10972836, 15028686, 9765565, 16428414, 22103536"
FT                   /protein_id="CAB12124.1"
FT                   /translation="MGKKQLVLVGNGMAGVRAIEEILSVAKDEFQITIFGAEPHPNYNR
FT                   ILLSKVLQGDTDIKDITLNDWDWYEENNIQLYTNETVIKVDTENKTVITDADRIQPYDE
FT                   LILATGSVPFILPIPGADKKGVTAFRDIKDTDTMLAASKQYKKAAVIGGGLLGLEAARG
FT                   LLNLGMDVSVIHLAPFLMERQLDATAGRLLQNELEKQGMTFLLEKQTEEIVGDDRVEGL
FT                   RFKDGTSIEADLVVMAVGIRPNTTLGAESGIPVNRGIIVNDYMQTEIPHIYAVGECAEH
FT                   RGIAYGLVAPLYEQAKVLAKHMCGIETKPYEGSVLSTQLKVSGVEVFSAGDFNESEEKK
FT                   AIKVFDEQDGIYKKIVLRGNQIVGAVLFGDSSEGNRLFSMIQKEADISETSKISILQPL
FT                   SQEAGTSITAAMSDDEIICGCNGVSKGAIIQAIQEKGCSSTDEIKACTGASRSCGGCKP
FT                   LVEEILQHTLGSDFDASAQKEAICGCTTLSRDEVVEEIKAKGLSHTREVMNVLGWKTPE
FT                   GCSKCRPALNYYLGMINPTKYEDDRTSRFVNERMHANIQKDGTYSVVPRMYGGVTNSTD
FT                   LRKIADVVDKYEIPLVKMTGGQRIDLIGVKKEDLPKVWEDLDMPSGYAYGKTLRTVKTC
FT                   VGEQFCRFGTQDSMALGIALEKKFEGLNTPHKVKMAVSACPRNCAESGIKDLGVVGIDG
FT                   GWELYVGGNGGTHLRAGDLLMKVKTNEEVLEYAGAYLQYYRETANYLERTSAWLERVGL
FT                   SHVQSVLNDPEKRQELNGRMNETLSVHKDPWKDFLEDKQTSKELFENVVTTS"
FT   gene            complement(358303..360435)
FT                   /gene="nasC"
FT                   /locus_tag="BSU_03310"
FT                   /old_locus_tag="BSU03310"
FT   CDS_pept        complement(358303..360435)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nasC"
FT                   /locus_tag="BSU_03310"
FT                   /old_locus_tag="BSU03310"
FT                   /product="assimilatory nitrate reductase (catalytic
FT                   subunit)"
FT                   /function="16.11: Scavenge (Catabolism)"
FT                   /function="16.2: Construct biomass (Anabolism)"
FT                   /EC_number="1.7.99.4"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 10972836, 15028686, 9765565;
FT                   Product type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU03310"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12125"
FT                   /db_xref="GOA:P42434"
FT                   /db_xref="InterPro:IPR006655"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006657"
FT                   /db_xref="InterPro:IPR006963"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="InterPro:IPR027467"
FT                   /db_xref="SubtiList:BG11095"
FT                   /db_xref="UniProtKB/Swiss-Prot:P42434"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:10972836, 15028686, 9765565"
FT                   /protein_id="CAB12125.2"
FT                   /translation="MTERLLRYFRDKQQDVQSEKTYDTQCPFCSMQCKMQLVEQTIVTR
FT                   KKYTAIGIDNPTTQGRLCIKGMNAHQHALNSSRITRPLLKKNGEFMPVSWEEALNHIKD
FT                   QVTMIQTEHGHDAMAVYGSASITNEEAYLLGKFARVGLQTKYIDYNGRLCMSAAATAAN
FT                   QTFGADRGLTNPLSDIPHTRVIILAGTNIAECQPTIMPYFEKAKENGAYFIAIDPRETA
FT                   TTKIADLHLKIKPGTDAALANGLVKIIIDEQLINEDFIQSRTNGFEELKQHTDSLDLND
FT                   IAEQTSVSLVDIRKAAVKFAKETSGMLFTARGIEQQTDGTAAVKGFLNMVLITGKIGKP
FT                   YSGYGAITGQGNGQGAREHGQKADQLPGYRSIENEEHRAHIAKVWGIHQDELPRKGVSA
FT                   YEMMEKINDGDIKGLFLMCSNPAVSSPNANLVKKALRRLTFFVAIDLFISETAKYADVI
FT                   LPASSYLEDEGTMTNVEGRVTLREASRPCPGEAKHDWQIICDLASALGKGRYFSYTSAE
FT                   DIFNELREASRGGIADYSGISYGRLRREGGIHWPCPESDHPGTGRLFTESFAHPDQKAA
FT                   LSVIPNEPPVPKEKPTADYPLYLTTGRVMSHYLTGVQTRKSAALAARHFESFMEIHPQT
FT                   AATYNIEDRVLVKIESPRGSITVRSKLSEQIRKDTVFVPIHWADAQNVNDLIGEALDPA
FT                   CKMPGFKVCAVRIIPI"
FT   gene            complement(360442..362757)
FT                   /gene="nasB"
FT                   /locus_tag="BSU_03320"
FT                   /old_locus_tag="BSU03320"
FT   CDS_pept        complement(360442..362757)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nasB"
FT                   /locus_tag="BSU_03320"
FT                   /old_locus_tag="BSU03320"
FT                   /product="assimilatory nitrate reductase (electron transfer
FT                   subunit NasB)"
FT                   /function="16.2: Construct biomass (Anabolism)"
FT                   /function="16.11: Scavenge (Catabolism)"
FT                   /EC_number="1.7.1.3"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 7836289, 8799114, 9765565,
FT                   10940050, 10972836, 15028686, 24122235; Product type e:
FT                   enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU03320"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12126"
FT                   /db_xref="GOA:P42433"
FT                   /db_xref="InterPro:IPR005117"
FT                   /db_xref="InterPro:IPR007419"
FT                   /db_xref="InterPro:IPR012744"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR017121"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036136"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR041575"
FT                   /db_xref="InterPro:IPR041854"
FT                   /db_xref="SubtiList:BG11094"
FT                   /db_xref="UniProtKB/Swiss-Prot:P42433"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:7836289, 8799114, 9765565, 10940050, 10972836,
FT                   15028686, 24122235"
FT                   /protein_id="CAB12126.2"
FT                   /translation="MKKQRLVLAGNGMAGIRCIEEVLKLNRHMFEIVIFGSEPHPNYNR
FT                   ILLSSVLQGEASLDDITLNSKDWYDKHGITLYTGETVIQIDTDQQQVITDRKRTLSYDK
FT                   LIVATGSSPHILPIPGADKKGVYGFRTIEDCQALMNMAQHFQKAAVIGAGLLGLEAAVG
FT                   LQHLGMDVSVIHHSAGIMQKQLDQTAARLLQTELEQKGLTFLLEKDTVSISGATKADRI
FT                   HFKDGSSLKADLIVMAAGVKPNIELAVSAGIKVNRGIIVNDFMQTSEPNIYAVGECAEH
FT                   NGTVYGLVAPLYEQGKALASHICGVPCEEYQGSAPSAALKIAGIDVWSAGKIQEDERTT
FT                   SIKIYDEQAGVYKKALFVDDKLAGVILFGDTRDKQRLLDSLLKQRDISIAKKQIIEPET
FT                   SGPLFESMPSSETICQCNTVTKGAIEDAVHTNSLTTVEEVKHCTKATGSCGGCKPLVED
FT                   LLRYMTNSEYTKPASTPSFCSCTDFTEDDIIAELQRRPFTNPAEVMNQLDWKTKNGCST
FT                   CVPAIQYYLEMLYPGFVQPEPATEETCILIPQMYGGRTNAEQLRTIANIIEAYSIPDVS
FT                   ITHGQRLKLSGIKPADLPNMKKDLKMPVYTNEHRHALQSIKACTCGQNRSIQQLAAQIE
FT                   RQLEMLPLPAPISISLSCETDCTEAALQDVGAIRTQAGWDIHIGGVRGTHARSGALFCV
FT                   TENEDSTAGMIKGLIQYYRETAHYLEGVHQWIDRLGIVHIREVLFEEDLRAQLLESLQT
FT                   DLSLIQNPTVETGAYKKG"
FT   gene            362937..364142
FT                   /gene="nasA"
FT                   /locus_tag="BSU_03330"
FT                   /old_locus_tag="BSU03330"
FT   CDS_pept        362937..364142
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nasA"
FT                   /locus_tag="BSU_03330"
FT                   /old_locus_tag="BSU03330"
FT                   /product="putative nitrate transporter"
FT                   /function="16.1: Circulate"
FT                   /note="Evidence 3: Putative function from multiple
FT                   computational evidences; PubMedId: 7868621, 12823818,
FT                   15849754, 16850406; Product type t: transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BSU03330"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12127"
FT                   /db_xref="GOA:P42432"
FT                   /db_xref="InterPro:IPR004737"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="SubtiList:BG11093"
FT                   /db_xref="UniProtKB/Swiss-Prot:P42432"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB12127.2"
FT                   /translation="MKLSELKTSGHPLTLLCSFLYFDVSFMIWVMLGALGVYISQDFGL
FT                   SPFEKGLVVAVPILSGSVFRIILGILTDRIGPKKTAVIGMLVTMIPLLWGTFGGRSLTE
FT                   LYAIGILLGVAGASFAVALPMASRWYPPHLQGLAMGIAGAGNSGTLFATLFGPRLAEQF
FT                   GWHIVMGIALIPLLIVFILFVSMAKDSPAQPSPQPLKSYLHVFGQKETWFFCLLYSVTF
FT                   GGFVGLSSFLSIFFVDQYQLSKIHAGDFVTLCVAAGSFFRPVGGLISDRVGGTKVLSVL
FT                   FVIVALCMAGVSSLPSLSMVIVLLFVGMMGLGMGNGAVFQLVPQRFRKEIGMVTGIVGA
FT                   AGGIGGFFLPNILGSLKQMTGTYAIGFITFSCIALLAFALVLAAGYYWRKSWSAESSPA
FT                   DV"
FT   gene            364259..365173
FT                   /gene="folEB"
FT                   /locus_tag="BSU_03340"
FT                   /old_locus_tag="BSU03340"
FT   CDS_pept        364259..365173
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="folEB"
FT                   /locus_tag="BSU_03340"
FT                   /old_locus_tag="BSU03340"
FT                   /product="GTP cyclohydrolase I"
FT                   /function="16.2: Construct biomass (Anabolism)"
FT                   /EC_number="3.5.4.16"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 12426338, 17032654, 19767425;
FT                   Product type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU03340"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12128"
FT                   /db_xref="GOA:P94398"
FT                   /db_xref="InterPro:IPR003801"
FT                   /db_xref="InterPro:IPR022838"
FT                   /db_xref="SubtiList:BG12019"
FT                   /db_xref="UniProtKB/Swiss-Prot:P94398"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:12426338, 17032654, 19767425"
FT                   /protein_id="CAB12128.2"
FT                   /translation="MNQHTLLPKKTERLQYFGSVSPIKGEKPVEKEKMKDLQNIRKDYF
FT                   FDIQHVGVANVSHPVTITSAMMPAEQTTAANFTMTCNLPRNQKGINMSRLTELLQVYHQ
FT                   NGWILSFSSLQQFTKELAENMDTSSATVEVRFPWFFERKSPKLEKAGLMHADIFMSVTY
FT                   RKDQPFKQRAGISAKVTTLCPCSKEISEYSAHNQRGTVSIWADIHPAASLPSDVKADLL
FT                   HAAESNASARLHPVLKRPDEKAVTETAYENPRFVEDLARLIAADLFELEWVSAFEIECR
FT                   NEESIHLHDAYAKLCFSKEVDKI"
FT   gene            365170..365754
FT                   /gene="yciB"
FT                   /locus_tag="BSU_03350"
FT                   /old_locus_tag="BSU03350"
FT   CDS_pept        365170..365754
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yciB"
FT                   /locus_tag="BSU_03350"
FT                   /old_locus_tag="BSU03350"
FT                   /product="putative Zn(2+)-dependent division lipoprotein
FT                   (schizosome)"
FT                   /function="16.1: Circulate"
FT                   /function="16.13: Shape"
FT                   /note="Evidence 3: Putative function from multiple
FT                   computational evidences; PubMedId: 12426338, 20013255;
FT                   Product type f: factor"
FT                   /db_xref="EnsemblGenomes-Gn:BSU03350"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12129"
FT                   /db_xref="GOA:C0SP99"
FT                   /db_xref="InterPro:IPR005490"
FT                   /db_xref="InterPro:IPR038063"
FT                   /db_xref="SubtiList:BG12020"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0SP99"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB12129.2"
FT                   /translation="MKLSLFIIAVLMPVILLSACSDHAEEHASINTKKTVENITDVRKT
FT                   AKTSIDWTKPSGGEYPDIKQKHVWIDVNVKEQKAYIKEGSNTIYTMMISSGLDQTKDDA
FT                   TPKGTFYVEPERGEWFFSEGYQEGAEYWVSWKNHGEFLFHSVPMTKDQKVIKTEAEKLG
FT                   TKASHGCIRLTIPDAKWVYENIPEHTKVVIS"
FT   gene            365850..366035
FT                   /gene="yczL"
FT                   /locus_tag="BSU_03359"
FT                   /old_locus_tag="BSU03359"
FT   CDS_pept        365850..366035
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yczL"
FT                   /locus_tag="BSU_03359"
FT                   /old_locus_tag="BSU03359"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5: Unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:BSU03359"
FT                   /db_xref="EnsemblGenomes-Tr:CAX52544"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0H3U7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX52544.1"
FT                   /translation="MKSGKASIKDLAVGKGKDLRWGKGLNAVGVFTDLEIGRQREMSAK
FT                   SCSTPLYIRRSIQFKS"
FT   gene            366063..367256
FT                   /gene="zinU"
FT                   /locus_tag="BSU_03360"
FT                   /old_locus_tag="BSU03360"
FT   CDS_pept        366063..367256
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="zinU"
FT                   /locus_tag="BSU_03360"
FT                   /old_locus_tag="BSU03360"
FT                   /product="zinc metallochaperone with NTPase activity"
FT                   /function="16.1: Circulate"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 2013568, 9811636, 12426338,
FT                   18344368, 19648245, 27060116, 27561249; Product type t:
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BSU03360"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12130"
FT                   /db_xref="GOA:P94400"
FT                   /db_xref="InterPro:IPR003495"
FT                   /db_xref="InterPro:IPR011629"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="SubtiList:BG12021"
FT                   /db_xref="UniProtKB/Swiss-Prot:P94400"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:2013568, 9811636, 12426338, 18344368, 19648245,
FT                   27060116, 27561249"
FT                   /protein_id="CAB12130.1"
FT                   /translation="MKKIPVTVLSGYLGAGKTTLLNSILQNREGLKIAVIVNDMSEVNI
FT                   DAGLVKQEGGLSRTDEKLVEMSNGCICCTLREDLLIEVEKLAKDGRFDYIVIESTGISE
FT                   PIPVAQTFSYIDEEMGIDLTKFCQLDTMVTVVDANRFWHDYQSGESLLDRKEALGEKDE
FT                   REIADLLIDQIEFCDVLILNKCDLVSEQELEQLENVLRKLQPRARFIRSVKGNVKPQEI
FT                   LHTGLFNFEEASGSAGWIQELTAGHAEHTPETEEYGISSFVYKRRLPFHSTRFYRWLDQ
FT                   MPKNVVRAKGIVWCASHNNLALLMSQAGPSVTIEPVSYWVAALPKLEQEQVKQQEPEIL
FT                   EEWDPEFGDRLTQLVFIGTDLDEETITKELDQCLLTEYEFDSDWSLFEDPFKWKLNQ"
FT   gene            complement(367305..367985)
FT                   /gene="yckA"
FT                   /locus_tag="BSU_03370"
FT                   /old_locus_tag="BSU03370"
FT   CDS_pept        complement(367305..367985)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yckA"
FT                   /locus_tag="BSU_03370"
FT                   /old_locus_tag="BSU03370"
FT                   /product="aminoacid ABC transporter (permease subunit)"
FT                   /function="16.1: Circulate"
FT                   /note="Evidence 2b: Function from indirect experimental
FT                   evidences (e.g. phenotypes); PubMedId: 15849754, 16850406,
FT                   23038252; Product type t: transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BSU03370"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12131"
FT                   /db_xref="GOA:P42399"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="SubtiList:BG11177"
FT                   /db_xref="UniProtKB/Swiss-Prot:P42399"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB12131.1"
FT                   /translation="MINSIQWEYIFNTKLAIESFPYVIKGIGYTLLISFVSMFAGTVIG
FT                   LFISLARMSKLALLRWPAKLYISFMRGVPILVILFILYFGFPYIGIEFSAVTAALIGFS
FT                   LNSAAYIAEINRSAISSVEKGQWEAASSLGLSYWQTMRGIILPQSIRIALPPLANVLLD
FT                   LIKASSLAAMITVPELLQHAKIIGGREFDYMTMYILTALIYWAICSIAAVFQNILEKKY
FT                   AHYV"
FT   gene            complement(367995..368858)
FT                   /gene="yckB"
FT                   /locus_tag="BSU_03380"
FT                   /old_locus_tag="BSU03380"
FT   CDS_pept        complement(367995..368858)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yckB"
FT                   /locus_tag="BSU_03380"
FT                   /old_locus_tag="BSU03380"
FT                   /product="amino acid ABC transporter (binding lipoprotein
FT                   subunit)"
FT                   /function="16.1: Circulate"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 23038252; Product type t:
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BSU03380"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12132"
FT                   /db_xref="GOA:P42400"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR018313"
FT                   /db_xref="PDB:2IEE"
FT                   /db_xref="SubtiList:BG11178"
FT                   /db_xref="UniProtKB/Swiss-Prot:P42400"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:23038252"
FT                   /protein_id="CAB12132.1"
FT                   /translation="MKSFMHSKAVIFSFTMAFFLILAACSGKNEADSKDTGWEQIKDKG
FT                   KIVVATSGTLYPTSYHDTDSGSDKLTGYEVEVVREAAKRLGLKVEFKEMGIDGMLTAVN
FT                   SGQVDAAANDIDVTKDREEKFAFSTPYKYSYGTAIVRKDDLSGIKTLKDLKGKKAAGAA
FT                   TTVYMEVARKYGAKEVIYDNATNEQYLKDVANGRTDVILNDYYLQTLALAAFPDLNITI
FT                   HPDIKYMPNKQALVMKKSNAALQKKMNEALKEMSKDGSLTKLSKQFFNKADVSKKIDAD
FT                   VQDVDL"
FT   gene            369020..369217
FT                   /locus_tag="BSU_03385"
FT                   /old_locus_tag="BSU03385"
FT   CDS_pept        369020..369217
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSU_03385"
FT                   /old_locus_tag="BSU03385"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5: Unknown function"
FT                   /db_xref="UniProtKB/TrEMBL:A0A2K4Z9F2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="SOX90541.1"
FT                   /translation="MSKDECQTYQGNACESEGCSRPVTHLCQYRKKWSRGMKPIFRINL
FT                   SLADAPKAYDIFDEKENGNI"
FT   gene            369236..369691
FT                   /gene="yckC"
FT                   /locus_tag="BSU_03390"
FT                   /old_locus_tag="BSU03390"
FT   CDS_pept        369236..369691
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yckC"
FT                   /locus_tag="BSU_03390"
FT                   /old_locus_tag="BSU03390"
FT                   /product="conserved integral membrane protein of unknown
FT                   function"
FT                   /note="Evidence 4: Unknown function but conserved in other
FT                   organisms; PubMedId: 15849754, 16850406; Product type m:
FT                   membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:BSU03390"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12133"
FT                   /db_xref="GOA:P42401"
FT                   /db_xref="InterPro:IPR010432"
FT                   /db_xref="SubtiList:BG11179"
FT                   /db_xref="UniProtKB/Swiss-Prot:P42401"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB12133.1"
FT                   /translation="MNIYKPAGFWIRLGAALLDYIIVSVPLLLIYWLITGKDPNDSMFI
FT                   SLVVLLYSILLPMFWRGYLIGKRICGIRIVKKDGSQVSLLTMFLRVIVAGLVYCITFGL
FT                   GLIASLILIAVREDKRTLHDLIAGTYVTYATPGEEELNADEEIRKSE"
FT   gene            369773..370105
FT                   /gene="yckD"
FT                   /locus_tag="BSU_03400"
FT                   /old_locus_tag="BSU03400"
FT   CDS_pept        369773..370105
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yckD"
FT                   /locus_tag="BSU_03400"
FT                   /old_locus_tag="BSU03400"
FT                   /product="putative exported protein"
FT                   /note="Evidence 3: Putative function from multiple
FT                   computational evidences; Product type f: factor"
FT                   /db_xref="EnsemblGenomes-Gn:BSU03400"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12134"
FT                   /db_xref="InterPro:IPR024485"
FT                   /db_xref="SubtiList:BG11180"
FT                   /db_xref="UniProtKB/Swiss-Prot:P42402"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB12134.1"
FT                   /translation="MKRITINIITMFIAAAVISLTGTAEAAEKQQQSPANVTLTDQQKK
FT                   EIEQLEAEILKKRKDVISKYVQYGILPKERGEHIKNHLDKHFEMMKQNGFVPKHHPHPH
FT                   KFEKRH"
FT   gene            370259..371692
FT                   /gene="bglC"
FT                   /locus_tag="BSU_03410"
FT                   /old_locus_tag="BSU03410"
FT   CDS_pept        370259..371692
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bglC"
FT                   /locus_tag="BSU_03410"
FT                   /old_locus_tag="BSU03410"
FT                   /product="aryl-phospho-beta-d-glucosidase"
FT                   /function="16.11: Scavenge (Catabolism)"
FT                   /EC_number="3.2.1.86"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 14652714, 15139916, 18069788;
FT                   Product type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU03410"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12135"
FT                   /db_xref="GOA:P42403"
FT                   /db_xref="InterPro:IPR001360"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR018120"
FT                   /db_xref="InterPro:IPR033132"
FT                   /db_xref="SubtiList:BG11181"
FT                   /db_xref="UniProtKB/Swiss-Prot:P42403"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:14652714, 15139916, 18069788"
FT                   /protein_id="CAB12135.1"
FT                   /translation="MIHQHPESFPKHFLWGSASAAYQIEGAWNEDGKGPSVWDVFTKIP
FT                   GKTFKGTNGEIAVDHYHRFKEDVALMAEMGLKAYRFSVSWPRVFPKGKGEINEAGLAFY
FT                   DSLIDELLSHHIEPVLTLYHWDLPQALMDEYGGFESRNIIEDFNHYCITLYKRFGDRVK
FT                   YWVTLNEQNYNFNHGFITAMHPPGVKDRKRFYEANHIAFLANAKAIESFREYVPEGKIG
FT                   PSFAYSPAYPLSSHPEDILAFENAEEFTNNWWLDMYCWGTYPQIPFRCLEKQGWAPTIE
FT                   AGDMDLLAKGKPDFVGVNYYQTITYERNPLDGVSEGKMNTTGQKGTNQETGIPGVFKTK
FT                   KNPHLTTSNWDWTIDPIGLRIGLRRITSRYQLPVFITENGLGEFDKVEDGTVQDDYRID
FT                   YLRSHLEQCRQAISDGVDLIGYCSWSFTDLLSWLNGYQKRYGFVYVNRDEESTSDLKRL
FT                   KKKSFYWYQDVIKTNGESL"
FT   gene            complement(371729..372127)
FT                   /gene="nin"
FT                   /locus_tag="BSU_03420"
FT                   /old_locus_tag="BSU03420"
FT   CDS_pept        complement(371729..372127)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nin"
FT                   /locus_tag="BSU_03420"
FT                   /old_locus_tag="BSU03420"
FT                   /product="inhibitor of the DNA degrading activity of NucA
FT                   (competence)"
FT                   /function="16.3: Control"
FT                   /function="16.11: Scavenge (Catabolism)"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 11359569, 11814663, 22720735;
FT                   Product type r: regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BSU03420"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12136"
FT                   /db_xref="GOA:P12669"
FT                   /db_xref="InterPro:IPR020354"
FT                   /db_xref="InterPro:IPR038691"
FT                   /db_xref="PDB:4MQD"
FT                   /db_xref="SubtiList:BG10839"
FT                   /db_xref="UniProtKB/Swiss-Prot:P12669"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:11359569, 11814663, 22720735"
FT                   /protein_id="CAB12136.1"
FT                   /translation="MIKSWKPQELSISYHQFTVFQKDSTPPVMDWTDEAIEKGYAAADG
FT                   AISFEAQRNTKAFILFRLNSSETVNSYEKKVTVPFHVTENGIHIESIMSKRLSFDLPKG
FT                   DYQLTCWTVPAEMSDLHADTYIIDAVSV"
FT   gene            complement(372154..372603)
FT                   /gene="nucA"
FT                   /locus_tag="BSU_03430"
FT                   /old_locus_tag="BSU03430"
FT   CDS_pept        complement(372154..372603)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nucA"
FT                   /locus_tag="BSU_03430"
FT                   /old_locus_tag="BSU03430"
FT                   /product="endonuclease"
FT                   /function="16.6: Maintain"
FT                   /function="16.11: Scavenge (Catabolism)"
FT                   /function="16.8: Protect"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 2841296, 7746143, 11359569,
FT                   11814663; Product type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU03430"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12137"
FT                   /db_xref="GOA:P12667"
FT                   /db_xref="InterPro:IPR029476"
FT                   /db_xref="SubtiList:BG10838"
FT                   /db_xref="UniProtKB/Swiss-Prot:P12667"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:2841296, 7746143, 11359569, 11814663"
FT                   /protein_id="CAB12137.3"
FT                   /translation="MNITTDIIKTILLVIVIIAAAAVGLIKGDFFSADQKTSQTKEYDE
FT                   TMAFPSDRYPETAKHIKDAINEGHSEVCTIDRDGAEERREQSLKDVPSKKGYDRDEWPM
FT                   AMCKEGGEGASVEYISPADNRGAGSWVGHRLTDYPDGTKVLFTIQ"
FT   gene            complement(372771..374492)
FT                   /gene="tlpC"
FT                   /locus_tag="BSU_03440"
FT                   /old_locus_tag="BSU03440"
FT   CDS_pept        complement(372771..374492)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tlpC"
FT                   /locus_tag="BSU_03440"
FT                   /old_locus_tag="BSU03440"
FT                   /product="methyl-accepting chemotaxis protein (plant
FT                   colonization)"
FT                   /function="16.3: Control"
FT                   /function="16.12: Sense"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 7704255, 7921238, 15187186,
FT                   27899502; Product type rc: receptor"
FT                   /db_xref="EnsemblGenomes-Gn:BSU03440"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12138"
FT                   /db_xref="GOA:P39209"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR033463"
FT                   /db_xref="SubtiList:BG10790"
FT                   /db_xref="UniProtKB/Swiss-Prot:P39209"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:7704255, 7921238, 15187186, 27899502"
FT                   /protein_id="CAB12138.2"
FT                   /translation="MLIKRFKMKLGTKILCLVFVVILLFSASVGTVMLKEITESMKQMA
FT                   TEKAKGDLALSSTYIDDVMSGDWQVKNNKLYKGQTQINGNEDIVDLLGEKTGDTITIFQ
FT                   GDTRVATNVMKNGERAVGTQASSEVIAAVLKKGKRFYGQADVAGSSYQTAYMPLKDQNG
FT                   NIIGMLYTGANQSILASLTQSLFTQFAIVLVIVIMVSVILVLVFTRKINKRLNALKSAF
FT                   ESAGNGDMTIEVSDKTGDELSELSVYYNKMRMKLNDTIQTVQQSALQLASASQQLSAGA
FT                   EETNQASEKITEAVQQIANGAQDQITRIENSESSLKQASADIRDISANTAAIADKGQLA
FT                   QSKADIGQKEIANVQAQMDAIHQSIQKSGEIIHQLDGRSKQIEQILSVITQIADQTNLL
FT                   ALNAAIEAARAGEQGKGFAVVADEVRKLAEESQQSAGQISKLIIEIQKDMNRSARSVEH
FT                   VKTEAAEGVTMIQRTRDAFKEIAAATGEISAEISDLSASVTNISASAHQINDSFAANTA
FT                   DIKESTKNTRQAAALTEEQFAAMEEITAASETLSQLAEELTGIISQFKMINQAENG"
FT   gene            complement(374603..375160)
FT                   /gene="hxlB"
FT                   /locus_tag="BSU_03450"
FT                   /old_locus_tag="BSU03450"
FT   CDS_pept        complement(374603..375160)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hxlB"
FT                   /locus_tag="BSU_03450"
FT                   /old_locus_tag="BSU03450"
FT                   /product="6-phospho-3-hexuloisomerase (PHI)"
FT                   /function="16.11: Scavenge (Catabolism)"
FT                   /function="16.8: Protect"
FT                   /EC_number="5.3.1.27"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 10572115, 15978081; Product
FT                   type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU03450"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12139"
FT                   /db_xref="GOA:P42404"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR017552"
FT                   /db_xref="PDB:1M3S"
FT                   /db_xref="PDB:1VIV"
FT                   /db_xref="SubtiList:BG11182"
FT                   /db_xref="UniProtKB/Swiss-Prot:P42404"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:10572115, 15978081"
FT                   /protein_id="CAB12139.1"
FT                   /translation="MKTTEYVAEILNELHNSAAYISNEEADQLADHILSSHQIFTAGAG
FT                   RSGLMAKSFAMRLMHMGFNAHIVGEILTPPLAEGDLVIIGSGSGETKSLIHTAAKAKSL
FT                   HGIVAALTINPESSIGKQADLIIRMPGSPKDQSNGSYKTIQPMGSLFEQTLLLFYDAVI
FT                   LKLMEKKGLDSETMFTHHANLE"
FT   gene            complement(375166..375798)
FT                   /gene="hxlA"
FT                   /locus_tag="BSU_03460"
FT                   /old_locus_tag="BSU03460"
FT   CDS_pept        complement(375166..375798)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hxlA"
FT                   /locus_tag="BSU_03460"
FT                   /old_locus_tag="BSU03460"
FT                   /product="3-hexulose-6-phosphate synthase (HPS)"
FT                   /function="16.11: Scavenge (Catabolism)"
FT                   /function="16.8: Protect"
FT                   /EC_number="4.1.2.43"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 10572115, 15978081; Product
FT                   type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU03460"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12140"
FT                   /db_xref="GOA:P42405"
FT                   /db_xref="InterPro:IPR001754"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017553"
FT                   /db_xref="InterPro:IPR041710"
FT                   /db_xref="SubtiList:BG11183"
FT                   /db_xref="UniProtKB/Swiss-Prot:P42405"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:10572115, 15978081"
FT                   /protein_id="CAB12140.1"
FT                   /translation="MELQLALDLVNIPEAIELVKEVEQYIDVVEIGTPVVINEGLRAVK
FT                   EIKEAFPQLKVLADLKIMDAGGYEIMKASEAGADIITVLGATDDATIKGAVEEAKKQKK
FT                   KILVDMINVKDIESRAKEIDALGVDYICVHTGYDLQAEGKNSFEELTTIKNTVKNAKTA
FT                   IAGGIKLDTLPEVIQQKPDLVIVGGGITSAADKAETASKMKQLIVQG"
FT   gene            376032..376394
FT                   /gene="hxlR"
FT                   /locus_tag="BSU_03470"
FT                   /old_locus_tag="BSU03470"
FT   CDS_pept        376032..376394
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hxlR"
FT                   /locus_tag="BSU_03470"
FT                   /old_locus_tag="BSU03470"
FT                   /product="positive regulator of hxlAB expression
FT                   (formaldehyde sensing)"
FT                   /function="16.3: Control"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 15978081, 26973631; Product
FT                   type r: regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BSU03470"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12141"
FT                   /db_xref="GOA:P42406"
FT                   /db_xref="InterPro:IPR002577"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="SubtiList:BG11184"
FT                   /db_xref="UniProtKB/Swiss-Prot:P42406"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:15978081, 26973631"
FT                   /protein_id="CAB12141.2"
FT                   /translation="MSRMDDKRFNCEKELTLAVIGGKWKMLILWHLGKEGTKRFNELKT
FT                   LIPDITQKILVNQLRELEQDMIVHREVYPVVPPKVEYSLTPHGESLMPILEAMYEWGKG
FT                   YMELIDIDKNVMKESL"
FT   gene            376968..387731
FT                   /gene="srfAA"
FT                   /locus_tag="BSU_03480"
FT                   /old_locus_tag="BSU03480"
FT   CDS_pept        376968..387731
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="srfAA"
FT                   /locus_tag="BSU_03480"
FT                   /old_locus_tag="BSU03480"
FT                   /product="surfactin synthetase"
FT                   /function="16.8: Protect"
FT                   /function="16.5: Explore"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 15066026, 16166527, 8288534,
FT                   8441623, 14762003, 16707694, 26284661, 26268540, 14762003;
FT                   Product type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU03480"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12142"
FT                   /db_xref="GOA:P27206"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR001242"
FT                   /db_xref="InterPro:IPR006162"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR010060"
FT                   /db_xref="InterPro:IPR010071"
FT                   /db_xref="InterPro:IPR020806"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="SubtiList:BG10168"
FT                   /db_xref="UniProtKB/Swiss-Prot:P27206"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:15066026, 16166527, 8288534, 8441623, 14762003,
FT                   16707694, 26284661, 26268540, 14762003"
FT                   /protein_id="CAB12142.2"
FT                   /translation="MEITFYPLTDAQKRIWYTEKFYPHTSISNLAGIGKLVSADAIDYV
FT                   LVEQAIQEFIRRNDAMRLRLRLDENGEPVQYISEYRPVDIKHTDTTEDPNAIEFISQWS
FT                   REETKKPLPLYDCDLFRFSLFTIKENEVWFYANVHHVISDGISMNILGNAIMHIYLELA
FT                   SGSETKEGISHSFIDHVLSEQEYAQSKRFEKDKAFWNKQFESVPELVSLKRNASAGGSL
FT                   DAERFSKDVPEALHQQILSFCEANKVSVLSVFQSLLAAYLYRVSGQNDVVTGTFMGNRT
FT                   NAKEKQMLGMFVSTVPLRTNIDGGQAFSEFVKDRMKDLMKTLRHQKYPYNLLINDLRET
FT                   KSSLTKLFTVSLEYQVMQWQKEEDLAFLTEPIFSGSGLNDVSIHVKDRWDTGKLTIDFD
FT                   YRTDLFSREEINMICERMITMLENALTHPEHTIDELTLISDAEKEKLLARAGGKSVSYR
FT                   KDMTIPELFQEKAELLSDHPAVVFEDRTLSYRTLHEQSARIANVLKQKGVGPDSPVAVL
FT                   IERSERMITAIMGILKAGGAYVPIDPGFPAERIQYILEDCGADFILTESKVAAPEADAE
FT                   LIDLDQAIEEGAEESLNADVNARNLAYIIYTSGTTGRPKGVMIEHRQVHHLVESLQQTI
FT                   YQSGSQTLRMALLAPFHFDASVKQIFASLLLGQTLYIVPKKTVTNGAALTAYYRKNSIE
FT                   ATDGTPAHLQMLAAAGDFEGLKLKHMLIGGEGLSSVVADKLLKLFKEAGTAPRLTNVYG
FT                   PTETCVDASVHPVIPENAVQSAYVPIGKALGNNRLYILDQKGRLQPEGVAGELYIAGDG
FT                   VGRGYLHLPELTEEKFLQDPFVPGDRMYRTGDVVRWLPDGTIEYLGREDDQVKVRGYRI
FT                   ELGEIEAVIQQAPDVAKAVVLARPDEQGNLEVCAYVVQKPGSEFAPAGLREHAARQLPD
FT                   YMVPAYFTEVTEIPLTPSGKVDRRKLFALEVKAVSGTAYTAPRNETEKAIAAIWQDVLN
FT                   VEKAGIFDNFFETGGHSLKAMTLLTKIHKETGIEIPLQFLFEHPTITALAEEADHRESK
FT                   AFAVIEPAEKQEHYPLSLAQQRTYIVSQFEDAGVGYNMPAAAILEGPLDIQKLERAFQG
FT                   LIRRHESLRTSFVLENSTPRQKIHDSVDFNIEMIERGGRSDEAIMASFVRTFDLAKAPL
FT                   FRIGLLGLEENRHMLLFDMHHLISDGVSIGIMLEELARIYKGEQLPDLRLQYKDYAVWQ
FT                   SRQAAEGYKKDQAYWKEVFAGELPVLQLLSDYPRPPVQSFEGDRVSIKLDAGVKDRLNR
FT                   LAEQNGATLYMVMLSAYYTLLSKYTGQDDIIVGTPSAGRNHSDTEGIIGMFVNTLAIRS
FT                   EVKQNETFTQLISRVRKRVLDAFSHQDYPFEWLVEDLNIPRDVSRHPLFDTMFSLQNAT
FT                   EGIPAVGDLSLSVQETNFKIAKFDLTVQARETDEGIEIDVDYSTKLFKQSTADRLLTHF
FT                   ARLLEDAAADPEKPISEYKLLSEEEAASQIQQFNPGRTPYPKDKTIVQLFEEQAANTPD
FT                   HTALQYEGESLTYRELNERANRLARGILSLGAGEGRTAAVLCERSMDMIVSILAVLKSG
FT                   SAYVPIDPEHPIQRMQHFFRDSGAKVLLTQRKLKALAEEAEFKGVIVLADEEESYHADA
FT                   RNLALPLDSAAMANLTYTSGTTGTPKGNIVTHANILRTVKETNYLSITEQDTILGLSNY
FT                   VFDAFMFDMFGSLLNGAKLVLIPKETVLDMARLSRVIERENISILMITTALFHLLVDLN
FT                   PACLSTLRKIMFGGERASVEHVRKALQTVGKGKLLHMYGPSESTVFATYHPVDELEEHT
FT                   LSVPIGKPVSNTEVYILDRTGHVQPAGIAGELCVSGEGLVKGYYNRPELTEEKFVPHPF
FT                   TSGERMYKTGDLARWLPNGDIEFIGRIDHQVKIRGQRIELGEIEHQLQTHDRVQESVVL
FT                   AVDQGAGDKLLCAYYVGEGDISSQEMREHAAKDLPAYMVPAVFIQMDELPLTGNGKIDR
FT                   RALPIPDANVSRGVSYVAPRNGTEQKVADIWAQVLQAEQVGAYDHFFDIGGHSLAGMKM
FT                   LALVHQELGVELSLKDLFQSPTVEGLAQVIASAEKGTAASISPAEKQDTYPVSSPQKRM
FT                   YVLQQLEDAQTSYNMPAVLRLTGELDVERLNSVMQQLMQRHEALRTTFEIKDGETVQRI
FT                   WEEAECEIAYFEAPEEETERIVSEFIKPFKIDQLPLFRIGLIKHSDTEHVLLFDMHHII
FT                   SDGASVGVLIEELSKLYDGETLEPLRIQYKDYAVWQQQFIQSELYKKQEEHWLKELDGE
FT                   LPVLTLPTDYSRPAVQTFEGDRIAFSLEAGKADALRRLAKETDSTLYMVLLASYSAFLS
FT                   KISGQDDIIVGSPVAGRSQADVSRVIGMFVNTLALRTYPKGEKTFADYLNEVKETALSA
FT                   FDAQDYPLEDLIGNVQVQRDTSRNPLFDAVFSMQNANIKDLTMKGIQLEPHPFERKTAK
FT                   FDLTLTADETDGGLTFVLEYNTALFKQETIERWKQYWMELLDAVTGNPNQPLSSLSLVT
FT                   ETEKQALLEAWKGKALPVPTDKTVHQLFEETAQRHKDRPAVTYNGQSWTYGELNAKANR
FT                   LARILMDCGISPDDRVGVLTKPSLEMSAAVLGVLKAGAAFVPIDPDYPDQRIEYILQDS
FT                   GAKLLLKQEGISVPDSYTGDVILLDGSRTILSLPLDENDEENPETAVTAENLAYMIYTS
FT                   GTTGQPKGVMVEHHALVNLCFWHHDAFSMTAEDRSAKYAGFGFDASIWEMFPTWTIGAE
FT                   LHVIEEAIRLDIVRLNDYFETNGVTITFLPTQLAEQFMELENTSLRVLLTGGDKLKRAV
FT                   KKPYTLVNNYGPTENTVVATSAEIHPEEGSLSIGRAIANTRVYILGEGNQVQPEGVAGE
FT                   LCVAGRGLARGYLNREDETAKRFVADPFVPGERMYRTGDLVKWTGGGIEYIGRIDQQVK
FT                   VRGYRIELSEIEVQLAQLSEVQDAAVTAVKDKGGNTAIAAYVTPESADIEALKSALKET
FT                   LPDYMIPAFWVTLNELPVTANGKVDRKALPEPDIEAGSGEYKAPTTDMEELLAGIWQDV
FT                   LGMSEVGVTDNFFSLGGDSIKGIQMASRLNQHGWKLEMKDLFQHPTIEELTQYVERAEG
FT                   KQADQGPVEGEVILTPIQRWFFEKNFTNKHHWNQSVMLHAKKGFDPERVEKTLQALIEH
FT                   HDALRMVYREGQEDVIQYNRGLEAASAQLEVIQIEGQAADYEDRIEREAERLQSSIDLQ
FT                   EGGLLKAGLFQAEDGDHLLLAIHHLVVDGVSWRILLEDFAAVYTQLEQGNEPVLPQKTH
FT                   SFAEYAERLQDFANSKAFLKEKEYWRQLEEQAVAAKLPKDRESGDQRMKHTKTIEFSLT
FT                   AEETEQLTTKVHEAYHTEMNDILLTAFGLAMKEWTGQDRVSVHLEGHGREEIIEDLTIS
FT                   RTVGWFTSMYPMVLDMKHADDLGYQLKQMKEDIRHVPNKGVGYGILRYLTAPEHKEDVA
FT                   FSIQPDVSFNYLGQFDEMSDAGLFTRSELPSGQSLSPETEKPNALDVVGYIENGKLTMS
FT                   LAYHSLEFHEKTVQTFSDSFKAHLLRIIEHCLSQDGTELTPSDLGDDDLTLDELDKLME
FT                   IF"
FT   gene            387744..398495
FT                   /gene="srfAB"
FT                   /locus_tag="BSU_03490"
FT                   /old_locus_tag="BSU03490"
FT   CDS_pept        387744..398495
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="srfAB"
FT                   /locus_tag="BSU_03490"
FT                   /old_locus_tag="BSU03490"
FT                   /product="surfactin synthetase"
FT                   /function="16.5: Explore"
FT                   /function="16.8: Protect"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 15066026, 16166527, 16553878,
FT                   17227471, 14762003, 26284661; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU03490"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12143"
FT                   /db_xref="GOA:Q04747"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR001242"
FT                   /db_xref="InterPro:IPR006162"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR010060"
FT                   /db_xref="InterPro:IPR010071"
FT                   /db_xref="InterPro:IPR020806"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="SubtiList:BG10169"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q04747"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:15066026, 16166527, 16553878, 17227471, 14762003,
FT                   26284661"
FT                   /protein_id="CAB12143.2"
FT                   /translation="MSKKSIQKVYALTPMQEGMLYHAMLDPHSSSYFTQLELGIHGAFD
FT                   LEIFEKSVNELIRSYDILRTVFVHQQLQKPRQVVLAERKTKVHYEDISHADENRQKEHI
FT                   ERYKQDVQRQGFNLAKDILFKVAVFRLAADQLYLVWSNHHIMMDGWSMGVLMKSLFQNY
FT                   EALRAGRTPANGQGKPYSDYIKWLGKQDNEEAESYWSERLAGFEQPSVLPGRLPVKKDE
FT                   YVNKEYSFTWDETLVARIQQTANLHQVTGPNLFQAVWGIVLSKYNFTDDVIFGTVVSGR
FT                   PSEINGIETMAGLFINTIPVRVKVERDAAFADIFTAVQQHAVEAERYDYVPLYEIQKRS
FT                   ALDGNLLNHLVAFENYPLDQELENGSMEDRLGFSIKVESAFEQTSFDFNLIVYPGKTWT
FT                   VKIKYNGAAFDSAFIERTAEHLTRMMEAAVDQPAAFVREYGLVGDEEQRQIVEVFNSTK
FT                   AELPEGMAVHQVFEEQAKRTPASTAVVYEGTKLTYRELNAAANRLARKLVEHGLQKGET
FT                   AAIMNDRSVETVVGMLAVLKAGAAYVPLDPALPGDRLRFMAEDSSVRMVLIGNSYTGQA
FT                   HQLQVPVLTLDIGFEESEAADNLNLPSAPSDLAYIMYTSGSTGKPKGVMIEHKSILRLV
FT                   KNAGYVPVTEEDRMAQTGAVSFDAGTFEVFGALLNGAALYPVKKETLLDAKQFAAFLRE
FT                   QSITTMWLTSPLFNQLAAKDAGMFGTLRHLIIGGDALVPHIVSKVKQASPSLSLWNGYG
FT                   PTENTTFSTSFLIDREYGGSIPIGKPIGNSTAYIMDEQQCLQPIGAPGELCVGGIGVAR
FT                   GYVNLPELTEKQFLEDPFRPGERIYRTGDLARWLPDGNIEFLGRIDNQVKVRGFRIELG
FT                   EIETKLNMAEHVTEAAVIIRKNKADENEICAYFTADREVAVSELRKTLSQSLPDYMVPA
FT                   HLIQMDSLPLTPNGKINKKELPAPQSEAVQPEYAAPKTESEKKLAEIWEGILGVKAGVT
FT                   DNFFMIGGHSLKAMMMTAKIQEHFHKEVPIKVLFEKPTIQELALYLEENESKEEQTFEP
FT                   IRQASYQQHYPVSPAQRRMYILNQLGQANTSYNVPAVLLLEGEVDKDRLENAIQQLINR
FT                   HEILRTSFDMIDGEVVQTVHKNISFQLEAAKGREEDAEEIIKAFVQPFELNRAPLVRSK
FT                   LVQLEEKRHLLLIDMHHIITDGSSTGILIGDLAKIYQGADLELPQIHYKDYAVWHKEQT
FT                   NYQKDEEYWLDVFKGELPILDLPADFERPAERSFAGERVMFGLDKQITAQIKSLMAETD
FT                   TTMYMFLLAAFNVLLSKYASQDDIIVGSPTAGRTHPDLQGVPGMFVNTVALRTAPAGDK
FT                   TFAQFLEEVKTASLQAFEHQSYPLEELIEKLPLTRDTSRSPLFSVMFNMQNMEIPSLRL
FT                   GDLKISSYSMLHHVAKFDLSLEAVEREEDIGLSFDYATALFKDETIRRWSRHFVNIIKA
FT                   AAANPNVRLSDVDLLSSAETAALLEERHMTQITEATFAALFEKQAQQTPDHSAVKAGGN
FT                   LLTYRELDEQANQLAHHLRAQGAGNEDIVAIVMDRSAEVMVSILGVMKAGAAFLPIDPD
FT                   TPEERIRYSLEDSGAKFAVVNERNMTAIGQYEGIIVSLDDGKWRNESKERPSSISGSRN
FT                   LAYVIYTSGTTGKPKGVQIEHRNLTNYVSWFSEEAGLTENDKTVLLSSYAFDLGYTSMF
FT                   PVLLGGGELHIVQKETYTAPDEIAHYIKEHGITYIKLTPSLFHTIVNTASFAKDANFES
FT                   LRLIVLGGEKIIPTDVIAFRKMYGHTEFINHYGPTEATIGAIAGRVDLYEPDAFAKRPT
FT                   IGRPIANAGALVLNEALKLVPPGASGQLYITGQGLARGYLNRPQLTAERFVENPYSPGS
FT                   LMYKTGDVVRRLSDGTLAFIGRADDQVKIRGYRIEPKEIETVMLSLSGIQEAVVLAVSE
FT                   GGLQELCAYYTSDQDIEKAELRYQLSLTLPSHMIPAFFVQVDAIPLTANGKTDRNALPK
FT                   PNAAQSGGKALAAPETALEESLCRIWQKTLGIEAIGIDDNFFDLGGHSLKGMMLIANIQ
FT                   AELEKSVPLKALFEQPTVRQLAAYMEASAVSGGHQVLKPADKQDMYPLSSAQKRMYVLN
FT                   QLDRQTISYNMPSVLLMEGELDISRLRDSLNQLVNRHESLRTSFMEANGEPVQRIIEKA
FT                   EVDLHVFEAKEDEADQKIKEFIRPFDLNDAPLIRAALLRIEAKKHLLLLDMHHIIADGV
FT                   SRGIFVKELALLYKGEQLPEPTLHYKDFAVWQNEAEQKERMKEHEAYWMSVLSGELPEL
FT                   DLPLDYARPPVQSFKGDTIRFRTGSETAKAVEKLLAETGTTLHMVLHAVFHVFLSKISG
FT                   QRDIVIGSVTAGRTNADVQDMPGMFVNTLALRMEAKEQQTFAELLELAKQTNLSALEHQ
FT                   EYPFEDLVNQLDLPRDMSRNPLFNVMVTTENPDKEQLTLQNLSISPYEAHQGTSKFDLT
FT                   LGGFTDENGIGLQLEYATDLFAKETAEKWSEYVLRLLKAVADNPNQPLSSLLLVTETEK
FT                   QALLEAWKGKALPVPTDKTVHQLFEETVQRHKDRPAVTYNGQSWTYGELNAKANRLARI
FT                   LMDCGISPDDRVGVLTKPSLEMSAAVLGVLKAGAAFVPIDPDYPDQRIEYILQDSGAKL
FT                   LLKQEGISVPDSYTGDVILLDGSRTILSLPLDENDEGNPETAVTAENLAYMIYTSGTTG
FT                   QPKGVMVEHHALVNLCFWHHDAFSMTAEDRSAKYAGFGFDASIWEMFPTWTIGAELHVI
FT                   DEAIRLDIVRLNDYFETNGVTITFLPTQLAEQFMELENTSLRVLLTGGDKLKRAVKKPY
FT                   TLVNNYGPTENTVVATSAEIHPEEGSLSIGRAIANTRVYILGEGNQVQPEGVAGELCVA
FT                   GRGLARGYLNREDETAKRFVADPFVPGERMYRTGDLVKWVNGGIEYIGRIDQQVKVRGY
FT                   RIELSEIEVQLAQLSEVQDAAVTAVKDKGGNTAIAAYVTPETADIEALKSTLKETLPDY
FT                   MIPAFWVTLNELPVTANGKVDRKALPEPDIEAGSGEYKAPTTDMEELLAGIWQDVLGMS
FT                   EVGVTDNFFSLGGDSIKGIQMASRLNQHGWKLEMKDLFQHPTIEELTQYVERAEGKQAD
FT                   QGPVEGEVILTPIQRWFFEKNFTNKHHWNQSVMLHAKKGFDPERVEKTLQALIEHHDAL
FT                   RMVYREENGDIVQVYKPIGESKVSFEIVDLYGSDEEMLRSQIKLLANKLQSSLDLRNGP
FT                   LLKAEQYRTEAGDHLLIAVHHLVVDGVSWRILLEDFASGYMQAEKEESLVFPQKTNSFK
FT                   DWAEELAAFSQSAHLLQQAEYWSQIAAEQVSPLPKDCETEQRIVKDTSSVLCELTAEDT
FT                   KHLLTDVHQPYGTEINDILLSALGLTMKEWTKGAKIGINLEGHGREDIIPNVNISRTVG
FT                   WFTAQYPVVLDISDADASAVIKTVKENLRRIPDKGVGYGILRYFTETAETKGFTPEISF
FT                   NYLGQFDSEVKTDFFEPSAFDMGRQVSGESEALYALSFSGMIRNGRFVLSCSYNEKEFE
FT                   RATVEEQMERFKENLLMLIRHCTEKEDKEFTPSDFSAEDLEMDEMGDIFDMLEENLK"
FT   gene            390880..391020
FT                   /gene="comS"
FT                   /locus_tag="BSU_03500"
FT                   /old_locus_tag="BSU03500"
FT   CDS_pept        390880..391020
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="comS"
FT                   /locus_tag="BSU_03500"
FT                   /old_locus_tag="BSU03500"
FT                   /product="regulator of genetic competence"
FT                   /function="16.3: Control"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 10361283, 16554821, 8752331,
FT                   9696775, 22720735; Product type r: regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BSU03500"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12144"
FT                   /db_xref="GOA:P80355"
FT                   /db_xref="InterPro:IPR035139"
FT                   /db_xref="SubtiList:BG11045"
FT                   /db_xref="UniProtKB/Swiss-Prot:P80355"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:10361283, 16554821, 8752331, 9696775, 22720735"
FT                   /protein_id="CAB12144.1"
FT                   /translation="MNRSGKHLISSIILYPRPSGECISSISLDKQTQATTSPLYFCWRE
FT                   K"
FT   gene            398532..402359
FT                   /gene="srfAC"
FT                   /locus_tag="BSU_03510"
FT                   /old_locus_tag="BSU03510"
FT   CDS_pept        398532..402359
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="srfAC"
FT                   /locus_tag="BSU_03510"
FT                   /old_locus_tag="BSU03510"
FT                   /product="surfactin synthetase"
FT                   /function="16.5: Explore"
FT                   /function="16.8: Protect"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 15066026, 16166527, 16553878,
FT                   17227471, 14762003, 22720735, 26284661; Product type e:
FT                   enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU03510"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12145"
FT                   /db_xref="GOA:Q08787"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR001031"
FT                   /db_xref="InterPro:IPR001242"
FT                   /db_xref="InterPro:IPR006162"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR010071"
FT                   /db_xref="InterPro:IPR020806"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="PDB:1JMK"
FT                   /db_xref="PDB:2VSQ"
FT                   /db_xref="SubtiList:BG10170"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q08787"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:15066026, 16166527, 16553878, 17227471, 14762003,
FT                   22720735, 26284661"
FT                   /protein_id="CAB12145.2"
FT                   /translation="MSQFSKDQVQDMYYLSPMQEGMLFHAILNPGQSFYLEQITMKVKG
FT                   SLNIKCLEESMNVIMDRYDVFRTVFIHEKVKRPVQVVLKKRQFHIEEIDLTHLTGSEQT
FT                   AKINEYKEQDKIRGFDLTRDIPMRAAIFKKAEESFEWVWSYHHIILDGWCFGIVVQDLF
FT                   KVYNALREQKPYSLPPVKPYKDYIKWLEKQDKQASLRYWREYLEGFEGQTTFAEQRKKQ
FT                   KDGYEPKELLFSLSEAETKAFTELAKSQHTTLSTALQAVWSVLISRYQQSGDLAFGTVV
FT                   SGRPAEIKGVEHMVGLFINVVPRRVKLSEGITFNGLLKRLQEQSLQSEPHQYVPLYDIQ
FT                   SQADQPKLIDHIIVFENYPLQDAKNEESSENGFDMVDVHVFEKSNYDLNLMASPGDEML
FT                   IKLAYNENVFDEAFILRLKSQLLTAIQQLIQNPDQPVSTINLVDDREREFLLTGLNPPA
FT                   QAHETKPLTYWFKEAVNANPDAPALTYSGQTLSYRELDEEANRIARRLQKHGAGKGSVV
FT                   ALYTKRSLELVIGILGVLKAGAAYLPVDPKLPEDRISYMLADSAAACLLTHQEMKEQAA
FT                   ELPYTGTTLFIDDQTRFEEQASDPATAIDPNDPAYIMYTSGTTGKPKGNITTHANIQGL
FT                   VKHVDYMAFSDQDTFLSVSNYAFDAFTFDFYASMLNAARLIIADEHTLLDTERLTDLIL
FT                   QENVNVMFATTALFNLLTDAGEDWMKGLRCILFGGERASVPHVRKALRIMGPGKLINCY
FT                   GPTEGTVFATAHVVHDLPDSISSLPIGKPISNASVYILNEQSQLQPFGAVGELCISGMG
FT                   VSKGYVNRADLTKEKFIENPFKPGETLYRTGDLARWLPDGTIEYAGRIDDQVKIRGHRI
FT                   ELEEIEKQLQEYPGVKDAVVVADRHESGDASINAYLVNRTQLSAEDVKAHLKKQLPAYM
FT                   VPQTFTFLDELPLTTNGKVNKRLLPKPDQDQLAEEWIGPRNEMEETIAQIWSEVLGRKQ
FT                   IGIHDDFFALGGHSLKAMTAASRIKKELGIDLPVKLLFEAPTIAGISAYLKNGGSDGLQ
FT                   DVTIMNQDQEQIIFAFPPVLGYGLMYQNLSSRLPSYKLCAFDFIEEEDRLDRYADLIQK
FT                   LQPEGPLTLFGYSAGCSLAFEAAKKLEEQGRIVQRIIMVDSYKKQGVSDLDGRTVESDV
FT                   EALMNVNRDNEALNSEAVKHGLKQKTHAFYSYYVNLISTGQVKADIDLLTSGADFDMPE
FT                   WLASWEEATTGVYRVKRGFGTHAEMLQGETLDRNAEILLEFLNTQTVTVS"
FT   gene            402388..403116
FT                   /gene="srfAD"
FT                   /locus_tag="BSU_03520"
FT                   /old_locus_tag="BSU03520"
FT   CDS_pept        402388..403116
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="srfAD"
FT                   /locus_tag="BSU_03520"
FT                   /old_locus_tag="BSU03520"
FT                   /product="surfactin synthetase"
FT                   /function="16.5: Explore"
FT                   /function="16.8: Protect"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 16166527, 16553878, 17227471,
FT                   14762003, 22720735, 26284661; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU03520"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12146"
FT                   /db_xref="GOA:Q08788"
FT                   /db_xref="InterPro:IPR001031"
FT                   /db_xref="InterPro:IPR012223"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="PDB:2K2Q"
FT                   /db_xref="PDB:2RON"
FT                   /db_xref="SubtiList:BG10171"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q08788"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:16166527, 16553878, 17227471, 14762003, 22720735,
FT                   26284661"
FT                   /protein_id="CAB12146.1"
FT                   /translation="MSQLFKSFDASEKTQLICFPFAGGYSASFRPLHAFLQGECEMLAA
FT                   EPPGHGTNQTSAIEDLEELTDLYKQELNLRPDRPFVLFGHSMGGMITFRLAQKLEREGI
FT                   FPQAVIISAIQPPHIQRKKVSHLPDDQFLDHIIQLGGMPAELVENKEVMSFFLPSFRSD
FT                   YRALEQFELYDLAQIQSPVHVFNGLDDKKCIRDAEGWKKWAKDITFHQFDGGHMFLLSQ
FT                   TEEVAERIFAILNQHPIIQP"
FT   gene            403217..404443
FT                   /gene="srfT"
FT                   /locus_tag="BSU_03530"
FT                   /old_locus_tag="BSU03530"
FT   CDS_pept        403217..404443
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="srfT"
FT                   /locus_tag="BSU_03530"
FT                   /old_locus_tag="BSU03530"
FT                   /product="surfactin exporter"
FT                   /function="16.1: Circulate"
FT                   /note="Evidence 1b: Function from experimental evidences in
FT                   the studied species; PubMedId: 15849754, 16850406,
FT                   25366377; Product type t: transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BSU03530"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12147"
FT                   /db_xref="GOA:Q08791"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="SubtiList:BG10172"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q08791"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB12147.2"
FT                   /translation="MRTSPRMKWFVLLFTFVFAIGMNSFRNSFQFFMLPMADAFHADRS
FT                   LISVSVSIFMITTGIVQFFVGFFIDRFSVRKIMALGAVCISASFLVLPYSPNVHVFSAI
FT                   YGVLGGIGYSCAVGVTTQYFISCWFDTHKGLALAILTNANSAGLLLLSPIWAAAPYHAG
FT                   WQSTYTILGIVMAAVLLPLLVFGMKHPPHAQAETVKKSYDWRGFWNVMKQSRLIHILYF
FT                   GVFTCGFTMGIIDAHLVPILKDAHVSHVNGMMAAFGAFIIIGGLLAGWLSDLLGSRSVM
FT                   LSILFFIRLLSLICLLIPILGIHHSDLWYFGFILLFGLSYTGVIPLTAASISESYQTGL
FT                   IGSLLGINFFIHQVAGALSVYAGGLFFDMTHGYLLIVAVCIVFVGLSAVIELVPFLDKQ
FT                   KAKETHHSI"
FT   gene            complement(404458..405015)
FT                   /gene="ycxB"
FT                   /locus_tag="BSU_03540"
FT                   /old_locus_tag="BSU03540"
FT   CDS_pept        complement(404458..405015)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycxB"
FT                   /locus_tag="BSU_03540"
FT                   /old_locus_tag="BSU03540"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5: Unknown function; PubMedId : 21965396"
FT                   /db_xref="EnsemblGenomes-Gn:BSU03540"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12148"
FT                   /db_xref="GOA:Q08793"
FT                   /db_xref="InterPro:IPR025588"
FT                   /db_xref="SubtiList:BG10173"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q08793"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB12148.1"
FT                   /translation="MIQYASESINLPGEITFKDVREIFFYQIAKISCFYFLLFCAIFAA
FT                   VNFINGWPRIVYGSDALNLFMNSMLIIVMSVLFTLLLLLLLYVKFSRAYKKNERMKSKR
FT                   TYTLNQEGIRICSKKYDLIFNWDEITAVFEYKNIFRVNTSSGQYIAIPKHFFHSEEEMN
FT                   RFKEIILKNTETKKLKFKKDQH"
FT   gene            complement(405069..406007)
FT                   /gene="ycxC"
FT                   /locus_tag="BSU_03550"
FT                   /old_locus_tag="BSU03550"
FT   CDS_pept        complement(405069..406007)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycxC"
FT                   /locus_tag="BSU_03550"
FT                   /old_locus_tag="BSU03550"
FT                   /product="putative permease"
FT                   /function="16.1: Circulate"
FT                   /note="Evidence 3: Putative function from multiple
FT                   computational evidences; PubMedId: 15849754, 16850406;
FT                   Product type t: transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BSU03550"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12149"
FT                   /db_xref="GOA:Q08794"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="SubtiList:BG10174"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q08794"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB12149.2"
FT                   /translation="MVKHQQTPAYIAAILYSFIIGLSFLFVKIALQTAEPFDILAHRFT
FT                   IAFAAATVPILFGWVKLSIRVKDVIDILPLALLYPALFFSFQAFGLVYSSSSEAGIIQA
FT                   AIPIFTMVFAAYVLKERPTWTQKGFTVLSVAGVMFIFVMKGVDVESASLKGSLLILLSA
FT                   LSSAMYNTAARKMTQRFKLTELTYIMSAIGFVVFNAIALVRHGAAGTVGTYFLPFREPG
FT                   FVLAIVYLGVLSSLVTSFLSNYTLSRIEAFKMSAFNHVSTIVTMIAGFVILNESLAWYH
FT                   LAGAVCIMIGVVGSNINLEKKTKRPGMPAKK"
FT   gene            406131..407465
FT                   /gene="ycxD"
FT                   /locus_tag="BSU_03560"
FT                   /old_locus_tag="BSU03560"
FT   CDS_pept        406131..407465
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycxD"
FT                   /locus_tag="BSU_03560"
FT                   /old_locus_tag="BSU03560"
FT                   /product="putative PLP-dependent transcriptional regulator"
FT                   /function="16.3: Control"
FT                   /note="Evidence 3: Putative function from multiple
FT                   computational evidences; PubMedId: 15223311, 26585522;
FT                   Product type r: regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BSU03560"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12150"
FT                   /db_xref="GOA:Q08792"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="SubtiList:BG10175"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q08792"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB12150.1"
FT                   /translation="MEKYMSLLTRIEEMMQSTSYQEGDRLPSIRQLSARYQVSKSTVIR
FT                   ALQELEKRHLIYSVPKSGYYIVKKSGKSKSGQPGPIDFATSAPDPDVFPYLDFQHCINK
FT                   AIDTYKNDLFIYGTPKGLPSLIRVLRKLLATQQVFADERHIFITSGVQQALSLLCAMPF
FT                   PNGKEKIAIEQPGYHLMVEQLETLGIPAIGVKRTEEGLDIAKVERLFQTESIKFFYTMP
FT                   RFHNPLGCSLSERDKQELVRLAEAYDVYLVEDDYLGDLEENKKADPLYAYDLSSHVIYL
FT                   KSFSKMMFPGLRVGAAVLPEALTDTFYAYKKLNDIDCSMISQAALEIYLKSGMYGRHKE
FT                   KIRDSYKERSLRLHQAIRTHRQLGSGRFTFSSGQAPCMHTHLVLPQDLPASRVIHRLEK
FT                   QGVLLEAIDRHYLSDYPKENLLKINISNVKTEDIERGVKLLMSHL"
FT   gene            complement(407460..407627)
FT                   /pseudo
FT                   /gene="sfpAc"
FT                   /locus_tag="BSU_03569"
FT                   /old_locus_tag="BSU03569"
FT   CDS_pept        complement(407460..407627)
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sfpAc"
FT                   /locus_tag="BSU_03569"
FT                   /old_locus_tag="BSU03569"
FT                   /product="C-terminal part of 4'-phosphopantetheinyl
FT                   transferase (Surfactin synthetase-activating enzyme)"
FT                   /function="16.5: Explore"
FT                   /EC_number="2.7.8.-"
FT                   /note="Evidence 1b: Function from experimental evidences in
FT                   the studied species; PubMedId: 10568751, 17376553, 2848009,
FT                   9384377, 14762003, 16707694, 19061923, 20971906, 25288929,
FT                   26268540; Product type e: enzyme"
FT                   /db_xref="PSEUDO:CAX52545.1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT   gene            complement(407638..408135)
FT                   /pseudo
FT                   /gene="sfpAn"
FT                   /locus_tag="BSU_03570"
FT                   /old_locus_tag="BSU03570"
FT   CDS_pept        complement(407638..408135)
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sfpAn"
FT                   /locus_tag="BSU_03570"
FT                   /old_locus_tag="BSU03570"
FT                   /product="N-terminal part of 4'-phosphopantetheinyl
FT                   transferase (surfactin synthetase-activating enzyme)"
FT                   /function="16.5: Explore"
FT                   /EC_number="2.7.8.-"
FT                   /note="Evidence 1b: Function from experimental evidences in
FT                   the studied species; PubMedId: 10568751, 17376553, 2848009,
FT                   9384377, 14762003, 16707694, 19061923, 20971906, 25288929,
FT                   26268540; Product type e: enzyme"
FT                   /db_xref="PSEUDO:CAB12151.2"
FT                   /db_xref="GOA:P39135"
FT                   /db_xref="InterPro:IPR004568"
FT                   /db_xref="InterPro:IPR008278"
FT                   /db_xref="InterPro:IPR037143"
FT                   /db_xref="PDB:1QR0"
FT                   /db_xref="PDB:2GE0"
FT                   /db_xref="PDB:2GE1"
FT                   /db_xref="PDB:4MRT"
FT                   /db_xref="SubtiList:BG10176"
FT                   /db_xref="UniProtKB/Swiss-Prot:P39135"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT   gene            complement(408240..408887)
FT                   /gene="yczE"
FT                   /locus_tag="BSU_03580"
FT                   /old_locus_tag="BSU03580"
FT   CDS_pept        complement(408240..408887)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yczE"
FT                   /locus_tag="BSU_03580"
FT                   /old_locus_tag="BSU03580"
FT                   /product="integral inner membrane protein regulating
FT                   antibiotic production"
FT                   /function="15.11: Biosynthesis of natural products"
FT                   /note="Evidence 2a: Function from experimental evidences in
FT                   other organisms; PubMedId: 15849754, 16850406, 17827323,
FT                   14762003, 16707694, 17827323, 25288929; Product type m:
FT                   membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:BSU03580"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12152"
FT                   /db_xref="GOA:O34927"
FT                   /db_xref="InterPro:IPR038750"
FT                   /db_xref="SubtiList:BG12779"
FT                   /db_xref="UniProtKB/Swiss-Prot:O34927"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB12152.2"
FT                   /translation="MKQELVLRWTFYFAGLIILAFGVSLTIEGKALGISPWDAFHYSLF
FT                   QHFGLTVGQWSIIIGALIVGFTSLFTRAWPKIGALLNMVLIGVFIDFFNFILPALSTYT
FT                   GSIIVFSLGVVLIGYGVGVYVSAGLGAGPRDSLMMLITEKTGWNVQWVRNGMELTILFA
FT                   AWGMGGPIGFGTILTAILTGLILRFSLPQSIQLLNYAVARRTAAVKASPPVH"
FT   gene            complement(409208..409951)
FT                   /gene="tcyC"
FT                   /locus_tag="BSU_03590"
FT                   /old_locus_tag="BSU03590"
FT   CDS_pept        complement(409208..409951)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tcyC"
FT                   /locus_tag="BSU_03590"
FT                   /old_locus_tag="BSU03590"
FT                   /product="cystine ABC transporter (ATP-binding protein)"
FT                   /function="16.1: Circulate"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 15262924, 16513748, 22212096;
FT                   Product type t: transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BSU03590"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12153"
FT                   /db_xref="GOA:P39456"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030679"
FT                   /db_xref="SubtiList:BG11185"
FT                   /db_xref="UniProtKB/Swiss-Prot:P39456"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:15262924, 16513748, 22212096"
FT                   /protein_id="CAB12153.2"
FT                   /translation="MLTVKGLNKSFGENEILKKIDMKIEKGKVIAILGPSGSGKTTLLR
FT                   CLNALEIPNRGELAFDDFSIDFSKKVKQADILKLRRKSGMVFQAYHLFPHRTALENVME
FT                   GPVQVQKRNKEEVRKEAIQLLDKVGLKDKMDLYPFQLSGGQQQRVGIARALAIQPELML
FT                   FDEPTSALDPELVGEVLKVIKDLANEGWTMVVVTHEIKFAQEVADEVIFIDGGVIVEQG
FT                   PPEQIFSAPKEERTQRFLNRILNPL"
FT   gene            complement(409965..410669)
FT                   /gene="tcyB"
FT                   /locus_tag="BSU_03600"
FT                   /old_locus_tag="BSU03600"
FT   CDS_pept        complement(409965..410669)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tcyB"
FT                   /locus_tag="BSU_03600"
FT                   /old_locus_tag="BSU03600"
FT                   /product="cystine ABC transporter (permease)"
FT                   /function="16.1: Circulate"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 15262924, 15849754, 16850406,
FT                   22212096; Product type t: transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BSU03600"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12154"
FT                   /db_xref="GOA:P42200"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="SubtiList:BG11186"
FT                   /db_xref="UniProtKB/Swiss-Prot:P42200"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:15262924, 15849754, 16850406, 22212096"
FT                   /protein_id="CAB12154.1"
FT                   /translation="MFLNNLPALTLGTAIPWDLVQQSFWPILSGGIYYTIPLTILSFIF
FT                   GMILALITALARMSKVRPLRWVFSVYVSAIRGTPLLVQLFIIFYLFPAFNVTLDPFPSA
FT                   VIAFSLNVGAYASEIIRASILSVPKGQWEAGYTIGMTHQKTLFRVILPQAFRVSIPPLS
FT                   NTFISLIKDTSLASQILVAELFRKAQEIGARNLDQILVIYIEAAFIYWIICFLLSLVQH
FT                   VIERRLDRYVAK"
FT   gene            complement(410656..411462)
FT                   /gene="tcyA"
FT                   /locus_tag="BSU_03610"
FT                   /old_locus_tag="BSU03610"
FT   CDS_pept        complement(410656..411462)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tcyA"
FT                   /locus_tag="BSU_03610"
FT                   /old_locus_tag="BSU03610"
FT                   /product="cystine ABC transporter (substrate-binding
FT                   lipoprotein)"
FT                   /function="16.1: Circulate"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 15262924, 22212096; Product
FT                   type t: transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BSU03610"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12155"
FT                   /db_xref="GOA:P42199"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR018313"
FT                   /db_xref="SubtiList:BG11187"
FT                   /db_xref="UniProtKB/Swiss-Prot:P42199"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:15262924, 22212096"
FT                   /protein_id="CAB12155.2"
FT                   /translation="MKKALLALFMVVSIAALAACGAGNDNQSKDNAKDGDLWASIKKKG
FT                   VLTVGTEGTYEPFTYHDKDTDKLTGYDVEVITEVAKRLGLKVDFKETQWDSMFAGLNSK
FT                   RFDVVANQVGKTDREDKYDFSDKYTTSRAVVVTKKDNNDIKSEADVKGKTSAQSLTSNY
FT                   NKLATNAGAKVEGVEGMAQALQMIQQGRVDMTYNDKLAVLNYLKTSGNKNVKIAFETGE
FT                   PQSTYFTFRKGSGEVVDQVNKALKEMKEDGTLSKISKKWFGEDVSK"
FT   gene            complement(411578..412450)
FT                   /gene="bsdA"
FT                   /locus_tag="BSU_03620"
FT                   /old_locus_tag="BSU03620"
FT   CDS_pept        complement(411578..412450)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bsdA"
FT                   /locus_tag="BSU_03620"
FT                   /old_locus_tag="BSU03620"
FT                   /product="HTH-type transcriptional regulator BsdA (LysR
FT                   family)"
FT                   /function="16.3: Control"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 17295427; Product type r:
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BSU03620"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12156"
FT                   /db_xref="GOA:P94403"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="SubtiList:BG12022"
FT                   /db_xref="UniProtKB/Swiss-Prot:P94403"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:17295427"
FT                   /protein_id="CAB12156.1"
FT                   /translation="MDIRQLRYFITIAQEQKITSAAKKLHMAQPPLSRQLKQLEDELGV
FT                   VLFDRNKKKQMTLTYEGAVFLKRAKEILHRFEDAVIEVQELKEEVAGTLAVGSTIYCAA
FT                   LMLEKVTQIKERYPHLTFNIWENEPATLLELLESRQIDAAVTTTLIKSDTVQFKQLDDI
FT                   PCVLVLSDEAGYPCGDTIKMVDIPSFPLILLRPVNGKGVYNQVMNEFHRLNLEPRIVCE
FT                   CHDSATLLSLVSSGFGASILPVTMIPVHMRNHVHTVHIENNPFIMTPAVMWRTDSYLPK
FT                   PAQQFLDLF"
FT   gene            412540..413154
FT                   /gene="ubiX"
FT                   /locus_tag="BSU_03630"
FT                   /old_locus_tag="BSU03630"
FT   CDS_pept        412540..413154
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ubiX"
FT                   /locus_tag="BSU_03630"
FT                   /old_locus_tag="BSU03630"
FT                   /product="phenolic acid decarboxylase-flavin
FT                   prenyltransferase subunit"
FT                   /function="3.2: Degradation"
FT                   /EC_number="4.1.1.61"
FT                   /EC_number="4.1.1.-"
FT                   /note="Evidence 1b: Function from experimental evidences in
FT                   the studied species; PubMedId: 10919793, 15979273,
FT                   17295427, 18388975, 26083743, 26658822, 26337367; Product
FT                   type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU03630"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12157"
FT                   /db_xref="GOA:P94404"
FT                   /db_xref="InterPro:IPR003382"
FT                   /db_xref="InterPro:IPR004507"
FT                   /db_xref="InterPro:IPR032901"
FT                   /db_xref="InterPro:IPR036551"
FT                   /db_xref="SubtiList:BG12023"
FT                   /db_xref="UniProtKB/Swiss-Prot:P94404"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB12157.1"
FT                   /translation="MKAEFKRKGGGKVKLVVGMTGATGAIFGVRLLQWLKAAGVETHLV
FT                   VSPWANVTIKHETGYTLQEVEQLATYTYSHKDQAAAISSGSFDTDGMIVAPCSMKSLAS
FT                   IRTGMADNLLTRAADVMLKERKKLVLLTRETPLNQIHLENMLALTKMGTIILPPMPAFY
FT                   NRPRSLEEMVDHIVFRTLDQFGIRLPEAKRWNGIEKQKGGA"
FT   gene            413157..414578
FT                   /gene="bsdC"
FT                   /locus_tag="BSU_03640"
FT                   /old_locus_tag="BSU03640"
FT   CDS_pept        413157..414578
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bsdC"
FT                   /locus_tag="BSU_03640"
FT                   /old_locus_tag="BSU03640"
FT                   /product="promiscuous phenolic acid decarboxylase subunit;
FT                   1,4-dihydroxy-2-naphtoate-heptaprenyl diphosphate
FT                   decarboxylase"
FT                   /function="3.2: Degradation"
FT                   /EC_number="4.1.1.61"
FT                   /EC_number="4.1.1.-"
FT                   /note="Evidence 1b: Function from experimental evidences in
FT                   the studied species; PubMedId: 11029449, 15979273,
FT                   17295427, 18388975, 26658822, 26337367; Product type e :
FT                   enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU03640"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12158"
FT                   /db_xref="GOA:P94405"
FT                   /db_xref="InterPro:IPR002830"
FT                   /db_xref="InterPro:IPR032902"
FT                   /db_xref="SubtiList:BG12024"
FT                   /db_xref="UniProtKB/Swiss-Prot:P94405"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB12158.1"
FT                   /translation="MAYQDFREFLAALEKEGQLLTVNEEVKPEPDLGASARAASNLGDK
FT                   SPALLFNNIYGYHNARIAMNVIGSWPNHAMMLGMPKDTPVKEQFFEFAKRYDQFPMPVK
FT                   REETAPFHENEITEDINLFDILPLFRINQGDGGYYLDKACVISRDLEDPDNFGKQNVGI
FT                   YRMQVKGKDRLGIQPVPQHDIAIHLRQAEERGINLPVTIALGCEPVITTAASTPLLYDQ
FT                   SEYEMAGAIQGEPYRIVKSKLSDLDVPWGAEVVLEGEIIAGEREYEGPFGEFTGHYSGG
FT                   RSMPIIKIKRVYHRNNPIFEHLYLGMPWTECDYMIGINTCVPLYQQLKEAYPNEIVAVN
FT                   AMYTHGLIAIVSTKTRYGGFAKAVGMRALTTPHGLGYCKMVIVVDEDVDPFNLPQVMWA
FT                   LSTKMHPKHDAVIIPDLSVLPLDPGSNPSGITHKMILDATTPVAPETRGHYSQPLDSPL
FT                   TTKEWEQKLMDLMNK"
FT   gene            414595..414822
FT                   /gene="bsdD"
FT                   /locus_tag="BSU_03651"
FT                   /old_locus_tag="BSU03651"
FT   CDS_pept        414595..414822
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bsdD"
FT                   /locus_tag="BSU_03651"
FT                   /old_locus_tag="BSU03651"
FT                   /product="phenolic acid decarboxylase subunit"
FT                   /function="3.2: Degradation"
FT                   /EC_number="4.1.1.61"
FT                   /EC_number="4.1.1.91"
FT                   /EC_number="4.1.1.-"
FT                   /note="Evidence 1b: Function from experimental evidences in
FT                   the studied species; PubMedId: 15979273, 17295427,
FT                   18388975, 26658822; Product type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU03651"
FT                   /db_xref="EnsemblGenomes-Tr:CAX52546"
FT                   /db_xref="GOA:C0H3U9"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0H3U9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX52546.1"
FT                   /translation="MHTCPRCDSKKGEVMSKSPVEGAWEVYQCQTCFFTWRSCEPESIT
FT                   NPEKYNPAFKIDPKETETAIEVPAVPERKA"
FT   gene            414819..415283
FT                   /gene="yclD"
FT                   /locus_tag="BSU_03652"
FT                   /old_locus_tag="BSU03652"
FT   CDS_pept        414819..415283
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yclD"
FT                   /locus_tag="BSU_03652"
FT                   /old_locus_tag="BSU03652"
FT                   /product="putative FMN-binding enzyme subunit"
FT                   /function="16.11: Scavenge (Catabolism)"
FT                   /note="Evidence 3: Putative function from multiple
FT                   computational evidences; PubMedId: 15979273, 18388975;
FT                   Product type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU03652"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12159"
FT                   /db_xref="GOA:C0SPB5"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="SubtiList:BG12025"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0SPB5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB12159.2"
FT                   /translation="MIRVNCMSDRLFELLDGSCLNEKQHEAFVLQTVSEDGWPHAAMIS
FT                   AGEIIALSRTDIRIALWKNTMTSANILRTGKAQFTAWWKGAAYYVKLECAPLPPLKDAE
FT                   YERDRFSCRIVSVKEDVAKYADLTSGVRIQLHSPEEVLSRWKKTLEDLKR"
FT   gene            415350..416195
FT                   /gene="yclE"
FT                   /locus_tag="BSU_03660"
FT                   /old_locus_tag="BSU03660"
FT   CDS_pept        415350..416195
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yclE"
FT                   /locus_tag="BSU_03660"
FT                   /old_locus_tag="BSU03660"
FT                   /product="putative hydrolase"
FT                   /function="16.11: Scavenge (Catabolism)"
FT                   /function="16.6: Maintain"
FT                   /note="Evidence 3: Putative function from multiple
FT                   computational evidences; Product type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU03660"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12160"
FT                   /db_xref="GOA:P94407"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="SubtiList:BG12026"
FT                   /db_xref="UniProtKB/Swiss-Prot:P94407"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB12160.2"
FT                   /translation="MERAGICHSDGFDLAYRIEGEGAPILVIGSAVYYPRLFSSDIKQK
FT                   YQWVFVDHRGFAKPKRELRAEDSRLDAVLADIERMRTFLQLEDVTILGHSGHAFMALEY
FT                   ARTYPKQVRKVALFNTAPDNSEERQRKSESFFMETASLERKKRFEKDIENLPQDIDKDP
FT                   ERRFVHMCIRAEAKSFYQERPHAAALWDGVFTNMPIIDELWGNTFARIDLLQRLADVRM
FT                   PVYIGLGRYDYLVAPVSLWDAVDGLYPHVDKVIFEKSGHQPMLEEPEAFDQSFRKWLDQ
FT                   "
FT   gene            complement(416235..417713)
FT                   /gene="dtpT"
FT                   /locus_tag="BSU_03670"
FT                   /old_locus_tag="BSU03670"
FT   CDS_pept        complement(416235..417713)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dtpT"
FT                   /locus_tag="BSU_03670"
FT                   /old_locus_tag="BSU03670"
FT                   /product="di-tripeptide-proton ABC symporter"
FT                   /function="16.1: Circulate"
FT                   /note="Evidence 2a: Function from experimental evidences in
FT                   other organisms; PubMedId: 8458848, 11717292, 15849754,
FT                   16204487, 16850406, 17496096, 23144141, 25966844; Product
FT                   type t: transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BSU03670"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12175"
FT                   /db_xref="GOA:P94408"
FT                   /db_xref="InterPro:IPR000109"
FT                   /db_xref="InterPro:IPR005279"
FT                   /db_xref="InterPro:IPR018456"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="SubtiList:BG12027"
FT                   /db_xref="UniProtKB/Swiss-Prot:P94408"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB12175.2"
FT                   /translation="MASIDNESIIKSVPQKGFFGHPRGLFTLFFTEFWERFSYYGMRAI
FT                   LLYYLYTETVNGGLGFDKGTAVAIMSIYGSLVYMSTIIGGWLADRVFGTANTVFYGGIF
FT                   IMFGHIALAYPGSSIAFYISMVLIIVGTGLLKPNVSSVVGDLYTKEDPRRDSGFSIFYM
FT                   GINLGGLLAPLIVGTLGQKYNYHLGFGAAAVGMLLGLIVFALTRKKNLGLAGSNVPNPL
FT                   SKKSAIGTGIGVIIVAIAVIISVQTGVLTIKRFIDLVSILGILIPVIYFIIMFTSKKAD
FT                   KTEKSRLAAYVPLFIGAVMFWAIQEQGATILAVYADERIRLSLGGFELQSSWFQSLNPL
FT                   FVVIFAPIFAWLWMKLGKRQPSTPVKFSIGIILAGLSFIIMVFPAMQGKEALVSPLWLV
FT                   LSFLLVVLGELCLSPVGLSVTTKLAPAAFSAQTMSMWFLTNAAAQAINAQVAGLFDKIP
FT                   ETMYFGTIGLISIVLGGILLLLSPVIKRAMKGVL"
FT   gene            417993..419747
FT                   /gene="yclG"
FT                   /locus_tag="BSU_03680"
FT                   /old_locus_tag="BSU03680"
FT   CDS_pept        417993..419747
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yclG"
FT                   /locus_tag="BSU_03680"
FT                   /old_locus_tag="BSU03680"
FT                   /product="putative uronase"
FT                   /function="16.11: Scavenge (Catabolism)"
FT                   /note="Evidence 3: Putative function from multiple
FT                   computational evidences; Product type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU03680"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12176"
FT                   /db_xref="InterPro:IPR006626"
FT                   /db_xref="InterPro:IPR006633"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012334"
FT                   /db_xref="InterPro:IPR024535"
FT                   /db_xref="InterPro:IPR039448"
FT                   /db_xref="SubtiList:BG12028"
FT                   /db_xref="UniProtKB/Swiss-Prot:P94409"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB12176.1"
FT                   /translation="MAEFILNAADFGVPRDGKTDSTERINQCLSTAVSKGYHTVWFPKG
FT                   TYLIDATLGGDLNQRFRNAGIIVPGNLEIMMDPECIMKVIPNSSWGYSAFYVGKQENIT
FT                   ISGGQIIGERDEHTYASAGIRSTHEWGFGICIEGCSNVVIDDVKISDFTGDGIIVSPRG
FT                   LKTNQDYRTSEQIIIRRCEVRRSRRNNISITGCDMVTVEECLIEDAGTGNGTAPKFGID
FT                   IEGYGEGDVDYEEPINVSIRNNHFVGNVSSSVTNFNGYGILIEGNHSDNTISYGYGTQT
FT                   VIKGNILRRPEDAAAAPRVGITGLGVSQGKETSDAVIAGNLITGFSTGIDVRGKSVLVT
FT                   NNKISNFENTGILVYQSSDVKVDGNQIQNGLSETRRSIGLRAVLSDDIAFLNNCLIQVV
FT                   DGVNVSGGNMIIKDNLLRKFSRGIWIAQGNAVIEGNTLNPDAFEAVPESYSVSVTNNAG
FT                   AIIKNNTFKEFKNYPIYCSTSAKTSIIGNHLERSPLLVTIYISAGVHEIFDNTISVNRT
FT                   AGNPIVIYLNGSAGSIISGNTINNLSAGTATAIQTNTSTNSKIIGNRIFKGTINKHSSD
FT                   TIDGNMIV"
FT   gene            complement(419763..419984)
FT                   /gene="yczF"
FT                   /locus_tag="BSU_03690"
FT                   /old_locus_tag="BSU03690"
FT   CDS_pept        complement(419763..419984)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yczF"
FT                   /locus_tag="BSU_03690"
FT                   /old_locus_tag="BSU03690"
FT                   /product="conserved protein of unknown function"
FT                   /note="Evidence 4: Unknown function but conserved in other
FT                   organisms"
FT                   /db_xref="EnsemblGenomes-Gn:BSU03690"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12177"
FT                   /db_xref="GOA:O31479"
FT                   /db_xref="SubtiList:BG12780"
FT                   /db_xref="UniProtKB/Swiss-Prot:O31479"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB12177.1"
FT                   /translation="MKILGVTGFILICLLAISVLMDMLQGFSLTKAVYNNMSSFKMTTF
FT                   AEWVVLLFFVLVLVREMYVIYKSKKKNP"
FT   gene            420110..421744
FT                   /gene="gerKA"
FT                   /locus_tag="BSU_03700"
FT                   /old_locus_tag="BSU03700"
FT   CDS_pept        420110..421744
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gerKA"
FT                   /locus_tag="BSU_03700"
FT                   /old_locus_tag="BSU03700"
FT                   /product="spore germination receptor subunit"
FT                   /function="16.5: Explore"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 10762253, 16707705, 16740944;
FT                   Product type cp: cell process"
FT                   /db_xref="EnsemblGenomes-Gn:BSU03700"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12178"
FT                   /db_xref="GOA:P49939"
FT                   /db_xref="InterPro:IPR004995"
FT                   /db_xref="SubtiList:BG11392"
FT                   /db_xref="UniProtKB/Swiss-Prot:P49939"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:10762253, 16707705, 16740944"
FT                   /protein_id="CAB12178.1"
FT                   /translation="MPLFSKRKNNTDSKDKQNTDERNQEQQQEKERPVLISPSLAKNIA
FT                   ETKKEVGSSSDVIIREIKIGEQDHVHLAVIYISGLVDNNTIHESLIDPLVQDESIQNTH
FT                   AIQQILEKTLPLGGVKAEKSWDKLFSELMLGNALIFADGHDEALICSTQGGEQRSIQEP
FT                   STQVSFRGPRQGFTESLQTNISMIRRYIKNPNLWVEKMKKGSVTNTDIALMYIQGICDE
FT                   KVLKEVKQRLEKIDIDSILESGYIEQLIEDETFTTFPTMYHTERPDVVAGNLLEGRFAI
FT                   IVDGTPFVLIAPALFVQFFQSVEDYYSRFDIATSIRILRVLVFFISLVAPAVYVAATTF
FT                   HQEMIPTQLLVVIAAQREIVPFPAVVEALTMEVAFEILREAGVRLPRVVGSAVSIVGAL
FT                   VIGQAAVQAGIVSPAMVIIVALTAIASFATPAFAMAISARLIRFIFIIASAVMGFYGLI
FT                   LGIIMMFVHLCSLRSFGVPYMSPLAPFSSQGVKDALFRVPWWADEKRPESVSKEDKVRQ
FT                   GKDQRPEPAASRGMVNKDLEEGDQNGT"
FT   gene            421734..422957
FT                   /gene="gerKC"
FT                   /locus_tag="BSU_03710"
FT                   /old_locus_tag="BSU03710"
FT   CDS_pept        421734..422957
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gerKC"
FT                   /locus_tag="BSU_03710"
FT                   /old_locus_tag="BSU03710"
FT                   /product="spore germination receptor subunit"
FT                   /function="16.5: Explore"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 10762253, 16707705, 16740944,
FT                   19363077; Product type cp: cell process"
FT                   /db_xref="EnsemblGenomes-Gn:BSU03710"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12179"
FT                   /db_xref="GOA:P49941"
FT                   /db_xref="InterPro:IPR008844"
FT                   /db_xref="InterPro:IPR038501"
FT                   /db_xref="SubtiList:BG11394"
FT                   /db_xref="UniProtKB/Swiss-Prot:P49941"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:10762253, 16707705, 16740944, 19363077"
FT                   /protein_id="CAB12179.1"
FT                   /translation="MVRKCLLAVLMLLSVIVLPGCWDKRELTDLAIISAIGIDRTNDSN
FT                   YVLHLQIINPGNVAGGLQGGGAGDRPPVSVYSIEGNNITEALRKASMKVSRRLYFAHTN
FT                   LVVINEKLAKEEGLDFVLDNLDRDTEFRTTATFVVAHKTKAENIVKILTPIDKIPSNKV
FT                   NKTLDFTEAQYGRVVKINIQDVLKTLAANTMAPVIPGYMMIGDDKKGVSMENTQATDPK
FT                   AILQADGLAVFDKAGYLKYWLEDDESVGAVWLMNKIQHTFINADWGKTKDAVSLQVTHQ
FT                   DTKLVPKMRNGRPYIHVKVSVEGIIDAVKYPFQLSDPKVLAAIEKALNKELEKEISHTV
FT                   KKIKKNKIDFIGFGDTIYRKYPEQWEKMKDTWDKEYLPELPIDVKAETYIRRTGLRNNP
FT                   IKHQFKDD"
FT   gene            422982..424103
FT                   /gene="gerKB"
FT                   /locus_tag="BSU_03720"
FT                   /old_locus_tag="BSU03720"
FT   CDS_pept        422982..424103
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gerKB"
FT                   /locus_tag="BSU_03720"
FT                   /old_locus_tag="BSU03720"
FT                   /product="spore germination receptor subunit"
FT                   /function="16.5: Explore"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 10762253, 15849754, 16707705,
FT                   16740944, 16850406, 19363077; Product type cp : cell
FT                   process"
FT                   /db_xref="EnsemblGenomes-Gn:BSU03720"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12180"
FT                   /db_xref="GOA:P49940"
FT                   /db_xref="InterPro:IPR004761"
FT                   /db_xref="SubtiList:BG11393"
FT                   /db_xref="UniProtKB/Swiss-Prot:P49940"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:10762253, 15849754, 16707705, 16740944, 16850406,
FT                   19363077"
FT                   /protein_id="CAB12180.1"
FT                   /translation="MEKARISIRQLFVMIIIFELGSSLLITPGSMAGRDAWIAVLLGCA
FT                   IGLFLFYLYQGIYQCYPNSSPKEYMDDMLGTKLSWLFSFLYILYFAYIAARVLRDFGEM
FT                   LLTFAYHDTPIIIVNALLMVVSIYAVRKGIEVLARAAELLFGAMYLLGAIGLVLIIVSG
FT                   TIDPHNLKPVLANGISPVLHSVFTQTMYVPFGEVVLFVMIFPNLNDRKDVKKMGMIAMA
FT                   ISGLIVALTVAINISVLDVDLTLRSQFPLLSTIQTIKVEEFLDRLDVFFMLALIIGGFF
FT                   KVSLYLYATVVGTSTLFKEKNPSQLAYPMGLGILILSITIATNFSEHLNEGLNVVPLYI
FT                   HLPFQLLFPLFLFIVAVWKKKRREKSKGEEAKK"
FT   gene            complement(424208..424888)
FT                   /gene="yclH"
FT                   /locus_tag="BSU_03730"
FT                   /old_locus_tag="BSU03730"
FT   CDS_pept        complement(424208..424888)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yclH"
FT                   /locus_tag="BSU_03730"
FT                   /old_locus_tag="BSU03730"
FT                   /product="putative ABC transporter (ATPase component)"
FT                   /function="16.1: Circulate"
FT                   /note="Evidence 3: Putative function from multiple
FT                   computational evidences; Product type t: transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BSU03730"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12181"
FT                   /db_xref="GOA:P94411"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="SubtiList:BG12029"
FT                   /db_xref="UniProtKB/Swiss-Prot:P94411"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB12181.1"
FT                   /translation="MSLLQFQQVGYWYKNKSQPLFQDINISFQKGKFYTIVGTSGTGKT
FT                   TFLSLAGGLDAPKEGNILYDGKAVSKIGLTNFRNQYVSIVFQAYNLLPYMTALQNVTTA
FT                   MEITGSKEKNKESYALDMLQKVGINEKQARQKVLTLSGGQQQRVSITRAFCCDTDLIVA
FT                   DEPTGNLDEDTSKEIVRLFQDLAHKEDKCVIMVTHDEQIAKVSDINIRLSRGSFTVKEN
FT                   VAVV"
FT   gene            complement(424904..426364)
FT                   /gene="yclI"
FT                   /locus_tag="BSU_03740"
FT                   /old_locus_tag="BSU03740"
FT   CDS_pept        complement(424904..426364)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yclI"
FT                   /locus_tag="BSU_03740"
FT                   /old_locus_tag="BSU03740"
FT                   /product="putative transporter"
FT                   /note="Evidence 3: Putative function from multiple
FT                   computational evidences; Product type t: transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BSU03740"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12182"
FT                   /db_xref="GOA:P94412"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR025857"
FT                   /db_xref="SubtiList:BG12030"
FT                   /db_xref="UniProtKB/Swiss-Prot:P94412"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB12182.2"
FT                   /translation="MNFIKRAFWNMKAKKGKTLLQLFVFTVICVFVLSGLAIQSAAQKS
FT                   SELARQELGGSVTLQVDRQKQMEKQQDSGEKRSFESTPIKVSDANKLAALDHVKSYNYT
FT                   TSASANAGNFDAIESSSSSDSSSSSSSSNAKNSQGGGQGGPQMVQADLSIEGVISTALV
FT                   DDFSDGDSKITDGRAITKSDVGKKVTVINETLAEENDLSVGDSITIESATDEDTTVKLK
FT                   IVGIYKTTSSGDDQAQNFSFLNPYNKLYTPYTATAALKGDDYKNTIDSAVYYMDDAKNM
FT                   DTFVKAAKKTSIDFDTYTLNTNDQLYQQMVGPIENVASFSKNVVYLVSVAGAVILGLIV
FT                   MMSIRERKYEMGVLMAIGEKRWKLIGQFLTEILIVAVIAIGLASVTGNLVANQLGNQLL
FT                   SQQISSSTDSTQTASGQMPGGGGGMGGKMFGHSSSNVDVIDSLNVAVSMNDMLILGGIG
FT                   ILIAIIATLLPSISVLRLHPKTILTKQE"
FT   gene            426577..427260
FT                   /gene="yclJ"
FT                   /locus_tag="BSU_03750"
FT                   /old_locus_tag="BSU03750"
FT   CDS_pept        426577..427260
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yclJ"
FT                   /locus_tag="BSU_03750"
FT                   /old_locus_tag="BSU03750"
FT                   /product="two-component response regulator [YclK] (possibly
FT                   involved in arabinogalactan metabolism)"
FT                   /function="16.3: Control"
FT                   /function="16.10: Respire"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 11717295, 15375128, 20512483;
FT                   Product type r: regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BSU03750"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12183"
FT                   /db_xref="GOA:P94413"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="SubtiList:BG12031"
FT                   /db_xref="UniProtKB/Swiss-Prot:P94413"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:11717295, 15375128, 20512483"
FT                   /protein_id="CAB12183.1"
FT                   /translation="MKILMIEDNVSVCTMTEMFFFKEGFEAEFVHDGLEGYQRFTEENW
FT                   DLIILDIMLPSMDGVTICRKIRETSTVPIIMLTAKDTESDQVIGFEMGADDYVTKPFSP
FT                   LTLVARIKAVIRRYKATGKAVIDEDMIETECFTINKKTREVLLNGEPVENLTPKEFDLL
FT                   YYLVQNPRQVFSREQLLEQVWGYQFYGDERTVDVHIKRLRKKLASEDKPFLYTVWGVGY
FT                   KFDED"
FT   gene            427247..428668
FT                   /gene="yclK"
FT                   /locus_tag="BSU_03760"
FT                   /old_locus_tag="BSU03760"
FT   CDS_pept        427247..428668
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yclK"
FT                   /locus_tag="BSU_03760"
FT                   /old_locus_tag="BSU03760"
FT                   /product="two-component sensor histidine kinase [YclJ]"
FT                   /function="16.12: Sense"
FT                   /function="16.3: Control"
FT                   /function="16.10: Respire"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 11717295, 15375128, 20512483;
FT                   Product type rc: receptor"
FT                   /db_xref="EnsemblGenomes-Gn:BSU03760"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12184"
FT                   /db_xref="GOA:P94414"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="SubtiList:BG12032"
FT                   /db_xref="UniProtKB/Swiss-Prot:P94414"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:11717295, 15375128, 20512483"
FT                   /protein_id="CAB12184.1"
FT                   /translation="MMKIKYLYQLLLSHISILILAFVIIISLFSHFVKEFAYQNKVEEL
FT                   TSYAVQIANEFQSGQVDMRRLYPYQDILSTRKTQFIIFNEEQQPYFLPEGFHHPPREQL
FT                   KKSEWNKLKKGQTVTIRADGRFDDEVSLVAQPIFVQNEFKGAVLLISPISGVEQMVNQV
FT                   NLYMFYAVISTLVITILVSWLLSKFHVKRIQKLREATDKVASGDYDIHLENSYGDEIGV
FT                   LASDFNIMAKKLKQSRDEIERLEKRRRQFIADVSHELKTPLTTINGLVEGLNSHTIPED
FT                   KKDKCFSLISEETKRMLRLVKENLDYEKIRSQQITLNKLDVPLIEVFEIVKEHLQQQAE
FT                   EKQNKLMIQVEDHVIVHADYDRFIQILVNITKNSIQFTQNGDIWLRGMEGYKETIIEIE
FT                   DTGIGIPKEDIEHIWERFYKADISRTNTAYGEYGLGLSIVRQLVEMHQGTVEIKSEEGK
FT                   GTKFIIRLPLTAKQQ"
FT   gene            428831..429979
FT                   /gene="rapC"
FT                   /locus_tag="BSU_03770"
FT                   /old_locus_tag="BSU03770"
FT   CDS_pept        428831..429979
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rapC"
FT                   /locus_tag="BSU_03770"
FT                   /old_locus_tag="BSU03770"
FT                   /product="response regulator aspartate phosphatase"
FT                   /function="16.3: Control"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 10464187, 12456319, 12897006,
FT                   12950917, 15968044, 19202088; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU03770"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12185"
FT                   /db_xref="GOA:P94415"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR040702"
FT                   /db_xref="SubtiList:BG11966"
FT                   /db_xref="UniProtKB/Swiss-Prot:P94415"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:10464187, 12456319, 12897006, 12950917, 15968044,
FT                   19202088"
FT                   /protein_id="CAB12185.1"
FT                   /translation="MKSGVIPSSAVGQKINEWYRYIRTFSVPDAEVLKAEIQQELKHMQ
FT                   HDSNLLLYYSLMEFRHQLMLDYLEPLEKLNIEDQPSLSELSRNIDSNQADLKGLLDYYV
FT                   NFFRGMYEFDKREFISAITYYKQAEKKLSFVADHIERAEFYFKIAEAYYYMKQTYFSLI
FT                   NIKNAYEIYVEQETYNVRIIQCHFVFGVNLMDERNFEQAARHFKLALNMAQAEQKAQLV
FT                   GRAYYNLGLCYYNQDLLDPAIDYFEKAVSTFESSRIVNSLPQAYFLITLIYYKQGKHDK
FT                   ASEYHKRGYEYAKETDDADYAVKFEFLQSLYLDQPNEEGIERCFQYLKNKNMYADIEDL
FT                   ALEVAKYYYEQKWFKLSASYFLQVEEARKQIQRSEGLYEIEI"
FT   gene            429963..430085
FT                   /gene="phrC"
FT                   /locus_tag="BSU_03780"
FT                   /old_locus_tag="BSU03780"
FT   CDS_pept        429963..430085
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phrC"
FT                   /locus_tag="BSU_03780"
FT                   /old_locus_tag="BSU03780"
FT                   /product="secreted regulator of the activity of phosphatase
FT                   RapC and competence and sporulation stimulating factor
FT                   (CSF)"
FT                   /function="16.3: Control"
FT                   /function="16.5: Explore"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 10464187, 12456319, 12897006,
FT                   12950917, 16816200, 19202088; Product type r : regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BSU03780"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12186"
FT                   /db_xref="GOA:P94416"
FT                   /db_xref="InterPro:IPR025899"
FT                   /db_xref="SubtiList:BG11959"
FT                   /db_xref="UniProtKB/Swiss-Prot:P94416"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:10464187, 12456319, 12897006, 12950917, 16816200,
FT                   19202088"
FT                   /protein_id="CAB12186.1"
FT                   /translation="MKLKSKLFVICLAAAAIFTAAGVSANAEALDFHVTERGMT"
FT   gene            complement(430185..430274)
FT                   /gene="yczM"
FT                   /locus_tag="BSU_03788"
FT                   /old_locus_tag="BSU03788"
FT   CDS_pept        complement(430185..430274)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yczM"
FT                   /locus_tag="BSU_03788"
FT                   /old_locus_tag="BSU03788"
FT                   /product="putative type I toxin"
FT                   /note="Evidence 3: Putative function from multiple
FT                   computational evidences; PubMedId: 20156992, 21670523;
FT                   Product type f: factor"
FT                   /db_xref="EnsemblGenomes-Gn:BSU03788"
FT                   /db_xref="EnsemblGenomes-Tr:CAX52547"
FT                   /db_xref="GOA:C0H3V0"
FT                   /db_xref="InterPro:IPR010070"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0H3V0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX52547.1"
FT                   /translation="MSGYGTSFALIVVLFILLIIVGTAFVGGY"
FT   gene            complement(430356..430469)
FT                   /gene="yczN"
FT                   /locus_tag="BSU_03789"
FT                   /old_locus_tag="BSU03789"
FT   CDS_pept        complement(430356..430469)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yczN"
FT                   /locus_tag="BSU_03789"
FT                   /old_locus_tag="BSU03789"
FT                   /product="putative spore and germination protein"
FT                   /note="Evidence 3: Putative function from multiple
FT                   computational evidences; PubMedId: 21670523; Product type
FT                   f: factor"
FT                   /db_xref="EnsemblGenomes-Gn:BSU03789"
FT                   /db_xref="EnsemblGenomes-Tr:CAX52548"
FT                   /db_xref="GOA:C0H3V1"
FT                   /db_xref="InterPro:IPR010070"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0H3V1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX52548.1"
FT                   /translation="MSGYSNGGGYGGISSFALIVVLFILLIIVGTAFVGGF"
FT   gene            complement(430623..431987)
FT                   /gene="thrD"
FT                   /locus_tag="BSU_03790"
FT                   /old_locus_tag="BSU03790"
FT   CDS_pept        complement(430623..431987)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thrD"
FT                   /locus_tag="BSU_03790"
FT                   /old_locus_tag="BSU03790"
FT                   /product="aspartate kinase III"
FT                   /function="16.2: Construct biomass (Anabolism)"
FT                   /EC_number="2.7.2.4"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 2152900, 11471740, 27260660;
FT                   Product type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU03790"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12187"
FT                   /db_xref="GOA:P94417"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001341"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR005260"
FT                   /db_xref="InterPro:IPR018042"
FT                   /db_xref="InterPro:IPR027795"
FT                   /db_xref="InterPro:IPR035804"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="SubtiList:BG12033"
FT                   /db_xref="UniProtKB/Swiss-Prot:P94417"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:2152900, 11471740, 27260660"
FT                   /protein_id="CAB12187.1"
FT                   /translation="MKVVKFGGSSLASGAQLDKVFHIVTSDPARKAVVVSAPGKHYAED
FT                   TKVTDLLIACAEQYLATGSAPELAEAVVERYALIANELQLGQSIIEKIRDDLFTLLEGD
FT                   KSNPEQYLDAVKASGEDNNAKLIAAYFRYKGVKAEYVNPKDAGLFVTNEPGNAQVLPES
FT                   YQNLYRLRERDGLIIFPGFFGFSKDGDVITFSRSGSDITGSILANGLQADLYENFTDVD
FT                   AVYSVNPSFVENPKEISELTYREMRELSYAGFSVFHDEALIPAFRAGIPVQIKNTNNPS
FT                   AEGTRVVSKRDNTNGPVVGIASDTGFCSIYISKYLMNREIGFGRRALQILEEHGLTYEH
FT                   VPSGIDDMTIILRQGQMDAATERSVIKRIEEDLHADEVIVEHHLALIMVVGEAMRHNVG
FT                   TTARAAKALSEAQVNIEMINQGSSEVSMMFGVKEAEERKAVQALYQEFFAGVLIS"
FT   gene            432372..433322
FT                   /gene="pbtN"
FT                   /locus_tag="BSU_03800"
FT                   /old_locus_tag="BSU03800"
FT   CDS_pept        432372..433322
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pbtN"
FT                   /locus_tag="BSU_03800"
FT                   /old_locus_tag="BSU03800"
FT                   /product="petrobactin iron-siderophore ABC transporter
FT                   (permease)"
FT                   /function="16.1: Circulate"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 12354229, 15849754, 16850406,
FT                   19955416; Product type t: transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BSU03800"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12188"
FT                   /db_xref="GOA:P94418"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="SubtiList:BG12034"
FT                   /db_xref="UniProtKB/Swiss-Prot:P94418"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:12354229, 15849754, 16850406, 19955416"
FT                   /protein_id="CAB12188.1"
FT                   /translation="MKLRYLFILLIILAVTSVFIGVEDLSPLDLFDLSKQEASTLFASR
FT                   LPRLISIVIAGLSMSICGLIMQQISRNKFVSPTTAGTMDWARLGILISLLLFTSASPLI
FT                   KMLVAFVFALAGNFLFMKILERIKFNDTIFIPLVGLMLGNIVSSIATFIAYKYDLIQNV
FT                   SSWLQGDFSLVVKGRYELLYLSIPLVIIAYVYADKFTLAGMGESFSVNLGLKYKRVVNI
FT                   GLIIVSLITSLVILTVGMLPFLGLIIPNIVSIYRGDNLKSSLPHTVLLGAVFVLFCDIL
FT                   GRIIIFPYEISIGLMVGIIGSGIFLFMLLRRKAYA"
FT   gene            433315..434262
FT                   /gene="pbtO"
FT                   /locus_tag="BSU_03810"
FT                   /old_locus_tag="BSU03810"
FT   CDS_pept        433315..434262
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pbtO"
FT                   /locus_tag="BSU_03810"
FT                   /old_locus_tag="BSU03810"
FT                   /product="petrobactin iron-siderophore ABC transporter
FT                   (permease)"
FT                   /function="16.1: Circulate"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 12354229, 15849754, 16850406,
FT                   19955416; Product type t: transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BSU03810"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12189"
FT                   /db_xref="GOA:P94419"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="SubtiList:BG12035"
FT                   /db_xref="UniProtKB/Swiss-Prot:P94419"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:12354229, 15849754, 16850406, 19955416"
FT                   /protein_id="CAB12189.1"
FT                   /translation="MRNQMKIALLVGLAIVCIGLFLFYDLGNWDYTLPRRIKKVAAIVL
FT                   TGGAIAFSTMIFQTITNNRILTPSILGLDSLYMLIQTGIIFLFGSANMVIMNKNINFII
FT                   SVLLMILFSLVLYQIMFKGEGRNIFFLLLIGIVFGTLFSSLSSFMQMLIDPNEFQVVQD
FT                   KMFASFNNINTDLLWLAFIIFLLTGVYVWRFTKFFDVLSLGREHAVNLGIDYDKVVKQM
FT                   LIVVAILVSVSTALVGPIMFLGLLVVNLAREFLKTYKHSYLIAGSVFISIIALVGGQFV
FT                   VEKVFTFSTTLSVIINFAGGIYFIYLLLKENKSW"
FT   gene            434256..435014
FT                   /gene="pbtP"
FT                   /locus_tag="BSU_03820"
FT                   /old_locus_tag="BSU03820"
FT   CDS_pept        434256..435014
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pbtP"
FT                   /locus_tag="BSU_03820"
FT                   /old_locus_tag="BSU03820"
FT                   /product="petrobactin iron-siderophore ABC transporter
FT                   (ATP-binding protein)"
FT                   /function="16.1: Circulate"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 12354229, 19955416; Product
FT                   type t: transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BSU03820"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12190"
FT                   /db_xref="GOA:P94420"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="SubtiList:BG12036"
FT                   /db_xref="UniProtKB/Swiss-Prot:P94420"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:12354229, 19955416"
FT                   /protein_id="CAB12190.1"
FT                   /translation="MVEVRNVSKQYGGKVVLEETSVTIQKGKITSFIGPNGAGKSTLLS
FT                   IMSRLIKKDSGEIYIDGQEIGACDSKELAKKMSILKQANQINIRLTIKDLVSFGRFPYS
FT                   QGRLTEEDWVHINQALSYMKLEDIQDKYLDQLSGGQCQRAFIAMVIAQDTDYIFLDEPL
FT                   NNLDMKHSVEIMKLLKRLVEELGKTIVIVIHDINFASVYSDYIVALKNGRIVKEGPPEE
FT                   MIETSVLEEIYDMTIPIQTIDNQRIGVYFS"
FT   gene            435036..435989
FT                   /gene="pbtQ"
FT                   /locus_tag="BSU_03830"
FT                   /old_locus_tag="BSU03830"
FT   CDS_pept        435036..435989
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pbtQ"
FT                   /locus_tag="BSU_03830"
FT                   /old_locus_tag="BSU03830"
FT                   /product="petrobactin iron-siderophore ABC transporter
FT                   (binding lipoprotein)"
FT                   /function="16.1: Circulate"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 12354229, 19955416, 25355936;
FT                   Product type t: transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BSU03830"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12191"
FT                   /db_xref="GOA:P94421"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="InterPro:IPR033870"
FT                   /db_xref="PDB:3GFV"
FT                   /db_xref="SubtiList:BG12037"
FT                   /db_xref="UniProtKB/Swiss-Prot:P94421"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:12354229, 19955416, 25355936"
FT                   /protein_id="CAB12191.1"
FT                   /translation="MKKFALLFIALVTAVVISACGNQSTSSKGSDTKKEQITVKHQLDK
FT                   NGTKVPKNPKKVVVFDFGSLDTLDKLGLDDIVAGLPKQVLPKYLSKFKDDKYADVGSLK
FT                   EPDFDKVAELDPDLIIISARQSESYKEFSKIAPTIYLGVDTAKYMESFKSDAETIGKIF
FT                   DKEDKVKDELANIDHSIADVKKTAEKLNKNGLVIMANDGKISAFGPKSRYGLIHDVFGV
FT                   APADQNIKASTHGQSVSYEYISKTNPDYLFVIDRGTAIGETSSTKQVVENDYVKNVNAV
FT                   KNGHVIYLDSATWYLSGGGLESMTQMIKEVKDGLEK"
FT   gene            complement(436036..437454)
FT                   /gene="ycnB"
FT                   /locus_tag="BSU_03840"
FT                   /old_locus_tag="BSU03840"
FT   CDS_pept        complement(436036..437454)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycnB"
FT                   /locus_tag="BSU_03840"
FT                   /old_locus_tag="BSU03840"
FT                   /product="putative efflux transporter"
FT                   /function="16.1: Circulate"
FT                   /note="Evidence 3: Putative function from multiple
FT                   computational evidences; PubMedId: 15849754, 15855514,
FT                   16850406; Product type t: transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BSU03840"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12192"
FT                   /db_xref="GOA:P94422"
FT                   /db_xref="InterPro:IPR004638"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="SubtiList:BG12038"
FT                   /db_xref="UniProtKB/Swiss-Prot:P94422"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB12192.1"
FT                   /translation="MNTSIEQKPFNRSVIVGILLAGAFVAILNQTLLITALPHIMRDFN
FT                   VDANQAQWLTTSFMLTNGILIPITAFLIEKFTSRALLITAMSIFTAGTVVGAFAPNFPV
FT                   LLTARIIQAAGAGIMMPLMQTVFLTIFPIEKRGQAMGMVGLVISFAPAIGPTLSGWAVE
FT                   AFSWRSLFYIILPFAVIDLILASILMKNVTTLRKTQIDILSVILSTFGFGGLLYGFSSV
FT                   GSYGWSSSTVLISLLVGVIALLLFITRQMKLKKPMLEFRVFTFGVFSLTTLLGTLVFAL
FT                   LIGTETILPLYTQNVRDVTAFDTGLMLLPGAVVMGFMSPIIGRIFDRVGGRGLAIAGFC
FT                   IIFLTSLPFMQLTDHTSLAWIVVLYTVRLLGTAMIMMPVTTAGINALPRHLIPHGTAMN
FT                   NTIRQVGGSIGTALLVSVMSNQAAHAGTTNVKHAALHGMNAAFIVAAVIALVGFLLSFT
FT                   LKKPQRPAEQQPAR"
FT   gene            complement(437474..438352)
FT                   /gene="ycnC"
FT                   /locus_tag="BSU_03850"
FT                   /old_locus_tag="BSU03850"
FT   CDS_pept        complement(437474..438352)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycnC"
FT                   /locus_tag="BSU_03850"
FT                   /old_locus_tag="BSU03850"
FT                   /product="putative transcriptional regulator (TetR/AcrR
FT                   family)"
FT                   /function="16.3: Control"
FT                   /note="Evidence 3: Putative function from multiple
FT                   computational evidences; Product type r: regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BSU03850"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12193"
FT                   /db_xref="GOA:P94423"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="SubtiList:BG12039"
FT                   /db_xref="UniProtKB/Swiss-Prot:P94423"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB12193.2"
FT                   /translation="MLDKKTDILLAARKLFSEKDFTSVSMQAIAEECKMSKASIYKLFQ
FT                   SKEDLLLELLSFNQKQMVAAASRLQENTALTPEERLTQKVKMELEGFRRNQQFFNMLTY
FT                   GNPKLHNDRVKQHIHQTRSTIICWHRDSLIQAYGETILPFVWDLVIILHGMMREFLMLI
FT                   KIEEKPLELDPIAEFIISTLNQIIKNRETRQSLLPPEAIELYIHSASSYKPKDKSVLLS
FT                   ESLKELHKGISSLSAADYDVDELTSAAAMLEEEAKKEEPRAFLLKSLIGYLEQTGVLTQ
FT                   PVSMLKTLLIT"
FT   gene            complement(438516..439265)
FT                   /gene="nfrAB"
FT                   /locus_tag="BSU_03860"
FT                   /old_locus_tag="BSU03860"
FT   CDS_pept        complement(438516..439265)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nfrAB"
FT                   /locus_tag="BSU_03860"
FT                   /old_locus_tag="BSU03860"
FT                   /product="NADPH-FMN oxidoreductase (nitroreductase)"
FT                   /function="16.11: Scavenge (Catabolism)"
FT                   /function="16.8: Protect"
FT                   /EC_number="1.6.99.-"
FT                   /EC_number="1.5.1.39"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 16229462, 9836433, 20862523;
FT                   Product type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU03860"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12194"
FT                   /db_xref="GOA:P94424"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR016446"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="PDB:1ZCH"
FT                   /db_xref="SubtiList:BG12040"
FT                   /db_xref="UniProtKB/Swiss-Prot:P94424"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:16229462, 9836433, 20862523"
FT                   /protein_id="CAB12194.1"
FT                   /translation="MNEVIKSLTDHRSIRSYTDEPVAQEQLDQIIEAVQSAPSSINGQQ
FT                   VTVITVQDKERKKKISELAGGQPWIDQAPVFLLFCADFNRAKIALEDLHDFKMEITNGL
FT                   ESVLVGAVDAGIALGTATAAAESLGLGTVPIGAVRGNPQELIELLELPKYVFPLSGLVI
FT                   GHPADRSAKKPRLPQEAVNHQETYLNQDELTSHIQAYDEQMSEYMNKRTNGKETRNWSQ
FT                   SIASYYERLYYPHIREMLEKQGFKVEK"
FT   gene            complement(439282..439569)
FT                   /gene="ycnE"
FT                   /locus_tag="BSU_03870"
FT                   /old_locus_tag="BSU03870"
FT   CDS_pept        complement(439282..439569)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycnE"
FT                   /locus_tag="BSU_03870"
FT                   /old_locus_tag="BSU03870"
FT                   /product="putative AI-2 degrading enzyme"
FT                   /note="Evidence 3: Putative function from multiple
FT                   computational evidences; PubMedId: 17274596, 21454635;
FT                   Product type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU03870"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12195"
FT                   /db_xref="GOA:P94425"
FT                   /db_xref="InterPro:IPR007138"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="SubtiList:BG12041"
FT                   /db_xref="UniProtKB/Swiss-Prot:P94425"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB12195.1"
FT                   /translation="MIVLQAYIKVKPEKREEFLSEAQSLVQHSRAEEGNAQYDLFEKVG
FT                   EENTFVMLEKWKDEAAMKFHNETAHFQGFVAKGKELLSAPLDVVRTELSE"
FT   gene            439709..440023
FT                   /gene="yczG"
FT                   /locus_tag="BSU_03880"
FT                   /old_locus_tag="BSU03880"
FT   CDS_pept        439709..440023
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yczG"
FT                   /locus_tag="BSU_03880"
FT                   /old_locus_tag="BSU03880"
FT                   /product="putative transcriptional regulator (ArsR family)"
FT                   /function="16.3: Control"
FT                   /note="Evidence 3: Putative function from multiple
FT                   computational evidences; Product type r: regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BSU03880"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12196"
FT                   /db_xref="GOA:O31480"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="SubtiList:BG12781"
FT                   /db_xref="UniProtKB/Swiss-Prot:O31480"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB12196.1"
FT                   /translation="MNIPNHPETETLQLTKVLHALSDPLRLELVKQLAEAKEKTCSTCA
FT                   DVQVAKSTLSHHFKVLRESGIAQVRIEGKRRYYSLRAEDLEKAFPGLLEAVLNVDQDRW
FT                   "
FT   gene            complement(440025..441464)
FT                   /gene="gabR"
FT                   /locus_tag="BSU_03890"
FT                   /old_locus_tag="BSU03890"
FT   CDS_pept        complement(440025..441464)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gabR"
FT                   /locus_tag="BSU_03890"
FT                   /old_locus_tag="BSU03890"
FT                   /product="transcriptional regulator (GntR/MocR family) with
FT                   PLP binding site (GabR-GABA-PLP aldimine)"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 15223311, 24127574, 25388514,
FT                   27640111, 28348215, 28412355; Product type r : regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BSU03890"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12197"
FT                   /db_xref="GOA:P94426"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="PDB:4MGR"
FT                   /db_xref="PDB:4N0B"
FT                   /db_xref="PDB:4TV7"
FT                   /db_xref="PDB:5T4J"
FT                   /db_xref="PDB:5T4K"
FT                   /db_xref="PDB:5X03"
FT                   /db_xref="SubtiList:BG12042"
FT                   /db_xref="UniProtKB/Swiss-Prot:P94426"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:15223311, 24127574, 25388514, 27640111, 28348215,
FT                   28412355"
FT                   /protein_id="CAB12197.1"
FT                   /translation="MDITITLDRSEQADYIYQQIYQKLKKEILSRNLLPHSKVPSKREL
FT                   AENLKVSVNSVNSAYQQLLAEGYLYAIERKGFFVEELDMFSAEEHPPFALPDDLKEIHI
FT                   DQSDWISFSHMSSDTDHFPIKSWFRCEQKAASRSYRTLGDMSHPQGIYEVRAAITRLIS
FT                   LTRGVKCRPEQMIIGAGTQVLMQLLTELLPKEAVYAMEEPGYRRMYQLLKNAGKQVKTI
FT                   MLDEKGMSIAEITRQQPDVLVTTPSHQFPSGTIMPVSRRIQLLNWAAEEPRRYIIEDDY
FT                   DSEFTYDVDSIPALQSLDRFQNVIYMGTFSKSLLPGLRISYMVLPPELLRAYKQRGYDL
FT                   QTCSSLTQLTLQEFIESGEYQKHIKKMKQHYKEKRERLITALEAEFSGEVTVKGANAGL
FT                   HFVTEFDTRRTEQDILSHAAGLQLEIFGMSRFNLKENKRQTGRPALIIGFARLKEEDIQ
FT                   EGVQRLFKAVYGHKKIPVTGD"
FT   gene            441571..442881
FT                   /gene="gabT"
FT                   /locus_tag="BSU_03900"
FT                   /old_locus_tag="BSU03900"
FT   CDS_pept        441571..442881
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gabT"
FT                   /locus_tag="BSU_03900"
FT                   /old_locus_tag="BSU03900"
FT                   /product="4-aminobutyrate aminotransferase"
FT                   /function="16.8: Protect"
FT                   /EC_number="2.6.1.19"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 4590473, 12123465, 12354229,
FT                   15590624, 9723923, 19854901, 24529384; Product type e:
FT                   enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU03900"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12198"
FT                   /db_xref="GOA:P94427"
FT                   /db_xref="InterPro:IPR004632"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="SubtiList:BG12043"
FT                   /db_xref="UniProtKB/Swiss-Prot:P94427"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:4590473, 12123465, 12354229, 15590624, 9723923,
FT                   19854901, 24529384"
FT                   /protein_id="CAB12198.1"
FT                   /translation="MSQTTASITTAQWQQKRDQFVSKGVSNGNRSLAVKGEGAELYDLD
FT                   GRRFIDFAGAIGTLNVGHSHPKVVEAVKRQAEELIHPGFNVMMYPTYIELAEKLCGIAP
FT                   GSHEKKAIFLNSGAEAVENAVKIARKYTKRQGVVSFTRGFHGRTNMTMSMTSKVKPYKF
FT                   GFGPFAPEVYQAPFPYYYQKPAGMSDESYDDMVIQAFNDFFIASVAPETVACVVMEPVQ
FT                   GEGGFIIPSKRFVQHVASFCKEHGIVFVADEIQTGFARTGTYFAIEHFDVVPDLITVSK
FT                   SLAAGLPLSGVIGRAEMLDAAAPGELGGTYAGSPLGCAAALAVLDIIEEEGLNERSEEI
FT                   GKIIEDKAYEWKQEFPFIGDIRRLGAMAAIEIVKDPDTREPDKTKAAAIAAYANQNGLL
FT                   LLTAGINGNIIRFLTPLVISDSLLNEGLSILEAGLRA"
FT   gene            442950..444338
FT                   /gene="gabD"
FT                   /locus_tag="BSU_03910"
FT                   /old_locus_tag="BSU03910"
FT   CDS_pept        442950..444338
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gabD"
FT                   /locus_tag="BSU_03910"
FT                   /old_locus_tag="BSU03910"
FT                   /product="succinate-semialdehyde dehydrogenase"
FT                   /function="16.8: Protect"
FT                   /EC_number="1.2.1.24"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 12354229, 15590624, 9723923,
FT                   12123465, 24529384, 24809290, 25911692; Product type e:
FT                   enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU03910"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12199"
FT                   /db_xref="GOA:P94428"
FT                   /db_xref="InterPro:IPR010102"
FT                   /db_xref="InterPro:IPR012394"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="SubtiList:BG12044"
FT                   /db_xref="UniProtKB/Swiss-Prot:P94428"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:12354229, 15590624, 9723923, 12123465, 24529384,
FT                   24809290, 25911692"
FT                   /protein_id="CAB12199.1"
FT                   /translation="MPDQLTVYNPATGEEIKTIPQQSATEVEEAIERSHQAFKTWSKTS
FT                   ANERTSLLKKWYELIVEHKEELADLITKENGKPYQEAVGEVLYGAGYIEWFAEEAKRVY
FT                   GRTVPAPTTGKRIVVTRQPVGPVAAITPWNFPNAMITRKAAPALAAGCTFIIKPAPDTP
FT                   LSAYELARLAYEAGIPKDVLQVVIGDGEEIGNVFTSSPKIRKITFTGSTPVGKILMKNS
FT                   ADTVKHVSMELGGHAPLIVDEDADIDLAVEQAMASKYRNAGQTCVCANRLIVHESIKDE
FT                   FAAKLSEQVSKLKVGNGLEEGVNVGPIINKRGFEKIVSQIDDAVEKGAKVIAGGTYDRN
FT                   DDKGCYFVNPTVLTDVDTSMNIMHEETFGPVAPIVTFSDIDEAIQLANDTPYGLAAYFF
FT                   TENYRRGIYISENLEYGIIGWNDGGPSAVQAPFGGMKESGIGREGGSEGIEPYLETKYL
FT                   SIGL"
FT   gene            444461..445324
FT                   /gene="glcU"
FT                   /locus_tag="BSU_03920"
FT                   /old_locus_tag="BSU03920"
FT   CDS_pept        444461..445324
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glcU"
FT                   /locus_tag="BSU_03920"
FT                   /old_locus_tag="BSU03920"
FT                   /product="glucose uptake protein"
FT                   /function="16.1: Circulate"
FT                   /note="Evidence 2a: Function from experimental evidences in
FT                   other organisms; PubMedId: 10438764, 15849754, 16850406,
FT                   19054326, 21564334, 27329749; Product type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BSU03920"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12200"
FT                   /db_xref="GOA:P40420"
FT                   /db_xref="InterPro:IPR010651"
FT                   /db_xref="SubtiList:BG11066"
FT                   /db_xref="UniProtKB/Swiss-Prot:P40420"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB12200.1"
FT                   /translation="MDLLLALLPALFWGSIVLFNVKLGGGPYSQTLGTTIGALIVSIVI
FT                   YFFVQPVLSLRIFIVGIVSGLFWSLGQANQLKSIQLMGVSKTMPISTGMQLVSTSLFGV
FT                   IVFREWSTPIAITLGVLALIFIIVGIILTSLEDKNDKKEGEPSNLKKGILILLVSTLGY
FT                   LVYVVVARLFNVSGWSALLPQAIGMVVGGLVLTYRHKPFNKYAIRNILPGLIWAGGNMF
FT                   LFISQPRVGVATSFSLSQMGIVISTLGGIFILREKKTKRQLIAIAIGIILIIAAAVFLG
FT                   IAKTNS"
FT   gene            445344..446129
FT                   /gene="gdh"
FT                   /locus_tag="BSU_03930"
FT                   /old_locus_tag="BSU03930"
FT   CDS_pept        445344..446129
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gdh"
FT                   /locus_tag="BSU_03930"
FT                   /old_locus_tag="BSU03930"
FT                   /product="forespore glucose 1-dehydrogenase"
FT                   /function="16.11: Scavenge (Catabolism)"
FT                   /EC_number="1.1.1.47"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 2493633, 3141376, 6438057,
FT                   16912926; Product type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU03930"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12201"
FT                   /db_xref="GOA:P12310"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="SubtiList:BG10545"
FT                   /db_xref="UniProtKB/Swiss-Prot:P12310"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:2493633, 3141376, 6438057, 16912926"
FT                   /protein_id="CAB12201.1"
FT                   /translation="MYPDLKGKVVAITGAASGLGKAMAIRFGKEQAKVVINYYSNKQDP
FT                   NEVKEEVIKAGGEAVVVQGDVTKEEDVKNIVQTAIKEFGTLDIMINNAGLENPVPSHEM
FT                   PLKDWDKVIGTNLTGAFLGSREAIKYFVENDIKGNVINMSSVHEVIPWPLFVHYAASKG
FT                   GIKLMTETLALEYAPKGIRVNNIGPGAINTPINAEKFADPKQKADVESMIPMGYIGEPE
FT                   EIAAVAAWLASKEASYVTGITLFADGGMTQYPSFQAGRG"
FT   gene            complement(446174..446788)
FT                   /gene="cutI"
FT                   /locus_tag="BSU_03940"
FT                   /old_locus_tag="BSU03940"
FT   CDS_pept        complement(446174..446788)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cutI"
FT                   /locus_tag="BSU_03940"
FT                   /old_locus_tag="BSU03940"
FT                   /product="putative membrane protein involved in copper
FT                   intake"
FT                   /note="Evidence 3: Putative function from multiple
FT                   computational evidences; PubMedId: 19168619, 22904286,
FT                   27010565, 26822828; Product type f: factor"
FT                   /db_xref="EnsemblGenomes-Gn:BSU03940"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12202"
FT                   /db_xref="GOA:P94431"
FT                   /db_xref="InterPro:IPR012533"
FT                   /db_xref="InterPro:IPR038507"
FT                   /db_xref="SubtiList:BG12045"
FT                   /db_xref="UniProtKB/Swiss-Prot:P94431"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB12202.1"
FT                   /translation="MLKKIALTLCPAIVGSLLFFTAPASAHVSVKPAESAAGSWETYTM
FT                   KVPSEKNLPTTKVVLKMPKDVEFQQYEPIPGWKVSTQKHDDKSVSVTWEATDGGIQEGQ
FT                   FQQFTFVAKNPDKAEEAAWDAYQYYKDGSIVEWTGDEDADTPHSITNITSAKQVTDEHG
FT                   ATKTEDDSENSGSSALDITAMVLSAAAIILSVAALVKKKRA"
FT   gene            complement(446801..448426)
FT                   /gene="cutJ"
FT                   /locus_tag="BSU_03950"
FT                   /old_locus_tag="BSU03950"
FT   CDS_pept        complement(446801..448426)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cutJ"
FT                   /locus_tag="BSU_03950"
FT                   /old_locus_tag="BSU03950"
FT                   /product="copper import permease subunit"
FT                   /function="16.1: Circulate"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 15101989, 15849754, 16850406,
FT                   19168619, 22904286, 23012364; Product type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BSU03950"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12203"
FT                   /db_xref="GOA:C0SP95"
FT                   /db_xref="InterPro:IPR007348"
FT                   /db_xref="InterPro:IPR008457"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR032693"
FT                   /db_xref="InterPro:IPR032694"
FT                   /db_xref="SubtiList:BG12046"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0SP95"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:15101989, 15849754, 16850406, 19168619, 22904286,
FT                   23012364"
FT                   /protein_id="CAB12203.2"
FT                   /translation="MKRNRWWIILLLFLVFLPKTSFAHAYIVKSSPGENSELKSAPAQV
FT                   EIEFNEPVEEGFHYIKVYNSNGDRVDTDKTEIKKDNHHIMTVKLKKNLPKDVYRAEWNA
FT                   VSADGHPVSGVIPFSIGKADGGFSSQKAADSALNPGTAADRAILYTALSLFIGTVFFHL
FT                   FWYKGKSEQLVKRTRRILTGSIAALGLALLLQLPIQTKANAGGGWGSAFQPGYIRETLF
FT                   ETAGGSIWIIQAALFVLLALSVIPAIRKNRFSSFGYWTAPLIFFFGLLLAKAFTGHAAV
FT                   VEEKTVGILMDFLHLTSASIWVGGIAALVLLLSKEWRQPDKTLAWETVRRFSPWALTAV
FT                   GVILFSGLLNGFFIIRSMDSLFHTAYGQALLVKSGLFVFMLVLGAIHFLLTRKQRRTGI
FT                   SRTLKAEWAIGIAVLITAAVFTSLPSPPEPAPEPFYQTKAIENGQSVSLSISPNQPGKN
FT                   VFELRVTDHNGDPVKNIQQITLTVYKTGLSGSENKSTFTLKEKTKGVFQDQNLSINEKG
FT                   NWKIKVHGLTGDFNEINIMFTKTN"
FT   gene            complement(448461..449033)
FT                   /gene="cutR"
FT                   /locus_tag="BSU_03960"
FT                   /old_locus_tag="BSU03960"
FT   CDS_pept        complement(448461..449033)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cutR"
FT                   /locus_tag="BSU_03960"
FT                   /old_locus_tag="BSU03960"
FT                   /product="transcriptional regulator of copper intake
FT                   (CutR-Cu(+))"
FT                   /function="16.3: Control"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 15101989, 22904286, 23012364;
FT                   Product type r: regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BSU03960"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12204"
FT                   /db_xref="GOA:P94433"
FT                   /db_xref="InterPro:IPR001034"
FT                   /db_xref="InterPro:IPR008719"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="SubtiList:BG12047"
FT                   /db_xref="UniProtKB/Swiss-Prot:P94433"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:15101989, 22904286, 23012364"
FT                   /protein_id="CAB12204.1"
FT                   /translation="MLPINRQQHILKWLKEEGSLRISDISARFGVSEMTVYRDVNQLVQ
FT                   SNQVIKTAGGITLPVRTPQTDHMCSYCLKPVNQAHSVQLITVNQDIEQLCCAHCAFLRY
FT                   ADKTEEVSHLICRDFLLQTTVSAGSAYFVVNAELNLHCCQPQAIPFATLDHAERFQKGF
FT                   GGAVCTFDQALEDMLQDRKKRCTCTKK"
FT   gene            449198..449551
FT                   /gene="ycnL"
FT                   /locus_tag="BSU_03970"
FT                   /old_locus_tag="BSU03970"
FT   CDS_pept        449198..449551
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycnL"
FT                   /locus_tag="BSU_03970"
FT                   /old_locus_tag="BSU03970"
FT                   /product="putative reductase or disulfide isomerase"
FT                   /note="Evidence 3: Putative function from multiple
FT                   computational evidences; PubMedId: 15849754, 16850406,
FT                   18307109, 27010565; Product type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU03970"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12205"
FT                   /db_xref="GOA:P94434"
FT                   /db_xref="SubtiList:BG12048"
FT                   /db_xref="UniProtKB/Swiss-Prot:P94434"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB12205.1"
FT                   /translation="MKETPCPNCGKPLTGDMVRSSNVPCQFRCGHCRERLYEYKVSAPI
FT                   MLVSLAAIVLLIYLLMLLRNAAGSVLPAVQHVPMAVFALVCAYPVFIVSERMIAKYVIQ
FT                   NGNIIYRGKRKGS"
FT   gene            449724..451160
FT                   /gene="mtlA"
FT                   /locus_tag="BSU_03981"
FT                   /old_locus_tag="BSU03981"
FT   CDS_pept        449724..451160
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mtlA"
FT                   /locus_tag="BSU_03981"
FT                   /old_locus_tag="BSU03981"
FT                   /product="phosphotransferase system (PTS) mannitol-specific
FT                   enzyme IICB component"
FT                   /function="16.1: Circulate"
FT                   /function="16.11: Scavenge (Catabolism)"
FT                   /EC_number="2.7.1.197"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 12897001, 23279188; Product
FT                   type t: transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BSU03981"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12206"
FT                   /db_xref="GOA:P42956"
FT                   /db_xref="InterPro:IPR003352"
FT                   /db_xref="InterPro:IPR003501"
FT                   /db_xref="InterPro:IPR004718"
FT                   /db_xref="InterPro:IPR013011"
FT                   /db_xref="InterPro:IPR013014"
FT                   /db_xref="InterPro:IPR029503"
FT                   /db_xref="InterPro:IPR036095"
FT                   /db_xref="SubtiList:BG11215"
FT                   /db_xref="UniProtKB/Swiss-Prot:P42956"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:12897001, 23279188"
FT                   /protein_id="CAB12206.2"
FT                   /translation="MQQQEQQQGGMKVKVQRFGSYLSGMIMPNIGAFIAWGIITALFIP
FT                   AGWFPNEQLNTLVSPMITYLLPLLIAYTGGKMIYDHRGGVVGATAAIGVIVGSDIPMFL
FT                   GAMIMGPLGGYLIKQTDKLFKDKVKQGFEMLINNFTAGIVGAALTILAFYAIGPVVLTL
FT                   NKLLAAGVEVIVHANLLPVASVFVEPAKVLFLNNAINHGILSPIGIEQASQTGKSILFL
FT                   VEANPGPGLGILLAYMFFGKGSSKSTAPGAAIIHFFGGIHEIYFPYILMKPALILAAIA
FT                   GGASGLLTFTIFNAGLVAAASPGSIIALMAMTPRGGYFGVLAGVLVAAAVSFIVSAVIL
FT                   KSSKASEEDLAAATEKMQSMKGKKSQAAAALEAEQAKAEEASELSPESVNKIIFACDAG
FT                   MGSSAMGASILRNKVKKAELDISVTNTAINNLPSDADIVITHKDLTDRAKAKLPNATHI
FT                   SVDNFLNSPKYDELIEKLKK"
FT   gene            451185..451616
FT                   /gene="mtlF"
FT                   /locus_tag="BSU_03982"
FT                   /old_locus_tag="BSU03982"
FT   CDS_pept        451185..451616
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mtlF"
FT                   /locus_tag="BSU_03982"
FT                   /old_locus_tag="BSU03982"
FT                   /product="phosphotransferase system (PTS) mannitol-specific
FT                   enzyme IIA component"
FT                   /function="16.1: Circulate"
FT                   /function="16.11: Scavenge (Catabolism)"
FT                   /EC_number="2.7.1.197"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 12897001, 23279188; Product
FT                   type t: transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BSU03982"
FT                   /db_xref="EnsemblGenomes-Tr:CAX52549"
FT                   /db_xref="GOA:C0H3V2"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0H3V2"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:12897001, 23279188"
FT                   /protein_id="CAX52549.1"
FT                   /translation="MQVLAKENIKLNQTVSSKEEAIKLAGQTLIDNGYVTEDYISKMFE
FT                   REETSSTFMGNFIAIPHGTEEAKSEVLHSGISIIQIPEGVEYGEGNTAKVVFGIAGKNN
FT                   EHLDILSNIAIICSEEENIERLISAKSEEDLIAIFNEVN"
FT   gene            451618..452739
FT                   /gene="mtlD"
FT                   /locus_tag="BSU_03990"
FT                   /old_locus_tag="BSU03990"
FT   CDS_pept        451618..452739
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mtlD"
FT                   /locus_tag="BSU_03990"
FT                   /old_locus_tag="BSU03990"
FT                   /product="mannitol-1-phosphate 5-dehydrogenase"
FT                   /function="16.11: Scavenge (Catabolism)"
FT                   /EC_number="1.1.1.17"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 12897001, 22014119, 23279188;
FT                   Product type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU03990"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12207"
FT                   /db_xref="GOA:P42957"
FT                   /db_xref="InterPro:IPR000669"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013118"
FT                   /db_xref="InterPro:IPR013131"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR023027"
FT                   /db_xref="InterPro:IPR023028"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="SubtiList:BG11216"
FT                   /db_xref="UniProtKB/Swiss-Prot:P42957"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:12897001, 22014119, 23279188"
FT                   /protein_id="CAB12207.2"
FT                   /translation="MIALHFGAGNIGRGFIGALLHHSGYDVVFADVNETMVSLLNEKKE
FT                   YTVELAEEGRSSEIIGPVSAINSGSQTEELYRLMNEAALITTAVGPNVLKLIAPSIAEG
FT                   LRRRNTANTLNIIACENMIGGSSFLKKEIYSHLTEAEQKSVSETVGFPNSAVDRIVPIQ
FT                   HHEDPLKVSVEPFFEWVIDESGFKGKTPVINGALFVDDLTPYIERKLFTVNTGHAVTAY
FT                   VGYQRGLKTVKEAIDHPEIRRVVHSALLETGDYLVKSYGFKQTEHEQYIKKIIGRFENP
FT                   FISDDVTRVARSPLRKLGENDRLVGPAKKIKEPNALAEGIAAALRFDFTGDPEAVELQA
FT                   LIEEKGYSGVLQEVCGIQSHEPLHAIILKKLNQ"
FT   gene            452830..453894
FT                   /gene="ycsA"
FT                   /locus_tag="BSU_04000"
FT                   /old_locus_tag="BSU04000"
FT   CDS_pept        452830..453894
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycsA"
FT                   /locus_tag="BSU_04000"
FT                   /old_locus_tag="BSU04000"
FT                   /product="putative tartrate dehydrogenase"
FT                   /function="16.11: Scavenge (Catabolism)"
FT                   /EC_number="1.1.1.93"
FT                   /EC_number="1.1.1.83"
FT                   /EC_number="4.1.1.73"
FT                   /note="Evidence 2a: Function from experimental evidences in
FT                   other organisms; PubMedId: 10568751, 12356321; Product type
FT                   e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU04000"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12208"
FT                   /db_xref="GOA:P42958"
FT                   /db_xref="InterPro:IPR011829"
FT                   /db_xref="InterPro:IPR019818"
FT                   /db_xref="InterPro:IPR024084"
FT                   /db_xref="SubtiList:BG11222"
FT                   /db_xref="UniProtKB/Swiss-Prot:P42958"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB12208.3"
FT                   /translation="MTMKQFEIAAIPGDGVGKEVVAAAEKVLHTAAEVHGGLSFSFTAF
FT                   PWSCDYYLEHGKMMPEDGIHTLTQFEAVFLGAVGNPKLVPDHISLWGLLLKIRRELELS
FT                   INMRPAKQMAGITSPLLHPNDFDFVVIRENSEGEYSEVGGRIHRGDDEIAIQNAVFTRK
FT                   ATERVMRFAFELAKKRRSHVTSATKSNGIYHAMPFWDEVFQQTAADYSGIETSSQHIDA
FT                   LAAFFVTRPETFDVIVASNLFGDILTDISSSLMGSIGIAPSANINPSGKYPSMFEPVHG
FT                   SAPDIAGQGLANPIGQIWTAKLMLDHFGEEELGAKILDVMEQVTADGIKTRDIGGQSTT
FT                   AEVTDEICSRLRKL"
FT   gene            454029..454592
FT                   /gene="sipU"
FT                   /locus_tag="BSU_04010"
FT                   /old_locus_tag="BSU04010"
FT   CDS_pept        454029..454592
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sipU"
FT                   /locus_tag="BSU_04010"
FT                   /old_locus_tag="BSU04010"
FT                   /product="type I signal peptidase"
FT                   /function="16.6: Maintain"
FT                   /function="16.1: Circulate"
FT                   /function="16.2: Construct biomass (Anabolism)"
FT                   /EC_number="3.4.21.89"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 9325333, 10198007, 11856304,
FT                   14568161; Product type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU04010"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12209"
FT                   /db_xref="GOA:P42959"
FT                   /db_xref="InterPro:IPR000223"
FT                   /db_xref="InterPro:IPR015927"
FT                   /db_xref="InterPro:IPR019756"
FT                   /db_xref="InterPro:IPR019757"
FT                   /db_xref="InterPro:IPR019758"
FT                   /db_xref="InterPro:IPR036286"
FT                   /db_xref="SubtiList:BG11223"
FT                   /db_xref="UniProtKB/Swiss-Prot:P42959"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:9325333, 10198007, 11856304, 14568161"
FT                   /protein_id="CAB12209.1"
FT                   /translation="MNAKTITLKKKRKIKTIVVLSIIMIAALIFTIRLVFYKPFLIEGS
FT                   SMAPTLKDSERILVDKAVKWTGGFHRGDIIVIHDKKSGRSFVKRLIGLPGDSIKMKNDQ
FT                   LYINDKKVEEPYLKEYKQEVKESGVTLTGDFEVEVPSGKYFVMGDNRLNSLDSRNGMGM
FT                   PSEDDIIGTESLVFYPFGEMRQAK"
FT   gene            complement(454652..455260)
FT                   /gene="yczH"
FT                   /locus_tag="BSU_04020"
FT                   /old_locus_tag="BSU04020"
FT   CDS_pept        complement(454652..455260)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yczH"
FT                   /locus_tag="BSU_04020"
FT                   /old_locus_tag="BSU04020"
FT                   /product="putative hydrolase"
FT                   /note="Evidence 3: Putative function from multiple
FT                   computational evidences; Product type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU04020"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12210"
FT                   /db_xref="GOA:O31482"
FT                   /db_xref="InterPro:IPR002925"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="SubtiList:BG12782"
FT                   /db_xref="UniProtKB/Swiss-Prot:O31482"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB12210.2"
FT                   /translation="MFPKPLVILAHEIYGVNSHMKKMGRLIKMAGYDVLTPNLLGEDEV
FT                   YTLKEEKTAYEQFTKHERLKTGETIIQNVIRQNAGRHIFVIGFSVGATIAWKCSSMPEV
FT                   SGSVCYYGSRIRDSLHHMPACPVLLFFPNYEPSFDVALLIKKLREKQHTHLEIYQFDAL
FT                   HGFANPDSVYFNRALFFKTLSIIKNGAESRLRTVSSSFF"
FT   gene            455346..455738
FT                   /gene="ycsD"
FT                   /locus_tag="BSU_04030"
FT                   /old_locus_tag="BSU04030"
FT   CDS_pept        455346..455738
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycsD"
FT                   /locus_tag="BSU_04030"
FT                   /old_locus_tag="BSU04030"
FT                   /product="putative hydroxyacyl-(acyl carrier protein)
FT                   dehydratase"
FT                   /function="16.2: Construct biomass (Anabolism)"
FT                   /EC_number="4.2.1.-"
FT                   /note="Evidence 3: Putative function from multiple
FT                   computational evidences; PubMedId: 12682299, 16291680,
FT                   22720735; Product type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU04030"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12211"
FT                   /db_xref="InterPro:IPR013114"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="SubtiList:BG11225"
FT                   /db_xref="UniProtKB/Swiss-Prot:P42961"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB12211.2"
FT                   /translation="MNSLSLPHRYPFLFIDGVTDSEPGKHAAAYKLISENDWFITDTQT
FT                   EMPFSLVIEALAQTAAFTGITDENSLGLLSSVKKAEKLGEAVPGDRLDLTFEVTRNRRG
FT                   FVFGHAKASVGEQPVAEAEIGIYIEK"
FT   gene            complement(455771..455935)
FT                   /gene="yczO"
FT                   /locus_tag="BSU_04039"
FT                   /old_locus_tag="BSU04039"
FT   CDS_pept        complement(455771..455935)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yczO"
FT                   /locus_tag="BSU_04039"
FT                   /old_locus_tag="BSU04039"
FT                   /product="conserved protein of unknown function"
FT                   /note="Evidence 4: Unknown function but conserved in other
FT                   organisms"
FT                   /db_xref="EnsemblGenomes-Gn:BSU04039"
FT                   /db_xref="EnsemblGenomes-Tr:CAX52550"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0H3V3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX52550.1"
FT                   /translation="MTEKKQQNKPNENPEHNDLTDPIPNEELKENMNDEKHKRQQRDNS
FT                   QSERDYDTK"
FT   gene            456068..456817
FT                   /gene="ribZ"
FT                   /locus_tag="BSU_04040"
FT                   /old_locus_tag="BSU04040"
FT   CDS_pept        456068..456817
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ribZ"
FT                   /locus_tag="BSU_04040"
FT                   /old_locus_tag="BSU04040"
FT                   /product="5-amino-6-ribitylamino-2,4(1H,
FT                   3H)-pyrimidinedione 5'-phosphate phosphatase / 5'
FT                   nucleotidase"
FT                   /function="4.9: Riboflavin, FMN, and FAD"
FT                   /function="16.8: Protect"
FT                   /function="16.11: Scavenge (Catabolism)"
FT                   /EC_number="3.1.3.-"
FT                   /note="Evidence 1b: Function from experimental evidences in
FT                   the studied species; PubMedId: 26316208, 27435445,
FT                   27784292; Product type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU04040"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12212"
FT                   /db_xref="GOA:P42962"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="SubtiList:BG11226"
FT                   /db_xref="UniProtKB/Swiss-Prot:P42962"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB12212.2"
FT                   /translation="MSVQREDVDIKLIAIDMDGTLLNDEQLISDENRKAIREAEDKGVY
FT                   VVISTGRTLMTCRELAESLKLSSFLITANGSEIWDSNFNLVERKLLHTDHIQMMWDLRN
FT                   KHNTNFWASTVNKVWRGEFPENITDHEWLKFGFDIEDDDIRNEVLEELRKNKELEITNS
FT                   SPTNIEVNALGINKAAALAKVTEKLGFTMENVMAMGDSLNDIAMIKEAGLGVAMGNAQD
FT                   IVKETADYITDTNIEDGVAKAIRHWVL"
FT   gene            457023..457796
FT                   /gene="pxpA"
FT                   /locus_tag="BSU_04050"
FT                   /old_locus_tag="BSU04050"
FT   CDS_pept        457023..457796
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pxpA"
FT                   /locus_tag="BSU_04050"
FT                   /old_locus_tag="BSU04050"
FT                   /product="oxoprolinase subunit A"
FT                   /function="16.11: Scavenge (Catabolism)"
FT                   /function="16.6: Maintain"
FT                   /EC_number="3.5.2.9"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 9334321, 28830929; Product
FT                   type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU04050"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12213"
FT                   /db_xref="GOA:P42963"
FT                   /db_xref="InterPro:IPR005501"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="SubtiList:BG11227"
FT                   /db_xref="UniProtKB/Swiss-Prot:P42963"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:9334321, 28830929"
FT                   /protein_id="CAB12213.3"
FT                   /translation="MFQIDLNCDLGESFGAYKIGLDQDILEYVTSANIACGFHAGDPSV
FT                   MRKTVALAAERGVKMGAHPGLPDLLGFGRRNMAISPEEAYDLVVYQIGALSGFLKAEGL
FT                   HMQHVKPHGALYNMAAVDQKLSDAIAKAVYKVDPGLILFGLAESELVKAGERIGLQTAN
FT                   EVFADRTYQSDGTLTPRSQPDALIESDDAAVTQVIKMVKEGAVKSQQGHDVSLKADTVC
FT                   IHGDGAHALTFAQKIRKQLKAAGIEVTAISEQRST"
FT   gene            457811..459025
FT                   /gene="pxpG"
FT                   /locus_tag="BSU_04060"
FT                   /old_locus_tag="BSU04060"
FT   CDS_pept        457811..459025
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pxpG"
FT                   /locus_tag="BSU_04060"
FT                   /old_locus_tag="BSU04060"
FT                   /product="5-oxoproline transporter"
FT                   /function="16.1: Circulate"
FT                   /note="Evidence 2b: Function from indirect experimental
FT                   evidences (e.g. phenotypes); PubMedId: 9334321, 15849754,
FT                   16850406, 28830929; Product type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU04060"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12214"
FT                   /db_xref="GOA:P42964"
FT                   /db_xref="InterPro:IPR001046"
FT                   /db_xref="SubtiList:BG11228"
FT                   /db_xref="UniProtKB/Swiss-Prot:P42964"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB12214.3"
FT                   /translation="MEQQKKTAGKKAGSWSLLMGAAFLMATSAIGPGFLTQTATFTNTL
FT                   AASFGFVILISIILDIFAQTNVWRIIAVSGKRGQEIANMVLPGLGYFIAILVVLGGLAF
FT                   NIGNIGGAGLGLQVLFGITPETGALISAVIAILIFVIKEAGKAMDRFTQIAGFVMIILT
FT                   VYVAATTAPPVGQAVANTFVPEHISIFAIVTLVGGTVGGYITFAGGHRLLDAGIKGKES
FT                   IPQVTKSSVVGILITSVMRIALFLAVLGVVSKGLHIDESNPAASVFKLAAGNVGYKIFG
FT                   LIMWSAAITSVIGAAYTSVSFFKTFSPKIEKNSRGIIIGFIVVSTLAFVTIGQPAKILV
FT                   LVGSLNGLILPIALGTLLVAAYKKNIVGDYKHPLWLTSTGALVVIVMAVMGIYTLCTQL
FT                   PQLWS"
FT   gene            459049..459822
FT                   /gene="pxpI"
FT                   /locus_tag="BSU_04070"
FT                   /old_locus_tag="BSU04070"
FT   CDS_pept        459049..459822
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pxpI"
FT                   /locus_tag="BSU_04070"
FT                   /old_locus_tag="BSU04070"
FT                   /product="putative D-5-oxoproline epimerase"
FT                   /function="16.6: Maintain"
FT                   /function="16.11: Scavenge (Catabolism)"
FT                   /note="Evidence 3: Putative function from multiple
FT                   computational evidences; PubMedId: 8186229, 9334321,
FT                   28830929; Product type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU04070"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12215"
FT                   /db_xref="GOA:P42966"
FT                   /db_xref="InterPro:IPR009906"
FT                   /db_xref="InterPro:IPR016938"
FT                   /db_xref="InterPro:IPR038021"
FT                   /db_xref="SubtiList:BG11230"
FT                   /db_xref="UniProtKB/Swiss-Prot:P42966"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB12215.3"
FT                   /translation="MAPKDVRALIREGKINGPTAGMSGGYAQANLVVLKKDLAFDFLLF
FT                   CQRNQKPCPVLDVTEAGSPVPSLAAPDADIRTDFPKYRIYRHGILTEEVSDITPYWEDD
FT                   FVGFLIGCSFSFEQALINNGIAVRHIDEGTNVSMYKTNIDCVPAGAFHGQMVVSMRPVP
FT                   ERLAVRAAQVTSRFPAVHGGPIHIGNPGAIGIRDLGKPDFGDAVSIRDGEVPVFWACGV
FT                   TPQAVAMNVKPEMVITHAPGHMLITDIRDESLAVL"
FT   gene            459867..460589
FT                   /gene="pxpB"
FT                   /locus_tag="BSU_04080"
FT                   /old_locus_tag="BSU04080"
FT   CDS_pept        459867..460589
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pxpB"
FT                   /locus_tag="BSU_04080"
FT                   /old_locus_tag="BSU04080"
FT                   /product="L-5-oxoprolinase (ATP-dependent) subunit B"
FT                   /function="16.6: Maintain"
FT                   /function="16.8: Protect"
FT                   /EC_number="3.5.2.9"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 9334321, 18823995, 19040634,
FT                   20524093, 21050859, 21245531, 22277658, 28830929; Product
FT                   type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU04080"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12216"
FT                   /db_xref="GOA:P60495"
FT                   /db_xref="InterPro:IPR003833"
FT                   /db_xref="InterPro:IPR010016"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="PDB:2KWA"
FT                   /db_xref="PDB:2ZP2"
FT                   /db_xref="SubtiList:BG11231"
FT                   /db_xref="UniProtKB/Swiss-Prot:P60495"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:9334321, 18823995, 19040634, 20524093, 21050859,
FT                   21245531, 22277658, 28830929"
FT                   /protein_id="CAB12216.2"
FT                   /translation="MTVRYQIEQLGDSAMMIRFGEEINEQVNGIVHAAAAYIEEQPFPG
FT                   FIECIPAFTSLTVFYDMYEVYKHLPQGISSPFESVKRDVEERLAEIAEDYEVNRRIVEI
FT                   PVCYGGEFGPDLEEVAKINQLSPEEVIDIHTNGEYVVYMLGFAPGFPFLGGMSKRIAAP
FT                   RKSSPRPSIPAGSVGIAGLQTGVYPISTPGGWQLIGKTPLALFRPQENPPTLLRAGDIV
FT                   KFVRISEKDYHAYKEESN"
FT   gene            460592..461599
FT                   /gene="pxpC"
FT                   /locus_tag="BSU_04090"
FT                   /old_locus_tag="BSU04090"
FT   CDS_pept        460592..461599
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pxpC"
FT                   /locus_tag="BSU_04090"
FT                   /old_locus_tag="BSU04090"
FT                   /product="L-5-oxoprolinase (ATP-dependent) subunit C"
FT                   /function="16.6: Maintain"
FT                   /function="16.8: Protect"
FT                   /function="16.11: Scavenge (Catabolism)"
FT                   /EC_number="3.5.2.9"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 9334321, 18823995, 19040634,
FT                   20524093, 21050859, 21245531, 22277658, 28830929; Product
FT                   type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU04090"
FT                   /db_xref="EnsemblGenomes-Tr:CAE01447"
FT                   /db_xref="GOA:Q7WY77"
FT                   /db_xref="InterPro:IPR003778"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="SubtiList:BG14193"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7WY77"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:9334321, 18823995, 19040634, 20524093, 21050859,
FT                   21245531, 22277658, 28830929"
FT                   /protein_id="CAE01447.2"
FT                   /translation="MKVLKPGLLTTVQDIGRTGYQKYGVLASGAMDTVSLRIANLLIGN
FT                   GENEAGLEITMMGPGPSFHFSKQTLIAVTGADFTLRINDEEAPLWKPVLIKENSTVSFG
FT                   PCKLGSRAYLAAAGGIEVPAVMESKSTYVRGSIGGLHGRALQKEDELNIGEMSALSQTI
FT                   LSRLSSQLGKQGFAAPKWSVSRGRFLPLKKNPVIRVLEGKQFAFFTEESKTRFYEEAFR
FT                   VTPQSDRMGYRLKGEPLELKAPLEMVSEAVSFGTVQVPPDGNPIILLADRQTTGGYPRI
FT                   AHIISADLPIVSQIMPGEHVQFEPVSLQEAEALAVEREQHIKELKTRMKMEWLT"
FT   gene            461615..462367
FT                   /gene="pxpR"
FT                   /locus_tag="BSU_04100"
FT                   /old_locus_tag="BSU04100"
FT   CDS_pept        461615..462367
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pxpR"
FT                   /locus_tag="BSU_04100"
FT                   /old_locus_tag="BSU04100"
FT                   /product="transcriptional regulator of the pxp operon (IclR
FT                   family)"
FT                   /function="16.3: Control"
FT                   /note="Evidence 2a: Function from experimental evidences in
FT                   other organisms; PubMedId: 9334321; Product type r :
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BSU04100"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12217"
FT                   /db_xref="GOA:P42968"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="SubtiList:BG11214"
FT                   /db_xref="UniProtKB/Swiss-Prot:P42968"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB12217.2"
FT                   /translation="MQNKNKTVVKSMALLNLFLHKPSLTLSELVSLTGMPKTSVHRMVS
FT                   SLEEMGFLSRDASGAYSLGLVFLEFGQLVADRLDIRKIAKPVMEELCREVDEAVQLIMR
FT                   DGNEAIYVEKIEGTQTVRLYTAIGRRSPLYAGACARSILSFLPREEIEAYIKQTELISI
FT                   GSGTITDPEKLLQEIDASVQNGYTVSYSELENYTAAIGAPIFNHERQVAAGISIAGFEA
FT                   RFTEDRLPYLTEKVKDAALQISRKIGYT"
FT   gene            462431..463072
FT                   /gene="lipC"
FT                   /locus_tag="BSU_04110"
FT                   /old_locus_tag="BSU04110"
FT   CDS_pept        462431..463072
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lipC"
FT                   /locus_tag="BSU_04110"
FT                   /old_locus_tag="BSU04110"
FT                   /product="spore coat phospholipase B"
FT                   /function="16.6: Maintain"
FT                   /function="16.3: Control"
FT                   /EC_number="3.1.1.-"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 9334321, 17220230, 20057119;
FT                   Product type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU04110"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12218"
FT                   /db_xref="GOA:P42969"
FT                   /db_xref="InterPro:IPR013830"
FT                   /db_xref="InterPro:IPR036514"
FT                   /db_xref="SubtiList:BG11232"
FT                   /db_xref="UniProtKB/Swiss-Prot:P42969"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:9334321, 17220230, 20057119"
FT                   /protein_id="CAB12218.1"
FT                   /translation="MVLRYTALGDSLTTGRGSGLFSPGFVQRFGDMMEADLKTRTAINI
FT                   FARSGLNTEEILGLLSYPYVQKCIRDADMITITGCGNDLIDSVLAYQTSKDETIFSRVS
FT                   AHCHENFEKMIAKVAEIKGENPSPYAIRVFNLYNPFPEIDIAGKWITSFNSHLETLASA
FT                   PHVKIADAYSIFKGKEQEYLSFDGVHPNSKGYQAMAEAVHKLGYKELSVS"
FT   gene            463245..463490
FT                   /gene="yczI"
FT                   /locus_tag="BSU_04120"
FT                   /old_locus_tag="BSU04120"
FT   CDS_pept        463245..463490
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yczI"
FT                   /locus_tag="BSU_04120"
FT                   /old_locus_tag="BSU04120"
FT                   /product="conserved protein of unknown function"
FT                   /note="Evidence 4: Unknown function but conserved in other
FT                   organisms"
FT                   /db_xref="EnsemblGenomes-Gn:BSU04120"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12219"
FT                   /db_xref="GOA:P42970"
FT                   /db_xref="InterPro:IPR025018"
FT                   /db_xref="SubtiList:BG12783"
FT                   /db_xref="UniProtKB/Swiss-Prot:P42970"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB12219.1"
FT                   /translation="MFRIFKMSFAVIIIILALIAFNYTEHTSVIQSVMLVFLGAVMFMQ
FT                   GLEERKKENDGSGAFNIYTAVFVWSVSLIGFTLHII"
FT   gene            complement(463496..463783)
FT                   /gene="yczJ"
FT                   /locus_tag="BSU_04130"
FT                   /old_locus_tag="BSU04130"
FT   CDS_pept        complement(463496..463783)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yczJ"
FT                   /locus_tag="BSU_04130"
FT                   /old_locus_tag="BSU04130"
FT                   /product="conserved protein of unknown function"
FT                   /note="Evidence 4: Unknown function but conserved in other
FT                   organisms"
FT                   /db_xref="EnsemblGenomes-Gn:BSU04130"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12220"
FT                   /db_xref="InterPro:IPR007138"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="SubtiList:BG12784"
FT                   /db_xref="UniProtKB/Swiss-Prot:O31484"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB12220.1"
FT                   /translation="MVREAAMLHIKEGLEQEFEDAFRQAAPIISGMKGYITHSLSKCME
FT                   ETHKYLLLVEWETLEDHTEGFRGSSEYQEWKALLHRFYTPFPTVEHFQDV"
FT   gene            463934..465940
FT                   /gene="pbpC"
FT                   /locus_tag="BSU_04140"
FT                   /old_locus_tag="BSU04140"
FT   CDS_pept        463934..465940
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pbpC"
FT                   /locus_tag="BSU_04140"
FT                   /old_locus_tag="BSU04140"
FT                   /product="penicillin-binding lipoprotein 3; transpeptidase"
FT                   /function="16.13: Shape"
FT                   /function="16.2: Construct biomass (Anabolism)"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 8830698, 10648534; Product
FT                   type lp: lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:BSU04140"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12221"
FT                   /db_xref="GOA:P42971"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR005311"
FT                   /db_xref="InterPro:IPR007887"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR036138"
FT                   /db_xref="SubtiList:BG11234"
FT                   /db_xref="UniProtKB/Swiss-Prot:P42971"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:8830698, 10648534"
FT                   /protein_id="CAB12221.1"
FT                   /translation="MLKKCILLVFLCVGLIGLIGCSKTDSPEDRMEAFVKQWNDQQFDD
FT                   MYQSLTKDVKKEISKKDFVNRYKAIYEQAGVKNLKVTAGEVDKDDQDNKTMKHIPYKVS
FT                   MNTNAGKVSFKNTAVLKLEKTDDEESWNIDWDPSFIFKQLADDKTVQIMSIEPKRGQIY
FT                   DKNGKGLAVNTDVPEIGIVPGELGDKKEKVIKELAKKLDLTEDDIKKKLDQGWVKDDSF
FT                   VPLKKVKPDQEKLVSEATSLQGVTRTNVSSRYYPYGEKTAHLTGYVRAITAEELKKKKE
FT                   GTYSDTSNIGIAGLENVYEDKLRGTTGWKIYVPQTGEVIAEKKAKDGEDLHLTIDIKTQ
FT                   MKLYDELKDDSGAAVALQPKTGETLALVSAPSYDPNGFIFGWSDKEWKKLNKDKNNPFS
FT                   AKFNKTYAPGSTIKPIAAAIGIKNGTLKADEKKTIKGKEWQKDSSWGGYSVTRVSERLQ
FT                   QVDLENALITSDNIYFAQNALDMGADTFTKGLKTFGFSEDVPYEFPIQKSSIANDKLDS
FT                   DILLADTGYGQGQMQMSPLHLATAYTPFVDNGDLVKPTLIKKDSQTADVWHKQVVTKEG
FT                   AADITKGLKGVVEDERGSAYQPVVKGITVAGKTGTAELKTSKDDKDGTENGWFVGYDYE
FT                   NKDLLVAMMIQNVQDRGGSHYVVEKAKKQFQSN"
FT   gene            466042..466944
FT                   /gene="ycsN"
FT                   /locus_tag="BSU_04150"
FT                   /old_locus_tag="BSU04150"
FT   CDS_pept        466042..466944
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycsN"
FT                   /locus_tag="BSU_04150"
FT                   /old_locus_tag="BSU04150"
FT                   /product="putative oxidoreductase"
FT                   /function="16.11: Scavenge (Catabolism)"
FT                   /EC_number="1.1.1.-"
FT                   /note="Evidence 3: Putative function from multiple
FT                   computational evidences; PubMedId: 22720735; Product type
FT                   e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU04150"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12222"
FT                   /db_xref="GOA:P42972"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="SubtiList:BG11235"
FT                   /db_xref="UniProtKB/Swiss-Prot:P42972"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB12222.1"
FT                   /translation="MQRIQLAEDLQFSRVIHGLWRLNEWNYSDAELLSLIEWCIDHGIT
FT                   TFDHADIYGGYTCEKLFGNALALSPGLRENIELVTKCGIVLESPERPAHRSHHYNTSKS
FT                   HILASVEQSLMNLRTDYIDMLLIHRPDPLMDPEGVAEAFQALKCSGKVRYFGVSNFKDH
FT                   QYRMLESYLPEKLVTNQIELSAYELENMLDGTLNLCQEKRIPPMAWSPLAGGKVFTENT
FT                   DKDRRVRTALESVQGEIGAASLDEVMYAWLYTHPAGIMPIVGSGKRERISAAINALSYK
FT                   LDQDQWFRIFTAVQGYDIP"
FT   gene            467130..469214
FT                   /gene="mtlR"
FT                   /locus_tag="BSU_04160"
FT                   /old_locus_tag="BSU04160"
FT   CDS_pept        467130..469214
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mtlR"
FT                   /locus_tag="BSU_04160"
FT                   /old_locus_tag="BSU04160"
FT                   /product="transcriptional regulator, PTS-dependent
FT                   activator"
FT                   /function="16.3: Control"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 12897001, 23279188, 24196428,
FT                   26159071; Product type r: regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BSU04160"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12223"
FT                   /db_xref="GOA:P96574"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR003501"
FT                   /db_xref="InterPro:IPR007737"
FT                   /db_xref="InterPro:IPR011608"
FT                   /db_xref="InterPro:IPR013011"
FT                   /db_xref="InterPro:IPR013196"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="InterPro:IPR036095"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR036634"
FT                   /db_xref="SubtiList:BG12049"
FT                   /db_xref="UniProtKB/Swiss-Prot:P96574"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:12897001, 23279188, 24196428, 26159071"
FT                   /protein_id="CAB12223.1"
FT                   /translation="MYMTAREQKLLKHLLLQNRYITVTELAELMQVSTRTIHRELKSIK
FT                   PLMETVGLTLDKQPGKGLKAVGSPEGKQKLLTDLSYEQHEYSADERKLLILCSLLESQE
FT                   PVKLYTLAHDLQVTNATVSYDLDELEKWISPFGLTLIRKRGFGIQLIGPENAKRKIVGN
FT                   LIVNRLDIQMFLEAVELNIKGKTDSSEKMFGVVSKGELLKMERILFQLKEKIAFSLSDS
FT                   SYIALVVHLTYAIERIKLGETITMEQNELEELMNAKEYSSALEIAGELERAFGVTIPEA
FT                   EVGYITIHLRSANRKYKTEYKAQEIELETALQTKRLIAFISDKIRMDLTKNYSLYEGLI
FT                   AHLEPAVSRIKENIEIYNPMKEQIKRDYFLLYMAIEEGVEKYFPGMSFSDDEIAFIVLH
FT                   FGSALEIKKEEAKVKALVVCSSGIGSSKMLASRLKKELPEIESFDMSSLIELKGKDVQA
FT                   YDMIVSTVPIPYENIDYIMVSPLLNEEDANQVKQYIKRKIPLILNKKRSSKEEAQQADV
FT                   PDMLEAAESIGRYMEVIQDVLRHFTLAQLKTNPDHSMLLLELFQQLKKDGLIRDPEKAA
FT                   VCLAEREKQGGLGIPGTNMALYHLKNDEIVLPFFKMFDLSTPYEVDGMDGNTLRMTRIL
FT                   VMMAPGSLSAEGSEILSAISSAIIESGESMAGFQEEGGQELYQRLNRIFFTWMKEKNIL
FT                   "
FT   gene            469426..470937
FT                   /gene="ydaB"
FT                   /locus_tag="BSU_04170"
FT                   /old_locus_tag="BSU04170"
FT   CDS_pept        469426..470937
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydaB"
FT                   /locus_tag="BSU_04170"
FT                   /old_locus_tag="BSU04170"
FT                   /product="putative acyl-CoA ligase"
FT                   /EC_number="6.2.1.-"
FT                   /note="Evidence 3: Putative function from multiple
FT                   computational evidences; Product type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU04170"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12224"
FT                   /db_xref="GOA:P96575"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="SubtiList:BG12050"
FT                   /db_xref="UniProtKB/Swiss-Prot:P96575"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB12224.2"
FT                   /translation="METLQHLILHDMPNSEEIEAVKSGDHTLTYKGYRKRINQLANAML
FT                   QKGIQKGDRVALLCKNGHPASTVMFAALEIGAVVVPVSWQLKPYEMTGILKASEPKAMF
FT                   YGAEFKEILDEVLPELSSLCVTMETGTAYETSAEFEALFAGPDHLPETEMVSPDDTALL
FT                   MFTSGTTGNPKRCMITHGGIYRYVKKSNSSIARMKGLRFLACHPIYHTSALICIMLGTF
FT                   AETTFVFTKDQDPVHMLKVIEEEKIQTVMALPVFYTYLLEAWEKHQTDLSSLVILMTGG
FT                   TKVPSSLISRYLDIGIPLAHGYGSTEAWGISTWTPDMGMDKAASAGKPVAGVKVKVEDP
FT                   LTGEELPQGEIGEIVVHTPFLFKGYEDNPEATAKVLQNGWFRTGDSGYVDEDGFIFITG
FT                   RYKDVIIYGGDNVYPDQVEEVIQQIPGILETAVVGIPDPLYGEKPKAFIVKNGGQRITE
FT                   EDVIAFCKERLSAYKIPEVEFVNELPKNNLGKVKKDVLRNQAVHS"
FT   gene            complement(470957..471502)
FT                   /gene="ydaC"
FT                   /locus_tag="BSU_04180"
FT                   /old_locus_tag="BSU04180"
FT   CDS_pept        complement(470957..471502)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydaC"
FT                   /locus_tag="BSU_04180"
FT                   /old_locus_tag="BSU04180"
FT                   /product="putative methyltransferase"
FT                   /EC_number="2.1.1.-"
FT                   /note="Evidence 3: Putative function from multiple
FT                   computational evidences; Product type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU04180"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12225"
FT                   /db_xref="GOA:P96576"
FT                   /db_xref="InterPro:IPR026669"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="SubtiList:BG12051"
FT                   /db_xref="UniProtKB/Swiss-Prot:P96576"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB12225.1"
FT                   /translation="MIAGYIMAAENQTLNQWTINQLGITRGDSILEVGFGPGYCMQQML
FT                   KREKDVHLHGIDVSEAMLKLAARRVKPKGVRLIQGSIETFPLPASFYDKVISVNNYTIW
FT                   NDQTKGIKQIYRALKPGGKAAITMQPREADASPEKTKSFGRQMIADFKAAGFEDIDIQF
FT                   KNIKPELSVCATAKKPAT"
FT   gene            471709..472569
FT                   /gene="ydaD"
FT                   /locus_tag="BSU_04190"
FT                   /old_locus_tag="BSU04190"
FT   CDS_pept        471709..472569
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydaD"
FT                   /locus_tag="BSU_04190"
FT                   /old_locus_tag="BSU04190"
FT                   /product="putative dehydrogenase"
FT                   /function="16.8: Protect"
FT                   /function="16.11: Scavenge (Catabolism)"
FT                   /EC_number="1.1.1.-"
FT                   /note="Evidence 3: Putative function from multiple
FT                   computational evidences; PubMedId: 10220166, 11948145,
FT                   15805528, 21520290, 28197687; Product type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU04190"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12226"
FT                   /db_xref="GOA:P80873"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="SubtiList:BG12052"
FT                   /db_xref="UniProtKB/Swiss-Prot:P80873"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB12226.1"
FT                   /translation="MANYPKELPAQTQSRQPGIESEMNPSPVYEYEDYKGADKLKGKVA
FT                   LITGGDSGIGRAVSVAYAKEGADIAIVYKDEHEDAEETKKRVEQEGVKCLLIAGDVGEE
FT                   EFCNEAVEKTVKELGGLDILVNNAGEQHPKESIKDITSEQLHRTFKTNFYSQFYLTKKA
FT                   IDYLKPGSAIINTTSINPYVGNPTLIDYTATKGAINAFTRTMAQALVKDGIRVNAVAPG
FT                   PIWTPLIPATFPEETVAQFGQDTPMGRPGQPVEHVGCYVLLASDESSYMTGQTLHVNGG
FT                   NFVTT"
FT   gene            472585..473088
FT                   /gene="lyxE"
FT                   /locus_tag="BSU_04200"
FT                   /old_locus_tag="BSU04200"
FT   CDS_pept        472585..473088
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lyxE"
FT                   /locus_tag="BSU_04200"
FT                   /old_locus_tag="BSU04200"
FT                   /product="D-lyxose ketol isomerase"
FT                   /EC_number="5.3.1.15"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 10220166, 15805528, 21421786,
FT                   21520290; Product type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU04200"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12227"
FT                   /db_xref="GOA:P96578"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="PDB:2Y0O"
FT                   /db_xref="SubtiList:BG12053"
FT                   /db_xref="UniProtKB/Swiss-Prot:P96578"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:10220166, 15805528, 21421786, 21520290"
FT                   /protein_id="CAB12227.1"
FT                   /translation="MGITKEEVNSYYQKAGIVLTDEEVDQIQLMDYGLGKERKVGLQLF
FT                   VYVNTDRYCSKELVLFPGQTCPEHRHPPVDGQEGKQETFRCRYGKVYLYVEGEKTPLPK
FT                   VLPPQEDREHYTVWHEIELEPGGQYTIPPNTKHWFQAGEEGAVVTEMSSTSTDKHDIFT
FT                   DPRI"
FT   gene            473174..473725
FT                   /gene="ydaF"
FT                   /locus_tag="BSU_04210"
FT                   /old_locus_tag="BSU04210"
FT   CDS_pept        473174..473725
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydaF"
FT                   /locus_tag="BSU_04210"
FT                   /old_locus_tag="BSU04210"
FT                   /product="putative ribosomal protein N-acetyltransferase"
FT                   /function="16.6: Maintain"
FT                   /EC_number="2.3.1.-"
FT                   /note="Evidence 3: Putative function from multiple
FT                   computational evidences; PubMedId: 15468321; Product type
FT                   e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU04210"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12228"
FT                   /db_xref="GOA:P96579"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="PDB:1NSL"
FT                   /db_xref="SubtiList:BG12054"
FT                   /db_xref="UniProtKB/Swiss-Prot:P96579"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB12228.1"
FT                   /translation="MFTCKVNEHITIRLLEPKDAERLAELIIQNQQRLGKWLFFAENPS
FT                   SADTYRETIIPDWRRQYADLNGIEAGLLYDGSLCGMISLHNLDQVNRKAEIGYWIAKEF
FT                   EGKGIITAACRKLITYAFEELELNRVAICAAVGNEKSRAVPERIGFLEEGKARDGLYVN
FT                   GMHHDLVYYSLLKREWEGEK"
FT   gene            473803..474225
FT                   /gene="ydaG"
FT                   /locus_tag="BSU_04220"
FT                   /old_locus_tag="BSU04220"
FT   CDS_pept        473803..474225
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydaG"
FT                   /locus_tag="BSU_04220"
FT                   /old_locus_tag="BSU04220"
FT                   /product="putative general stress protein"
FT                   /function="16.8: Protect"
FT                   /note="Evidence 3: Putative function from multiple
FT                   computational evidences; PubMedId: 10220166; Product type
FT                   f: factor"
FT                   /db_xref="EnsemblGenomes-Gn:BSU04220"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12229"
FT                   /db_xref="GOA:P80238"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="InterPro:IPR038725"
FT                   /db_xref="SubtiList:BG19017"
FT                   /db_xref="UniProtKB/Swiss-Prot:P80238"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB12229.1"
FT                   /translation="MNQQDIKQKVLDVLDHHKVGSLATVQKGKPHSRYMTFFHDGLTIY
FT                   TPTSKETHKAEEIENNPNVHILLGYDCEGFGDAYVEVAGKAKINNSAELKDKIWSSKLE
FT                   RWFDGKDDPNLVILEIEPEDIRLMNAGEKTPVSLEL"
FT   gene            complement(474329..474597)
FT                   /gene="bsrC"
FT                   /locus_tag="BSU_misc_RNA_64"
FT   misc_RNA        complement(474329..474597)
FT                   /gene="bsrC"
FT                   /locus_tag="BSU_misc_RNA_64"
FT                   /product="small regulatory RNA"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 18948176, 23457461; Product
FT                   type n: RNA"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:18948176, 23457461"
FT   gene            474731..475540
FT                   /gene="amj"
FT                   /locus_tag="BSU_04230"
FT                   /old_locus_tag="BSU04230"
FT   CDS_pept        474731..475540
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="amj"
FT                   /locus_tag="BSU_04230"
FT                   /old_locus_tag="BSU04230"
FT                   /product="lipid II flippase"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 15849754, 16850406, 25918422,
FT                   27537185; Product type t: transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BSU04230"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12230"
FT                   /db_xref="GOA:P96581"
FT                   /db_xref="InterPro:IPR021260"
FT                   /db_xref="SubtiList:BG12055"
FT                   /db_xref="UniProtKB/Swiss-Prot:P96581"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:15849754, 16850406, 25918422, 27537185"
FT                   /protein_id="CAB12230.1"
FT                   /translation="MHVITTQVLFIFCFLLLIHSIETLAYATRLSGARVGFIASALSLF
FT                   NVMVIVSRMSNMVQQPFTGHLIDDAGKNALAIVGEQFRFLIFGSTVGTILGIILLPSFV
FT                   ALFSRAIIHLAGGGGSVFQVFRKGFSKQGFKNALSYLRLPSISYVKGFHMRLIPKRLFV
FT                   INMLITSIYTIGVLSALYAGLLAPERSTTAVMASGLINGIATMLLAIFVDPKVSVLADD
FT                   VAKGKRSYIYLKWTSVTMVTSRVAGTLLAQLMFIPGAYYIAWLTKWF"
FT   gene            complement(475584..475874)
FT                   /gene="ydzA"
FT                   /locus_tag="BSU_04240"
FT                   /old_locus_tag="BSU04240"
FT   CDS_pept        complement(475584..475874)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydzA"
FT                   /locus_tag="BSU_04240"
FT                   /old_locus_tag="BSU04240"
FT                   /product="conserved protein of unknown function"
FT                   /note="Evidence 4: Unknown function but conserved in other
FT                   organisms"
FT                   /db_xref="EnsemblGenomes-Gn:BSU04240"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12231"
FT                   /db_xref="GOA:O31485"
FT                   /db_xref="InterPro:IPR023845"
FT                   /db_xref="SubtiList:BG12807"
FT                   /db_xref="UniProtKB/Swiss-Prot:O31485"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB12231.1"
FT                   /translation="MLHTPIGRLRTMGFIEGMSLLILLFIAMPLKYWAGLPLAVTIVGS
FT                   VHGGLFILYLLVLAYATFSVKWPLKWSAAGFIAAFVPFGNFLYDRGLRNYK"
FT   gene            476059..476493
FT                   /gene="lrpC"
FT                   /locus_tag="BSU_04250"
FT                   /old_locus_tag="BSU04250"
FT   CDS_pept        476059..476493
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lrpC"
FT                   /locus_tag="BSU_04250"
FT                   /old_locus_tag="BSU04250"
FT                   /product="transcriptional regulator (Lrp/AsnC family)"
FT                   /function="16.3: Control"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 9341680, 10606655, 10913073,
FT                   12458218, 16407330, 16528101; Product type r : regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BSU04250"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12232"
FT                   /db_xref="GOA:P96582"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="PDB:2CFX"
FT                   /db_xref="SubtiList:BG12056"
FT                   /db_xref="UniProtKB/Swiss-Prot:P96582"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:9341680, 10606655, 10913073, 12458218, 16407330,
FT                   16528101"
FT                   /protein_id="CAB12232.1"
FT                   /translation="MKLDQIDLNIIEELKKDSRLSMRELGRKIKLSPPSVTERVRQLES
FT                   FGIIKQYTLEVDQKKLGLPVSCIVEATVKNADYERFKSYIQTLPNIEFCYRIAGAACYM
FT                   LKINAESLEAVEDFINKTSPYAQTVTHVIFSEIDTKNGRG"
FT   gene            476558..478741
FT                   /gene="topB"
FT                   /locus_tag="BSU_04260"
FT                   /old_locus_tag="BSU04260"
FT   CDS_pept        476558..478741
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="topB"
FT                   /locus_tag="BSU_04260"
FT                   /old_locus_tag="BSU04260"
FT                   /product="DNA topoisomerase III"
FT                   /function="16.9: Replicate"
FT                   /function="16.2: Construct biomass (Anabolism)"
FT                   /function="16.6: Maintain"
FT                   /EC_number="5.99.1.2"
FT                   /note="Evidence 1c: Function from experimental evidences in
FT                   the studied genus; PubMedId: 16192570, 16556226; Product
FT                   type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU04260"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12233"
FT                   /db_xref="GOA:P96583"
FT                   /db_xref="InterPro:IPR000380"
FT                   /db_xref="InterPro:IPR003601"
FT                   /db_xref="InterPro:IPR003602"
FT                   /db_xref="InterPro:IPR005738"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR013497"
FT                   /db_xref="InterPro:IPR013824"
FT                   /db_xref="InterPro:IPR013825"
FT                   /db_xref="InterPro:IPR013826"
FT                   /db_xref="InterPro:IPR023405"
FT                   /db_xref="InterPro:IPR023406"
FT                   /db_xref="InterPro:IPR034144"
FT                   /db_xref="SubtiList:BG11979"
FT                   /db_xref="UniProtKB/Swiss-Prot:P96583"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB12233.1"
FT                   /translation="MSKTVVLAEKPSVGRDLARVLKCHKKGNGYLEGDQYIVTWALGHL
FT                   VTLADPEGYGKEFQSWRLEDLPIIPEPLKLVVIKKTGKQFNAVKSQLTRKDVNQIVIAT
FT                   DAGREGELVARWIIEKANVRKPIKRLWISSVTDKAIKEGFQKLRSGKEYENLYHSAVAR
FT                   AEADWIVGINATRALTTKFNAQLSCGRVQTPTLAMIAKREADIQAFTPVPYYGIRAAVD
FT                   GMTLTWQDKKSKQTRTFNQDVTSRLLKNLQGKQAVVAELKKTAKKSFAPALYDLTELQR
FT                   DAHKRFGFSAKETLSVLQKLYEQHKLVTYPRTDSRFLSSDIVPTLKDRLEGMEVKPYAQ
FT                   YVSQIKKRGIKSHKGYVNDAKVSDHHAIIPTEEPLVLSSLSDKERKLYDLIAKRFLAVL
FT                   MPAFEYEETKVIAEIGGETFTAKGKTVQSQGWKAVYDMAEEDDEQEDDRDQTLPALQKG
FT                   DTLAVRTLTETSGQTKPPARFNEGTLLSAMENPSAFMQGEEKGLVKTLGETGGLGTVAT
FT                   RADIIEKLFNSFLIEKKGQDIFITSKGKQLLQLVPEDLKSPALTAEWEQKLSAIAAGKL
FT                   KSAVFIKDMKAYAHQTVKEIKNSSQTFRHDNITGTACPECGKMMLKVNGKRGTMLVCQD
FT                   RECGSRKTIARKTNARCPNCHKRMELRGQGEGQTFACVCGHREKLSVFEKRKNKDKARA
FT                   TKRDVSSYMKKQNKDEPINNALAEQLKKLGLDK"
FT   gene            478944..480032
FT                   /gene="epsJ"
FT                   /locus_tag="BSU_04270"
FT                   /old_locus_tag="BSU04270"
FT   CDS_pept        478944..480032
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="epsJ"
FT                   /locus_tag="BSU_04270"
FT                   /old_locus_tag="BSU04270"
FT                   /product="glycosyl hydrolase lipoprotein"
FT                   /function="16.5: Explore"
FT                   /function="16.13: Shape"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 15661000, 26078454, 27897378;
FT                   Product type lp: lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:BSU04270"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12234"
FT                   /db_xref="GOA:O31486"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="SubtiList:BG12057"
FT                   /db_xref="UniProtKB/Swiss-Prot:O31486"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:15661000, 26078454, 27897378"
FT                   /protein_id="CAB12234.1"
FT                   /translation="MRHVLIAVILFFLSIGLSAGCAEAGNKTQNQSATEVNASPLQPAE
FT                   YFIYHNLMNDKGLIKTDFSDQPSYLSESLGLWMEFLLSKNDAPHFQDQYQHLTDSFLMS
FT                   NHLVTWKIQNGQASGTNALIDDMRIMLSLDQAAAKWGRSDYAQTARDIGTSLKTYNMNN
FT                   GFFTDFYDSQAASKDVTLSYVMPDALAVLKKNGIIDEETEQRNANVLYSAPLKNGFLPK
FT                   TYSSETKEYTYDSEINLIDQLYAAWHLPEGDEKASVLADWIKQEFQKNGKLYGRYSAYT
FT                   KEPAVQYESPSVYALAVLFLTKQHENSSVIKAIYDRMNDFEIHDPVKSYYGGYMSGTQT
FT                   HSFDNLLPLLAERKLFNENIIQ"
FT   gene            480013..480864
FT                   /gene="epsK"
FT                   /locus_tag="BSU_04280"
FT                   /old_locus_tag="BSU04280"
FT   CDS_pept        480013..480864
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="epsK"
FT                   /locus_tag="BSU_04280"
FT                   /old_locus_tag="BSU04280"
FT                   /product="cyclic-di-GMP receptor"
FT                   /function="16.3: Control"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 23893111, 27897378; Product
FT                   type rc: receptor"
FT                   /db_xref="EnsemblGenomes-Gn:BSU04280"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12235"
FT                   /db_xref="GOA:P96585"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="SubtiList:BG12058"
FT                   /db_xref="UniProtKB/Swiss-Prot:P96585"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:23893111, 27897378"
FT                   /protein_id="CAB12235.1"
FT                   /translation="MKISFSESQKLFAYFSGLIAALSLFIYYVSAQQSEGALILCITFG
FT                   VIAAGIWFGPIYALAVTLIVLFVLGTLMMFFQTGQTSLFPAEEGLRMLVVWGIALLLFS
FT                   FISGRIHDITAELRRSMTRLQSEIKSYVAVDRVTGFDNKQRMKLELSEEIKRAERYGNS
FT                   FVFLLLHMHYFKEFKSLYGEKETDRLFQYVGQQIRTSVRETDKKFRPSDERIGIVLTHT
FT                   PAEHMPAVLTKLKKQLDTYQLENGKYVSLTFHVCYLPYRNDIQTADQFLEELENEMMMN
FT                   EL"
FT   gene            480875..482584
FT                   /gene="ydaL"
FT                   /locus_tag="BSU_04290"
FT                   /old_locus_tag="BSU04290"
FT   CDS_pept        480875..482584
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydaL"
FT                   /locus_tag="BSU_04290"
FT                   /old_locus_tag="BSU04290"
FT                   /product="conserved protein of unknown function"
FT                   /note="Evidence 4: Unknown function but conserved in other
FT                   organisms; PubMedId: 27897378; Product type ph : phenotype"
FT                   /db_xref="EnsemblGenomes-Gn:BSU04290"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12236"
FT                   /db_xref="GOA:O31487"
FT                   /db_xref="InterPro:IPR018763"
FT                   /db_xref="SubtiList:BG12059"
FT                   /db_xref="UniProtKB/Swiss-Prot:O31487"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB12236.1"
FT                   /translation="MLCVMMLLFSAIASFPVSAQAKDQDAGILIIYSTLDGKESSQVKM
FT                   LDLLAGHFTSHVTVKKDSDVEASDFKGKDHVIYYGQTKRKLSQKLLSLISGVKKPVVAI
FT                   GYNAGQISQFSGLSLARKENVFQVHSRSEKADVSLESGLNVLSVSGLKGTALYTFKADE
FT                   GTTHSFIWKTKKGNVYIGLTNLLNDNLIVAKQLREAFGEKAGTTLLYLRLEDISPMSDE
FT                   KLLLQAGTYLHKRHIPFILAVIPVYLNPETGDKVYLSNQPKMVKVLKKLQSMGGSIIVH
FT                   GYTHAYRYSETGEGFEFWDAKADQPITSGNAEDPPSILEKEQDFPNEQAYHSYLEPFRE
FT                   KEETYTKQKLTRAIEDLTSSGLYPLAFEAPHYTMSEYGYQIASQYFTSIFGQVQLSSTT
FT                   WKTSGAPPFVTAPSMLHGMTLYPETIGFVDTSKQNPLGEMEEHISQMIDFEGGVAGGFY
FT                   HPYLGMKYLPELVDQMERIPDSEWLDLKKTKQTVKTDKVEIHTSGDGTIQVKNGVSPIY
FT                   EFFDHHRQTPLEKALWILSAVVLLFVIMFVSYTFYLRATLKKRIFKERRSLG"
FT   gene            482577..483839
FT                   /gene="ydaM"
FT                   /locus_tag="BSU_04300"
FT                   /old_locus_tag="BSU04300"
FT   CDS_pept        482577..483839
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydaM"
FT                   /locus_tag="BSU_04300"
FT                   /old_locus_tag="BSU04300"
FT                   /product="putative glycosyltransferase associated to
FT                   biofilm formation"
FT                   /EC_number="2.4.-.-"
FT                   /note="Evidence 3: Putative function from multiple
FT                   computational evidences; PubMedId: 27897378, 28296273;
FT                   Product type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU04300"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12237"
FT                   /db_xref="GOA:P96587"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="SubtiList:BG12060"
FT                   /db_xref="UniProtKB/Swiss-Prot:P96587"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB12237.1"
FT                   /translation="MGNTLFFISLSLIWVMLLYHMFLMQGGFRHYMTFERNIPKWRENM
FT                   KELPKVSVLIPAHNEEVVIRQTLKAMVNLYYPKDRLEIIVVNDNSSDRTGDIVNEFSEK
FT                   YDFIKMVITKPPNAGKGKSSALNSGFAESNGDVICVYDADNTPEKMAVYYLVLGLMNDE
FT                   KAGAVVGKFRVINAAKTLLTRFINIETICFQWMAQGGRWKWFKIATIPGTNFAIRRSII
FT                   EKLGGWDDKALAEDTELTIRVYNLGYHIRFFPAAITWEQEPETWKVWWRQRTRWARGNQ
FT                   YVVLKFLAQFFKLKRKRIIFDLFYFFFTYFLFFFGVIMSNAIFVVNLFYDLHLSVGFLA
FT                   MILWILAFFLFMTEVMITLSIEKTEMNKQNFFIVFLMYFTYSQAWIVLVIYSLFVEIKH
FT                   RLFKQEVKWYKTERYNQHKSG"
FT   gene            483845..485956
FT                   /gene="ydaN"
FT                   /locus_tag="BSU_04310"
FT                   /old_locus_tag="BSU04310"
FT   CDS_pept        483845..485956
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydaN"
FT                   /locus_tag="BSU_04310"
FT                   /old_locus_tag="BSU04310"
FT                   /product="putative regulator of exopolysaccharide
FT                   synthesis"
FT                   /note="Evidence 3: Putative function from multiple
FT                   computational evidences; PubMedId: 27897378; Product type
FT                   r: regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BSU04310"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12238"
FT                   /db_xref="GOA:O31488"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR018513"
FT                   /db_xref="SubtiList:BG12061"
FT                   /db_xref="UniProtKB/Swiss-Prot:O31488"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB12238.1"
FT                   /translation="MKQIMIFLTSFMLLAMTGQTALAKDVQVSGSLLGKSSQEQAKQQV
FT                   LTSELITLYGSKDSAELTYQIPAGASSGNQQLVIEYEASNLLISPSSLTVVIDDEPVKT
FT                   LKLDGDSKRKTVKLNLNKSQSAQGYHNVSLKFYGVMKEGVCVRQDTSGNWIKIYPDSRL
FT                   TLADSSEAKGTSLDHYPYPFAQSGNTAEETAIVIPDNPSSAEIEAAVKTEGYLKTVDSS
FT                   VSIAYVTESELKKIDKPTIVIGVDKHWNGKVKKLLKQAGLQAKGENLLLAERVLKAEGK
FT                   QQPVLFAQAASEDALTKKISVMTDQTYTGQLSGDTLSISKLQQTEKKESDKLTLENFGA
FT                   GDITIGADKTSSAHYFYPASAVLDENQSAKLSLKLKKSETIQASTAENESASQAAELKV
FT                   MINGQPHSVRLDELGKEDKNGFYHVTVKVDPKLLQKNRYIDIQFVTTGLKENNPCNTTD
FT                   EEKWVFIDKNSTLSYAIKGMSPSADFQEWPLPYAGNQDQTTLIVLPDTVSQSKLEELSL
FT                   VTESFGNEAQHSYTVKKSSDVTANDAKGRNLIFIGGINQFSLLKEKSSDLLVPQEKNGS
FT                   FDVSSFEMLNETTKQVVFTQASVWDSRYTMAVFAPSKGDGTAVTKEIISYLNSNDESAT
FT                   VLNETNSQQVFTNHQQLKSETNSSDAEQPTQDHSQKWMYIGVLALIMVVAAVFIWIAVR
FT                   RKKRKTDTE"
FT   gene            486092..486235
FT                   /gene="swaO"
FT                   /locus_tag="BSU_misc_RNA_7"
FT   misc_RNA        486092..486235
FT                   /gene="swaO"
FT                   /locus_tag="BSU_misc_RNA_7"
FT                   /product="ATP-, cyclic di-AMP-sensing riboswitch"
FT                   /function="16.3: Control"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 15096624, 20511502, 23086297,
FT                   25086507, 25086509; Product type n: RNA"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:15096624, 20511502, 23086297, 25086507, 25086509"
FT   gene            486432..488255
FT                   /gene="kimA"
FT                   /locus_tag="BSU_04320"
FT                   /old_locus_tag="BSU04320"
FT   CDS_pept        486432..488255
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kimA"
FT                   /locus_tag="BSU_04320"
FT                   /old_locus_tag="BSU04320"
FT                   /product="cyclic di-AMP controlled transporter of
FT                   potassium"
FT                   /function="16.1: Circulate"
FT                   /function="16.3: Control"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 15096624, 15849754, 16850406,
FT                   20511502, 25086509, 26789423, 28420751; Product type t:
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BSU04320"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12239"
FT                   /db_xref="GOA:P96589"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="SubtiList:BG12062"
FT                   /db_xref="UniProtKB/Swiss-Prot:P96589"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:15096624, 15849754, 16850406, 20511502, 25086509,
FT                   26789423, 28420751"
FT                   /protein_id="CAB12239.1"
FT                   /translation="MYHSIKRFLIGKPLKSQAAGEQKLTKLKALAMLSSDALSSVAYGT
FT                   EQILIILATISAAAFWYSIPIAVGVLILLLALILSYRQIIYAYPQGGGAYIVSKENLGE
FT                   KPGLIAGGSLLVDYILTVAVSISAGTDAITSAFPALHDYHVPIAIFLVLVIMILNLRGL
FT                   SESASILAYPVYLFVVALLVLIAVGLFKLMTGQIDQPAHHTSLGTPVAGITLFLLLKAF
FT                   SSGCSALTGVEAISNAIPAFKNPPARNAARTLAMMGILLAILFSGITVLAYGYGTAPKP
FT                   DETVVSQIASETFGRNVFYYVIQGVTSLILVLAANTGFSAFPQLAFNLARDQYMPRMFT
FT                   VRGDRLGFSNGIIFLGFASIVLIILFGGQTEHLIPLYAVGVFIPFTLSQTGMCMKWIKQ
FT                   KPKGWIGKMLINSCGALISFMVLSILFVTKFNVVWPVLIFMPIVVLLFFAIKNHYTAVG
FT                   EQLRIVDKEPEEIKGTVVIVPVAGVTTVVQKSIHYAKSLSDQVIAVHVSFDREQEKKFE
FT                   KRWEELNNGVRLVTLHSSYRSLVHPFDKFLETVEAKAKKEQFSVMVLFPQFITKKRWHT
FT                   ILHNQSAFLLRVRLFWKKDIMVATLPYHFKK"
FT   gene            488314..488763
FT                   /gene="nudT"
FT                   /locus_tag="BSU_04330"
FT                   /old_locus_tag="BSU04330"
FT   CDS_pept        488314..488763
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nudT"
FT                   /locus_tag="BSU_04330"
FT                   /old_locus_tag="BSU04330"
FT                   /product="putative NTP pyrophosphohydrolase"
FT                   /function="16.8: Protect"
FT                   /function="16.6: Maintain"
FT                   /EC_number="3.6.1.-"
FT                   /note="Evidence 3: Putative function from multiple
FT                   computational evidences; PubMedId: 15576788, 16513759;
FT                   Product type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU04330"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12240"
FT                   /db_xref="GOA:P96590"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR020476"
FT                   /db_xref="SubtiList:BG11956"
FT                   /db_xref="UniProtKB/Swiss-Prot:P96590"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB12240.1"
FT                   /translation="MYTQGAFVIVLNESQQILLVKRKDVPLWDLPGGRVDPGESAEEAA
FT                   VREILEETGYNAALSAKIGVYQRPKFQDEQHLFFGSITGGQAMADGTETAGLKWVSPGR
FT                   LPLFMVPNRKRQINDFKNGAQDVNVTVKDSGLLAAIDLLKRRLGK"
FT   gene            488830..490554
FT                   /gene="poxB"
FT                   /locus_tag="BSU_04340"
FT                   /old_locus_tag="BSU04340"
FT   CDS_pept        488830..490554
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="poxB"
FT                   /locus_tag="BSU_04340"
FT                   /old_locus_tag="BSU04340"
FT                   /product="acetyl-phosphate generating pyruvate oxidase"
FT                   /function="16.6: Maintain"
FT                   /function="16.11: Scavenge (Catabolism)"
FT                   /EC_number="1.2.3.3"
FT                   /note="Evidence 2a: Function from experimental evidences in
FT                   other organisms; PubMedId: 16291680, 16513748, 10220166,
FT                   23611909; Product type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU04340"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12241"
FT                   /db_xref="GOA:P96591"
FT                   /db_xref="InterPro:IPR000399"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="SubtiList:BG12063"
FT                   /db_xref="UniProtKB/Swiss-Prot:P96591"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB12241.1"
FT                   /translation="MAHKTAGQAMTELLEQWGVDHVYGIPGDSINEFIEELRHERNQLK
FT                   FIQTRHEEVAALAAAAEAKLTGKIGVCLSIAGPGAVHLLNGLYDAKADGAPVLAIAGQV
FT                   SSGEVGRDYFQEIKLEQMFEDVAVFNREVHSAESLPDLLNQAIRTAYSKKGVAVLSVSD
FT                   DLFAEKIKREPVYTSPVYIEGNLEPKKEQLVTCAQYINNAKKPIILAGQGMKKAKRELL
FT                   EFADKAAAPIVVTLPAKGVVPDKHPHFLGNLGQIGTKPAYEAMEECDLLIMLGTSFPYR
FT                   DYLPDDTPAIQLDSDPAKIGKRYPVTAGLVCDSALGLRELTEYIERKEDRRFLNACTEH
FT                   MQHWWNEIEKDETEATTPLKPQQVVARLQEAAADDAVLSVDVGTVTVWMARHFKMNANQ
FT                   DFIVSSWLATMGCGLPGAIAASLSEPERQAIAVCGDGGFSMVMQDLPTAVKYKLPITVV
FT                   ILNNENLGMIEYEQQVKGNIDYVTKLQNVDYAAFAESCGAKGIKVTKAEELAPAFHEAL
FT                   HSDQPVVVDVMIGNEPPLPGKITYGQAKGFSKYMLKNFFENQKFEMPSLKKSLKRLF"
FT   gene            complement(490546..490749)
FT                   /locus_tag="BSU_04345"
FT                   /old_locus_tag="BSU04345"
FT   CDS_pept        complement(490546..490749)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSU_04345"
FT                   /old_locus_tag="BSU04345"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5: Unknown function"
FT                   /db_xref="UniProtKB/TrEMBL:A0A2K4Z9F4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="SOX90542.1"
FT                   /translation="MIRISMQGQMHLPLKQDAFVLLSVSSMAKSVPNTYTDHFMNSNML
FT                   KIHLFPKKKKKTRALRAPVFLK"
FT   gene            complement(490777..491043)
FT                   /gene="ydzK"
FT                   /locus_tag="BSU_04359"
FT                   /old_locus_tag="BSU04359"
FT   CDS_pept        complement(490777..491043)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydzK"
FT                   /locus_tag="BSU_04359"
FT                   /old_locus_tag="BSU04359"
FT                   /product="putative membrane protein"
FT                   /note="Evidence 3: Putative function from multiple
FT                   computational evidences; Product type m: membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:BSU04359"
FT                   /db_xref="EnsemblGenomes-Tr:CAX52551"
FT                   /db_xref="GOA:C0H3V4"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0H3V4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX52551.1"
FT                   /translation="MSVFILFYLWIVPIVIGILCSVAAHKSKGKMRVAPGIAMIVLSII
FT                   SLITAFTAGHTNFHVFIGGMFLFGTFLVGSAFPFFFGLKKKEK"
FT   gene            complement(491147..492424)
FT                   /gene="mntH"
FT                   /locus_tag="BSU_04360"
FT                   /old_locus_tag="BSU04360"
FT   CDS_pept        complement(491147..492424)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mntH"
FT                   /locus_tag="BSU_04360"
FT                   /old_locus_tag="BSU04360"
FT                   /product="proton-coupled manganese transporter"
FT                   /function="16.1: Circulate"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 12029030, 12950915, 14580210,
FT                   15849754, 16850406, 27573840, 27748968; Product type t:
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BSU04360"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12243"
FT                   /db_xref="GOA:P96593"
FT                   /db_xref="InterPro:IPR001046"
FT                   /db_xref="SubtiList:BG12065"
FT                   /db_xref="UniProtKB/Swiss-Prot:P96593"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:12029030, 12950915, 14580210, 15849754, 16850406,
FT                   27573840, 27748968"
FT                   /protein_id="CAB12243.1"
FT                   /translation="MMNKDITAQSPRSKAVQDALDGKIRGFRGLLPFLGPAFIAAIAYI
FT                   DPGNFATNISAGSKYGYMLLWVILFSNIMALLIQSLSAKLGIATGKNLPEVAREEFPKP
FT                   VSIGLWIQGELVIIATDLAEFIGAALGLYLLFGIPMLEASIIAAIGSFAILELQRRGYR
FT                   SLEAGIAGMLFVVVIAFALQTFFAKPDAVSVMKGLFVPAFHGTDSVLLAAGILGATVMP
FT                   HAIYLHSALTQRRVVGKTDAERKKIFRFEFIDILIAMLIAGAINASMLIVAAALFFKNG
FT                   LFVEDLDVAFQQFGHLVSPMSAALFGIGLLVAGLSSSSVGTLSGDVIMQGFINYRIPLY
FT                   VRRFITIIPPILIIASGVNPTTALVLSQVVLSFGIAFALIPLIMFTSNKRIMGSLINAK
FT                   WITVVSWLIAVLIVALNVFLIVDTFR"
FT   gene            complement(492654..492911)
FT                   /gene="ydaS"
FT                   /locus_tag="BSU_04370"
FT                   /old_locus_tag="BSU04370"
FT   CDS_pept        complement(492654..492911)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydaS"
FT                   /locus_tag="BSU_04370"
FT                   /old_locus_tag="BSU04370"
FT                   /product="conserved protein of unknown function"
FT                   /note="Evidence 4: Unknown function but conserved in other
FT                   organisms"
FT                   /db_xref="EnsemblGenomes-Gn:BSU04370"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12244"
FT                   /db_xref="GOA:P96594"
FT                   /db_xref="InterPro:IPR007341"
FT                   /db_xref="SubtiList:BG12066"
FT                   /db_xref="UniProtKB/Swiss-Prot:P96594"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB12244.1"
FT                   /translation="MLSFLVSLVVAIVIGLIGSAIVGNRLPGGIFGSMIAGLIGAWIGH
FT                   GLLGTWGPSLAGFAIFPAIIGAAIFVFLLGLIFRGLRKEA"
FT   gene            complement(492989..493441)
FT                   /gene="ydaT"
FT                   /locus_tag="BSU_04380"
FT                   /old_locus_tag="BSU04380"
FT   CDS_pept        complement(492989..493441)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydaT"
FT                   /locus_tag="BSU_04380"
FT                   /old_locus_tag="BSU04380"
FT                   /product="conserved protein of unknown function"
FT                   /note="Evidence 4: Unknown function but conserved in other
FT                   organisms"
FT                   /db_xref="EnsemblGenomes-Gn:BSU04380"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12245"
FT                   /db_xref="InterPro:IPR018691"
FT                   /db_xref="SubtiList:BG12067"
FT                   /db_xref="UniProtKB/Swiss-Prot:P96595"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB12245.1"
FT                   /translation="MPWSMKDYPASLKNLEKPVRKKAIDIANAMIDEGYEEGRAIPIAT
FT                   SKAKEWAENASTDEIDDFLTHDDETERDADPSSGSGPELMNKAEHVIKHKKGWAVKAEG
FT                   AKRVSEIKDTKKEAIERAKEIAAHKGTEVIVHLADGSVQRKIKTGS"
FT   gene            493559..494377
FT                   /gene="ydbA"
FT                   /locus_tag="BSU_04390"
FT                   /old_locus_tag="BSU04390"
FT   CDS_pept        493559..494377
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydbA"
FT                   /locus_tag="BSU_04390"
FT                   /old_locus_tag="BSU04390"
FT                   /product="conserved protein of unknown function"
FT                   /note="Evidence 4: Unknown function but conserved in other
FT                   organisms"
FT                   /db_xref="EnsemblGenomes-Gn:BSU04390"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12246"
FT                   /db_xref="InterPro:IPR024787"
FT                   /db_xref="SubtiList:BG12068"
FT                   /db_xref="UniProtKB/Swiss-Prot:P96596"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB12246.1"
FT                   /translation="MPTERKEDLHQQLKEIEKWEKDQQKVWFWEKLSRLPFQLLDKLTP
FT                   EFIQKKIGKLLDEVGSFVQTGGQYLTSEKQIIRMFQKKLPEEIFESLEDIRKAPLPVMD
FT                   EIAEGMGKNRTNAATVQGATTGVGGVFTLAADIPAVLGLSLKTLQDIAVAYGYDPKEKK
FT                   ERVFIVKCLQLTSADVVGKRSILQELKHYDQDRTYKNVASQIQGWREVVLGYRDTFGWK
FT                   KLFQIVPVAGMVFGAAANRSTLNDITETGMMLYKKRRILERLKETEREME"
FT   gene            494506..494877
FT                   /gene="gsiB"
FT                   /locus_tag="BSU_04400"
FT                   /old_locus_tag="BSU04400"
FT   CDS_pept        494506..494877
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gsiB"
FT                   /locus_tag="BSU_04400"
FT                   /old_locus_tag="BSU04400"
FT                   /product="general stress protein glucose starvation
FT                   induced"
FT                   /function="16.8: Protect"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 7651322, 9669336, 9763714,
FT                   12562800, 21421783; Product type f: factor"
FT                   /db_xref="EnsemblGenomes-Gn:BSU04400"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12247"
FT                   /db_xref="InterPro:IPR019626"
FT                   /db_xref="SubtiList:BG10826"
FT                   /db_xref="UniProtKB/Swiss-Prot:P26907"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:7651322, 9669336, 9763714, 12562800, 21421783"
FT                   /protein_id="CAB12247.1"
FT                   /translation="MADNNKMSREEAGRKGGETTSKNHDKEFYQEIGQKGGEATSKNHD
FT                   KEFYQEIGEKGGEATSKNHDKEFYQEIGEKGGEATSENHDKEFYQEIGRKGGEATSKNH
FT                   DKEFYQEIGSKGGNARNND"
FT   gene            495009..495350
FT                   /gene="ydbB"
FT                   /locus_tag="BSU_04410"
FT                   /old_locus_tag="BSU04410"
FT   CDS_pept        495009..495350
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydbB"
FT                   /locus_tag="BSU_04410"
FT                   /old_locus_tag="BSU04410"
FT                   /product="putative enzyme; cupin family"
FT                   /function="16.11: Scavenge (Catabolism)"
FT                   /note="Evidence 3: Putative function from multiple
FT                   computational evidences; PubMedId: 10704478; Product type
FT                   e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU04410"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12248"
FT                   /db_xref="GOA:P96597"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR019780"
FT                   /db_xref="SubtiList:BG12069"
FT                   /db_xref="UniProtKB/Swiss-Prot:P96597"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB12248.1"
FT                   /translation="MSKMQNLLAIANEVKEKHANFSISEVNDHCVRLAVFTGEYDWHHH
FT                   PDSDELFIVLEGELLIDFKDKETAVLKANDSLLIPKGTVHRTRSYVRTVNLCVEHKQAE
FT                   TVIIEEQPC"
FT   gene            495344..495703
FT                   /gene="ydbC"
FT                   /locus_tag="BSU_04420"
FT                   /old_locus_tag="BSU04420"
FT   CDS_pept        495344..495703
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydbC"
FT                   /locus_tag="BSU_04420"
FT                   /old_locus_tag="BSU04420"
FT                   /product="conserved protein of unknown function"
FT                   /note="Evidence 4: Unknown function but conserved in other
FT                   organisms"
FT                   /db_xref="EnsemblGenomes-Gn:BSU04420"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12249"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR032555"
FT                   /db_xref="SubtiList:BG12070"
FT                   /db_xref="UniProtKB/Swiss-Prot:P96598"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB12249.1"
FT                   /translation="MLIKKMICEVDAANAEAFAKAQSQWEALSHISGFIKQAGGWRKTI
FT                   DEPLTAEIISVWENREAYDHFMENEHDSIYEENDQKAVILSIEVTVYEEDKPFVHDLLH
FT                   NPDIRYEPNWTVLKA"
FT   gene            complement(495740..496561)
FT                   /gene="ydbD"
FT                   /locus_tag="BSU_04430"
FT                   /old_locus_tag="BSU04430"
FT   CDS_pept        complement(495740..496561)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydbD"
FT                   /locus_tag="BSU_04430"
FT                   /old_locus_tag="BSU04430"
FT                   /product="putative manganese-containing catalase"
FT                   /function="16.8: Protect"
FT                   /EC_number="1.11.1.6"
FT                   /note="Evidence 3: Putative function from multiple
FT                   computational evidences; PubMedId: 15231799; Product type
FT                   e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU04430"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12250"
FT                   /db_xref="GOA:P80878"
FT                   /db_xref="InterPro:IPR007760"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="InterPro:IPR027407"
FT                   /db_xref="InterPro:IPR039377"
FT                   /db_xref="SubtiList:BG12071"
FT                   /db_xref="UniProtKB/Swiss-Prot:P80878"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB12250.1"
FT                   /translation="MFKHTKMLQHPAKPDRPDPLFAKKMQEILGGQFGEISVAMQYLFQ
FT                   GWNTRGNEKYKDLLMDTATEELGHVEMIATMIARLLEDAPLDQQEKAAEDPVIGSILGG
FT                   MNPHHAIVSGLGAMPESSTGVPWSGGYIVASGNLLADFRANLNAESQGRLQVARLFEMT
FT                   DDKGVKDMLSFLLARDTMHQNQWLAAIKELEAQEGPVVPGTFPKALEKQEFSHQLINFS
FT                   EGEVSAEQNWLNEKAPDGEAFEYVKEAKTFGEKPELKPAPPFVHNTLPGRE"
FT   gene            complement(496646..497698)
FT                   /gene="dctB"
FT                   /locus_tag="BSU_04440"
FT                   /old_locus_tag="BSU04440"
FT   CDS_pept        complement(496646..497698)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dctB"
FT                   /locus_tag="BSU_04440"
FT                   /old_locus_tag="BSU04440"
FT                   /product="membrane bound C4-dicarboxylate binding sensor
FT                   protein"
FT                   /function="16.12: Sense"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 1809844, 10708364, 11566984,
FT                   24375102; Product type rc: receptor"
FT                   /db_xref="EnsemblGenomes-Gn:BSU04440"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12251"
FT                   /db_xref="GOA:P96600"
FT                   /db_xref="InterPro:IPR004682"
FT                   /db_xref="InterPro:IPR018389"
FT                   /db_xref="InterPro:IPR038404"
FT                   /db_xref="SubtiList:BG12072"
FT                   /db_xref="UniProtKB/Swiss-Prot:P96600"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:1809844, 10708364, 11566984, 24375102"
FT                   /protein_id="CAB12251.1"
FT                   /translation="MKSLLACLALMIAGIATALFIGFHDHTGNKKIVYDDDQEGLQDQI
FT                   VFKFSHVVAENTPKGLAANKFADLVNEKSGGKIKIEVFPNGSLYSDIEEIEALQNGDVQ
FT                   FIAPSTSKLGMLSPEWGVLDLPYAFTDYNAVKKGLNGSIGTQLFDSLKKNQLKGLAYWT
FT                   NGFKQITTNQGPVKTPDDLKGQDLRIMQSDVIEDQFKLLGATPHQESFNSTFQLLENNV
FT                   VDGEENTISNIYSKKFYNVQDYLTISSHGYLGYAVMTDEHFWKAQTPETRRILTEAMKE
FT                   TTEWNETYAEQMNKEQLEEIKKNSAIHIYELSDKEKQEWMKRLDPVYRQYEPIFGRELI
FT                   RELLELRKDS"
FT   gene            497768..499375
FT                   /gene="dctS"
FT                   /locus_tag="BSU_04450"
FT                   /old_locus_tag="BSU04450"
FT   CDS_pept        497768..499375
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dctS"
FT                   /locus_tag="BSU_04450"
FT                   /old_locus_tag="BSU04450"
FT                   /product="two-component sensor histidine kinase"
FT                   /function="16.12: Sense"
FT                   /function="16.3: Control"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 10627041, 11717295, 1290636,
FT                   12949159, 24375102; Product type rc: receptor"
FT                   /db_xref="EnsemblGenomes-Gn:BSU04450"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12252"
FT                   /db_xref="GOA:P96601"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR016120"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR033463"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR039506"
FT                   /db_xref="SubtiList:BG12073"
FT                   /db_xref="UniProtKB/Swiss-Prot:P96601"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:10627041, 11717295, 1290636, 12949159, 24375102"
FT                   /protein_id="CAB12252.1"
FT                   /translation="MNKKKLSIRWKITILSYILVIFSFLIGGIVLIGNIQHTEERELKK
FT                   RLMNTARTVSEMTEVKEALARKKQTEAVRHAVEEIRMINEADYIVVMDMNHIRYTHPVS
FT                   TSIGKKSEGADEEAAFAEHIYFSEAKGEIGTAVRAFYPVKDQDLNQIGVVLVGKTLPGI
FT                   ADILLHLKRDIAFIVVLTLGFGLAGSFLLARHIKKQMFQLEPHEIVRMYEERTATFHSM
FT                   NEGVIAIDNRLVITIFNEKAKQIFEVQGDLIGKVIWEVLKDSRLPEIVERNKAVYNEEI
FT                   RVSGKVIMSSRIPIVMKKKVIGAVAIFQDRTEAAKMAEELTGVRNFVEALRVQNHEHMN
FT                   KLHTIAGLIQLGKSEKALQLAFQASTEQENVTEFLHRSIQNDAAAGLLLSKIRRGRELG
FT                   IAVHIDENSSLQQFPEHVDQHDIVVLLGNLIENAFGSFETVQSEDKRIDISIEQTDDIL
FT                   AILIEDNGCGIEPTHMPRLYDKGFTVNKTGGTGYGLYLVKQIIDKGSGTIEVDSHAGQG
FT                   TSFSIVFPMKGEEAQHGS"
FT   gene            499365..500045
FT                   /gene="dctR"
FT                   /locus_tag="BSU_04460"
FT                   /old_locus_tag="BSU04460"
FT   CDS_pept        499365..500045
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dctR"
FT                   /locus_tag="BSU_04460"
FT                   /old_locus_tag="BSU04460"
FT                   /product="two-component response regulator"
FT                   /function="16.3: Control"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 10627041, 11717295, 1290636,
FT                   12949159; Product type r: regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BSU04460"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12253"
FT                   /db_xref="GOA:P96602"
FT                   /db_xref="InterPro:IPR001034"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR024187"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="SubtiList:BG12074"
FT                   /db_xref="UniProtKB/Swiss-Prot:P96602"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:10627041, 11717295, 1290636, 12949159"
FT                   /protein_id="CAB12253.1"
FT                   /translation="MARKEWKVLLIEDDPMVQEVNKDFITTVKGVTVCATAGNGEEGMK
FT                   LIKEEQPDLVILDVYMPKKDGIKTLQEIRKQKLEVDVIVVSAAKDKETISLMLQNGAVD
FT                   YILKPFKLERMRQALEKYKQYKQKIEANDTLSQEQLDAILNIPQQAVQDLPKGLNHFTM
FT                   NEVTAFLKQQTASLSAEEVAKALGIARVTARRYLDYLEKTGIIKLDVQYGGVGRPVNRY
FT                   VLKG"
FT   gene            500166..501431
FT                   /gene="dctP"
FT                   /locus_tag="BSU_04470"
FT                   /old_locus_tag="BSU04470"
FT   CDS_pept        500166..501431
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dctP"
FT                   /locus_tag="BSU_04470"
FT                   /old_locus_tag="BSU04470"
FT                   /product="C4-dicarboxylate transport protein"
FT                   /function="16.1: Circulate"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 10627041, 10708364, 12949159,
FT                   15849754, 16850406, 20363944, 22389480; Product type t:
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BSU04470"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12254"
FT                   /db_xref="GOA:P96603"
FT                   /db_xref="InterPro:IPR001991"
FT                   /db_xref="InterPro:IPR018107"
FT                   /db_xref="InterPro:IPR023954"
FT                   /db_xref="InterPro:IPR036458"
FT                   /db_xref="SubtiList:BG12075"
FT                   /db_xref="UniProtKB/Swiss-Prot:P96603"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:10627041, 10708364, 12949159, 15849754, 16850406,
FT                   20363944, 22389480"
FT                   /protein_id="CAB12254.1"
FT                   /translation="MKLFKNLTVQVITAVIIGVIVGLVWPDVGKEMKPLGDTFINAVKM
FT                   VIAPIIFFTIVLGIAKMGDMKKVGKVGGKAFIYFEVVTTLALIIGLFVVNIMKPGAGLD
FT                   YSKLEKGDVSQYTQNGGQGIDWIEFITHIVPSNMVDAFAKGDILQVLFFSILFGVGLAA
FT                   LGEKGKSVIDFFDKVSHVFFKIIGYIMRAAPIGAFGAMAYTIGHFGLDSIKPLASLMMS
FT                   VYITMFLFVFVALNIICKLYGFSLWNYLRFIKDELLIVLGTSSSESVLPRMMDKMERYG
FT                   CSKSVVGLVIPTGYSFNLDGTSIYLSMATVFLAQVFGVDLSIGQQITIILVLMLTSKGA
FT                   AGVTGSGFIVLASTLSALQVIPLEGLALLLGVDRFMSEGRAIVNLIGNGIATIIVAKSE
FT                   NEFDEAKSIEAVEGMKKMKTAV"
FT   gene            501579..502631
FT                   /gene="ydbI"
FT                   /locus_tag="BSU_04480"
FT                   /old_locus_tag="BSU04480"
FT   CDS_pept        501579..502631
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydbI"
FT                   /locus_tag="BSU_04480"
FT                   /old_locus_tag="BSU04480"
FT                   /product="putative integral inner membrane protein"
FT                   /note="Evidence 3: Putative function from multiple
FT                   computational evidences; PubMedId: 15849754, 16850406;
FT                   Product type m: membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:BSU04480"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12255"
FT                   /db_xref="GOA:P96604"
FT                   /db_xref="InterPro:IPR002549"
FT                   /db_xref="SubtiList:BG12076"
FT                   /db_xref="UniProtKB/Swiss-Prot:P96604"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB12255.1"
FT                   /translation="MAALVKFFQHPGVRRFSIFVVLTGVLYLFKSMINLILLTFIFTFL
FT                   MDRLELVVRQFVSQFFRVSQRVVITFLYMLLAVLLTVGGFVFYPVVAAQIQQLVKQIKH
FT                   IAYHPDSIPFFDEITSVFGDINISSYVKEGFNVVYTYLADISTFGLQVVMALILSMFFL
FT                   FEKKRLSEFMAKFKTSKLRVFYEEIAFFGSKFARTFGKVLEAQFIIALVNCILTFIALW
FT                   IMHFPQLFGLSIMVFFLGLIPVAGVVISLIPLSIIAYSTGGGMYVLYIVLVIFAIHAIE
FT                   TYFLNPKLMSAKTELPIFFTFTVLIFSEHFFGIWGLIIGIPIFVFLLDILDVTNKEDRS
FT                   KGPRENSDKK"
FT   gene            502908..503834
FT                   /gene="ydbJ"
FT                   /locus_tag="BSU_04490"
FT                   /old_locus_tag="BSU04490"
FT   CDS_pept        502908..503834
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydbJ"
FT                   /locus_tag="BSU_04490"
FT                   /old_locus_tag="BSU04490"
FT                   /product="putative ABC transporter (ATP-binding subunit)"
FT                   /function="16.1: Circulate"
FT                   /note="Evidence 3: Putative function from multiple
FT                   computational evidences; Product type t: transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BSU04490"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12256"
FT                   /db_xref="GOA:P96605"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="SubtiList:BG12077"
FT                   /db_xref="UniProtKB/Swiss-Prot:P96605"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB12256.1"
FT                   /translation="MAEPILHIEGLDKKIGSKQILKQISMDVMEGEIIGLLGPNGSGKT
FT                   TLIRIIVGLLKQNSGSVTISGFQHDTEFEKAMEAVGAIVENPEFYPYLTGWENLKHFAN
FT                   MHKKIADERLDEVVERVGLTSAIHDKVKTYSLGMRQRLGIAQAILHRPKLLILDEPTNG
FT                   LDPAGMKDFRDHIKELAEMEGTAVLFATHLLREVEDLCDRVIIIQKGEIKAEVSLQGTD
FT                   QTTEKAIIEVQPQEKALNWLTGNQYQAESQDGTIVVEVAKENIPELNRSLVGQDLNVFS
FT                   ITPYTQSLEDEFIKATTAHQEEGEELV"
FT   gene            503854..504594
FT                   /gene="ydbK"
FT                   /locus_tag="B