(data stored in SCRATCH zone)

EMBL: AL049171

ID   AL049171; SV 1; linear; genomic DNA; STD; PLN; 89904 BP.
XX
AC   AL049171;
XX
DT   13-MAR-1999 (Rel. 59, Created)
DT   14-NOV-2006 (Rel. 89, Last updated, Version 5)
XX
DE   Arabidopsis thaliana DNA chromosome 4, BAC clone  (ESSA project)
XX
KW   .
XX
OS   Arabidopsis thaliana (thale cress)
OC   Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
OC   Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae; Pentapetalae;
OC   rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis.
XX
RN   [1]
RA   Bevan M., Koetter P., Hempel S., Entian K.-D., Bancroft I., Mewes H.W.,
RA   Mayer K.F.X., Schueller C.;
RT   ;
RL   Unpublished.
XX
RN   [2]
RP   1-89904
RA   EU Arabidopsis sequencing project;
RT   ;
RL   Submitted (12-MAR-1999) to the INSDC.
RL   MIPS, at the Max-Planck-Institut fuer Biochemie, Am Klopferspitz 18a,
RL   D-82152 Martinsried, FRG, E-mail:
RL   schuelle@mips.biochem.mpg.de,mayer@mips.biochem.mpg.de Project Coordinator:
RL   Mike Bevan, Molecular Genetics Department, Cambridge Laboratory, John Innes
RL   Centre, Colney Lane, NR4 7UJ Norwich, UK, E-mail: michael.bevan@bbsrc.ac.uk
XX
DR   MD5; 83394ce5170e7ca6dc24ec17ec3ea7ac.
DR   GOA; F4JU70.
DR   InterPro; IPR002067; Mit_carrier.
DR   InterPro; IPR002167; Graves_DC.
DR   InterPro; IPR018108; Mitochondrial_sb/sol_carrier.
DR   InterPro; IPR023395; Mt_carrier_dom_sf.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00069; SNORD24.
DR   RFAM; RF00204; snoR12.
DR   UniProtKB/Swiss-Prot; F4JU70; COAC2_ARATH.
XX
CC   Information on performance of analysis and a more detailed annotation
CC   of this entry and other sequences of chromosome 4 can be viewed at:
CC   http://websvr.mips.biochem.mpg.de/proj/thal/
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..89904
FT                   /organism="Arabidopsis thaliana"
FT                   /chromosome="4"
FT                   /variety="Columbia"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:3702"
FT   misc_feature    1..11070
FT                   /note="overlap to BAC ; please refer to this entry for
FT                   analysis and annotation"
FT   gene            19417..21056
FT                   /gene="T25K17.10"
FT   CDS_pept        join(19417..19605,19706..20001,20198..21056)
FT                   /gene="T25K17.10"
FT                   /product="1-aminocyclopropane-1-carboxylate synthase-like
FT                   protein"
FT                   /EC_number="4.4.1.14"
FT                   /note="strong similarity to ACC synthase , Malus domestica,
FT                   U73816"
FT                   /note="Contains Aminotransferases class-I
FT                   pyridoxal-phosphate attachmentsite, Aa_Transfer_Class_1
FT                   [SLSKDLGLPGFRVG]"
FT                   /note="contains EST gb:N65643, AA650853, Z33841"
FT                   /db_xref="GOA:Q9STR4"
FT                   /db_xref="InterPro:IPR004838"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9STR4"
FT                   /protein_id="CAB38949.1"
FT                   /translation="MGLPLMMERSSNNNNVELSRVAVSDTHGEDSPYFAGWKAYDENPY
FT                   DESHNPSGVIQMGLAENQVSFDLLETYLEKKNPEGSMWGSKGAPGFRENALFQDYHGLK
FT                   TFRQAMASFMEQIRGGKARFDPDRIVLTAGATAANELLTFILADPNDALLVPTPYYPGF
FT                   DRDLRWRTGVKIVPIHCDSSNHFQITPEALESAYQTARDANIRVRGVLITNPSNPLGAT
FT                   VQKKVLEDLLDFCVRKNIHLVSDEIYSGSVFHASEFTSVAEIVENIDDVSVKERVHIVY
FT                   SLSKDLGLPGFRVGTIYSYNDNVVRTARRMSSFTLVSSQTQHMLASMLSDEEFTEKYIR
FT                   INRERLRRRYDTIVEGLKKAGIECLKGNAGLFCWMNLGFLLEKKTKDGELQLWDVILKE
FT                   LNLNISPGSSCHCSEVGWFRVCFANMSENTLEIALKRIHEFMDRRRRF"
FT   exon            19417..19605
FT                   /number=1
FT   intron          19606..19705
FT                   /number=1
FT   exon            19706..20001
FT                   /number=2
FT   intron          20002..20197
FT                   /number=2
FT   exon            20198..21056
FT                   /number=3
FT   gene            26480..27228
FT                   /gene="T25K17.20"
FT   CDS_pept        join(26480..26661,27042..27228)
FT                   /gene="T25K17.20"
FT                   /product="putative protein"
FT                   /note="strong similarity to predicted protein, Arabidopsis
FT                   thaliana, AC005169"
FT                   /db_xref="GOA:Q9STR3"
FT                   /db_xref="InterPro:IPR006808"
FT                   /db_xref="UniProtKB/TrEMBL:Q9STR3"
FT                   /protein_id="CAB38950.1"
FT                   /translation="MASKLLQLKSKACEASKFVSKHGTTYYKQLLDKNKMYIQEPATIE
FT                   KCNELSKQLLYTRLASIPGRSESFWKEVNHVKGLWKNRADLKVEDAGIAALFGLECFAW
FT                   YCAGEIVGRGFTFTGYYP"
FT   exon            26480..26661
FT                   /number=1
FT   intron          26662..27041
FT                   /number=1
FT   exon            27042..27228
FT                   /number=2
FT   gene            28289..29256
FT                   /gene="T25K17.30"
FT   CDS_pept        join(28289..28369,28417..28641,28748..28879,28966..29256)
FT                   /gene="T25K17.30"
FT                   /product="caffeoyl-CoA O-methyltransferase-like protein"
FT                   /note="strong similarity to caffeoyl-CoA
FT                   O-methyltransferase, Pinus taeda, AF036095"
FT                   /db_xref="GOA:Q9C5D7"
FT                   /db_xref="InterPro:IPR002935"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9C5D7"
FT                   /protein_id="CAB38951.1"
FT                   /translation="MAKDEAKGLLKSEELYKVCPYILISTLYILETSVYPREPEVLREL
FT                   RNITHNHPQAGMATAPDAGQLMGMLLNLVNARKTIEVGVFTGYSLLLTALTLPEDGKVI
FT                   AIDMNRDSYEIGLPVIKKAGVEHKIDFKESEALPALDELLNNKVNEGGFDFAFVDADKL
FT                   NYWNYHERLIRLIKVGGIIVYDNTLWGGSVAEPDSSTPEWRIEVKKATLELNKKLSADQ
FT                   RVQISQAALGDGITICRRLY"
FT   exon            28289..28369
FT                   /number=1
FT   intron          28370..28416
FT                   /number=1
FT   exon            28417..28641
FT                   /number=2
FT   intron          28642..28747
FT                   /number=2
FT   exon            28748..28879
FT                   /number=3
FT   intron          28880..28965
FT                   /number=3
FT   exon            28966..29256
FT                   /number=4
FT   tRNA            29533..29604
FT                   /note="Pro-tRNA_(TGG)"
FT   gene            30136..30663
FT                   /gene="T25K17.40"
FT   CDS_pept        join(30136..30215,30384..30663)
FT                   /gene="T25K17.40"
FT                   /product="putative ribosomal protein"
FT                   /note="strong similarity to ribosomal protein L31,
FT                   Nicotiana glutinosa, U23784"
FT                   /note="contains EST gb:H77007"
FT                   /db_xref="GOA:Q9STR1"
FT                   /db_xref="InterPro:IPR000054"
FT                   /db_xref="InterPro:IPR020052"
FT                   /db_xref="InterPro:IPR023621"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9STR1"
FT                   /protein_id="CAB38952.1"
FT                   /translation="MSEKKGRKEEVVTREYTINLHRRLHSCTFKKKAPKAIKEIRKFAE
FT                   KEMGTKDVRVDVKLNKQIWSKGIRGPPRRIRVRVARKRNDDEDAKEEFFSLVTVAEIPA
FT                   EGLSGLGTKIIEEED"
FT   exon            30136..30215
FT                   /number=1
FT   intron          30216..30383
FT                   /number=1
FT   exon            30384..30663
FT                   /number=2
FT   misc_feature    30910..31193
FT                   /note="EST AA586104 matches to position 30910-31193; no
FT                   obvious genmodel"
FT   gene            32558..33006
FT                   /gene="T25K17.50"
FT   CDS_pept        complement(join(<32558..32659,32745..32806,32898..33006))
FT                   /gene="T25K17.50"
FT                   /product="putative protein (fragment)"
FT                   /note="contains EST gb:F45349"
FT                   /db_xref="GOA:Q9STR0"
FT                   /db_xref="UniProtKB/TrEMBL:Q9STR0"
FT                   /protein_id="CAB38953.1"
FT                   /translation="MKKLARKWRRTRRDEDDDKFVLPTSEDVDSRPIDTQEQEEYVRYL
FT                   EEAHAQQSLQWRSVFVVLLICFGAFLFYSIFQQFMSPWELVLIISP"
FT   exon            complement(32558..32659)
FT                   /number=1
FT   intron          complement(32660..32744)
FT                   /number=1
FT   exon            complement(32745..32806)
FT                   /number=2
FT   intron          complement(32807..32897)
FT                   /number=2
FT   exon            complement(32898..33006)
FT                   /number=3
FT   gene            33751..35163
FT                   /gene="T25K17.60"
FT   CDS_pept        join(33751..34158,34325..34648,34729..34863,34945..35163)
FT                   /gene="T25K17.60"
FT                   /product="putative protein"
FT                   /note="strong similarity to WSI76 protein induced by water
FT                   stress, Oryzasativa, D26537"
FT                   /db_xref="GOA:Q8H1S1"
FT                   /db_xref="InterPro:IPR002495"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR030515"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8H1S1"
FT                   /protein_id="CAB38954.1"
FT                   /translation="MAQMSMTVEKSIKADVTVSHDRVKRAYVTFLAGNKDYWMGVVGLA
FT                   KGLRKVKSAYPLVVAILPDVPEEHRQILLAQGCIIREIEPVYPPENKTGYSMAYYVINY
FT                   SKLRIWEVKNFLTICLYLCLFIIRSHRLFFVNFVEYEKMIYLDGDIQVFSNIDHLFDTP
FT                   RGYLYAVKDCFCEISWSKTPQFKIGYCQQCPEKVTWPVESLGSPPPVYFNAGMLVFEPN
FT                   LLTYEDLLRVVQITTPTYFAEQDFLNEYFTDIYKPIPSTYNLVMAMLWRHPEHIDLDQI
FT                   SVIHYCANGSKPWRFDETEEHMDREDIKMLVKKWWDIYEDSSLDYKNFVETESKLSPIN
FT                   ATLASKESVGDVLISLAPSAA"
FT   exon            33751..34158
FT                   /number=1
FT   intron          34159..34324
FT                   /number=1
FT   exon            34325..34648
FT                   /number=2
FT   intron          34649..34728
FT                   /number=2
FT   exon            34729..34863
FT                   /number=3
FT   intron          34864..34944
FT                   /number=3
FT   exon            34945..35163
FT                   /number=4
FT   misc_feature    39092..39402
FT                   /note="EST N65756 matches to position 39092 - 39402; no
FT                   obvious genmodel"
FT   gene            42049..44256
FT                   /gene="T25K17.70"
FT   CDS_pept        join(42049..42079,42264..42408,42558..42639,42772..42976,
FT                   43084..43143,43234..43286,43452..43574,43685..43754,
FT                   43852..43930,44024..44105,44230..44256)
FT                   /gene="T25K17.70"
FT                   /product="putative protein"
FT                   /note="strong similarity to PRE87 mRNA, Pinus radiata,
FT                   AF049069"
FT                   /db_xref="GOA:Q8H1S0"
FT                   /db_xref="InterPro:IPR007828"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8H1S0"
FT                   /protein_id="CAB38955.1"
FT                   /translation="MTISVEKPIFEEEVSAFEKSGDNIGELKLDGGFSMPKMDTNDDEA
FT                   FLAPEMNAFGRQFRDYDVESERQKGVEEFYRLQHINQTVDFVKKMRAEYGKLDKMVMSI
FT                   WECCELLNEVVDESDPDLDEPQIQHLLQSAEAIRKDYPNEDWLHLTALIHDLGKVITLP
FT                   QFGGLPQWAVVGDTFPVGCAFDESNVHHKYFVENPDFHNETYNTKNGIYSEGCGLNNVM
FT                   MSWGHDDYMYLVAKENGSTLPSAGQFIIRYHSFYPLHTAGEYTHLMNEEDKENLKWLHV
FT                   FNKYDLYSKSKVHVDVEKVKPYYMSLIKKYFPENLRW"
FT   exon            42049..42079
FT                   /number=1
FT   intron          42080..42263
FT                   /number=1
FT   exon            42264..42408
FT                   /number=2
FT   intron          42409..42557
FT                   /number=2
FT   exon            42558..42639
FT                   /number=3
FT   intron          42640..42771
FT                   /number=3
FT   exon            42772..42976
FT                   /number=4
FT   intron          42977..43083
FT                   /number=4
FT   exon            43084..43143
FT                   /number=5
FT   intron          43144..43233
FT                   /number=5
FT   exon            43234..43286
FT                   /number=6
FT   intron          43287..43451
FT                   /number=6
FT   exon            43452..43574
FT                   /number=7
FT   intron          43575..43684
FT                   /number=7
FT   exon            43685..43754
FT                   /number=8
FT   intron          43755..43851
FT                   /number=8
FT   exon            43852..43930
FT                   /number=9
FT   intron          43931..44023
FT                   /number=9
FT   exon            44024..44105
FT                   /number=10
FT   intron          44106..44229
FT                   /number=10
FT   exon            44230..44256
FT                   /number=11
FT   gene            45204..47695
FT                   /gene="T25K17.80"
FT   CDS_pept        complement(join(45204..45404,45609..45763,45842..45887,
FT                   45985..46250,46336..46465,46556..46624,46695..46748,
FT                   46837..46995,47038..47220,47301..47363,47460..47499,
FT                   47559..47695))
FT                   /gene="T25K17.80"
FT                   /product="pyrophosphate-dependent phosphofructo-1-kinase"
FT                   /note="strong similarity to pyrophosphate-dependent
FT                   phosphofructo-1-kinase, Prunus armeniaca, U93272"
FT                   /db_xref="GOA:Q94AA4"
FT                   /db_xref="InterPro:IPR000023"
FT                   /db_xref="InterPro:IPR012004"
FT                   /db_xref="InterPro:IPR022953"
FT                   /db_xref="InterPro:IPR035966"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q94AA4"
FT                   /protein_id="CAB38956.1"
FT                   /translation="MVNFLLVLCYCRLILIHCKTIQLTQWLSKSFLTDVLVTKVPNCVL
FT                   WQYFVDADDSVPQKIVVHKDGPRGIHFRRAGPRQKVYFESDEVHACIVTCGGLCPGLNT
FT                   VIREIVSSLSYMYGVKRILGIDVSFCDCNLLLTKTNTGGYRGFYAKNTVSLDSKVVNDI
FT                   HKRGGTILGTSRGGHDTTKIVDSIQDRGINQVYIIGGDGTQRGASVIFEEIRRRGLKVA
FT                   VIGIPKTIDNDIPVIDKSFGFDTAVEEAQRAINAAHVEAESIENGIGVVKLMGRYSGFI
FT                   AMYATLASRDVDCCLIPESPFYLEGEGGLFEYIEKRLKESGHMVLVIAEGAGQDLMSKS
FT                   MESMTLKDASGNKLLKDVGLWLSQSIKDHFNQKKMVMNLKYIDPTYMIRAVPSNASDNV
FT                   YCTLLAQSAVHGAMAGYTGYISGLVNGRQTYIPFYRITEKQNHVVITDRMWARLLSSTN
FT                   QPSFLGPKDVFDNKEKPMSALLDDGNCNGVVDVPPVTKEITK"
FT   exon            complement(45204..45404)
FT                   /number=1
FT   intron          complement(45405..45608)
FT                   /number=1
FT   exon            complement(45609..45763)
FT                   /number=2
FT   intron          complement(45764..45841)
FT                   /number=2
FT   exon            complement(45842..45887)
FT                   /number=3
FT   intron          complement(45888..45984)
FT                   /number=3
FT   exon            complement(45985..46250)
FT                   /number=4
FT   intron          complement(46251..46335)
FT                   /number=4
FT   exon            complement(46336..46465)
FT                   /number=5
FT   intron          complement(46466..46555)
FT                   /number=5
FT   exon            complement(46556..46624)
FT                   /number=6
FT   intron          complement(46625..46694)
FT                   /number=6
FT   exon            complement(46695..46748)
FT                   /number=7
FT   intron          complement(46749..46836)
FT                   /number=7
FT   exon            complement(46837..46995)
FT                   /number=8
FT   intron          complement(46996..47037)
FT                   /number=8
FT   exon            complement(47038..47220)
FT                   /number=9
FT   intron          complement(47221..47300)
FT                   /number=9
FT   exon            complement(47301..47363)
FT                   /number=10
FT   intron          complement(47364..47459)
FT                   /number=10
FT   exon            complement(47460..47499)
FT                   /number=11
FT   intron          complement(47500..47558)
FT                   /number=11
FT   exon            complement(47559..47695)
FT                   /number=12
FT   gene            48831..49832
FT                   /gene="T25K17.90"
FT   CDS_pept        complement(join(48831..49448,49506..49832))
FT                   /gene="T25K17.90"
FT                   /product="steroid sulfotransferase-like protein"
FT                   /note="similarity to steroid sulfotransferase, Brassica
FT                   napus, AF000307"
FT                   /db_xref="GOA:Q9STQ6"
FT                   /db_xref="InterPro:IPR000863"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9STQ6"
FT                   /protein_id="CAB38957.1"
FT                   /translation="MEKWMNLRDEDLTEETKTLISSLSSEKGYLGRNLCKYQGSWYYYN
FT                   FLQGVLNFQRGFKPQDTDIIVASYPKSGTLWLKALTVALFERTKNPSHDDPMSHPLLSN
FT                   NPHNLLSSSSPRLFSTHTPFHTLQVAVKDSPCKVVYICRDAKDSLVSRWHIVCRSLNKE
FT                   EDRTILESMFESFCSGVCLFGPFWDHILSYWKASLEKPKQVLFMRYDEIKTDPHGQLKK
FT                   LAEFLGCPFSKEEEKNGSLNKILEMCSLPNLSSLEVNKTGKSINGIEYKNHFRKGIVGD
FT                   WKNHLTPEMGSKIDMIMKEKLKDYSEVWFENAL"
FT   exon            complement(48831..49448)
FT                   /number=1
FT   intron          complement(49449..49505)
FT                   /number=1
FT   exon            complement(49506..49832)
FT                   /number=2
FT   gene            51705..51932
FT                   /gene="T25K17.100"
FT   CDS_pept        complement(51705..51932)
FT                   /gene="T25K17.100"
FT                   /product="hypothetical protein"
FT                   /db_xref="GOA:Q9STQ5"
FT                   /db_xref="UniProtKB/TrEMBL:Q9STQ5"
FT                   /protein_id="CAB38958.1"
FT                   /translation="MRSERSSKGPFEEEEEEEEEEEASSVKSDEHIEIEDEDETFAEDP
FT                   ETPITPSSSFVVEIRLPSRMFISSSFVNYV"
FT   exon            complement(51705..51932)
FT                   /number=1
FT   gene            52510..57219
FT                   /gene="T25K17.110"
FT   CDS_pept        complement(join(52510..52620,52734..52832,52927..52995,
FT                   53381..53470,53552..53621,53804..53873,53979..54165,
FT                   54269..54353,54524..54702,54803..54907,55021..55104,
FT                   55234..55314,55422..55637,55727..55828,55907..55982,
FT                   56080..56219,56306..56380,57130..57219))
FT                   /gene="T25K17.110"
FT                   /product="arginyl-tRNA synthetase"
FT                   /EC_number="6.1.1.19"
FT                   /note="Contains Aminoacyl-transfer RNA synthetases class-I
FT                   signature, Aa_Trna_Ligase_I [PNIAKEMHVGHL"
FT                   /note="contains EST gb:AA404880, T76307"
FT                   /db_xref="GOA:O23247"
FT                   /db_xref="InterPro:IPR001278"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR005148"
FT                   /db_xref="InterPro:IPR008909"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR035684"
FT                   /db_xref="InterPro:IPR036695"
FT                   /db_xref="UniProtKB/Swiss-Prot:O23247"
FT                   /protein_id="CAB38959.1"
FT                   /translation="MFIFPKDENRRETLTTKLRFSADHLTFTTVTEKLRATAWRFAFSS
FT                   RAKSVVAMAANEEFTGNLKRQLAKLFDVSLKLTVPDEPSVEPLVAASALGKFGDYQCNN
FT                   AMGLWSIIKGKGTQFKGPPAVGQALVKSLPTSEMVESCSVAGPGFINVVLSAKWMAKSI
FT                   ENMLIDGVDTWAPTLSVKRAVVDFSSPNIAKEMHVGHLRSTIIGDTLARMLEYSHVEVL
FT                   RRNHVGDWGTQFGMLIEYLFEKFPDTDSVTETAIGDLQVFYKASKHKFDLDEAFKEKAQ
FT                   QAVVRLQGGDPVYRKAWAKICDISRTEFAKVYQRLRVELEEKGESFYNPHIAKVIEELN
FT                   SKGLVEESEGARVIFLEGFDIPLMVVKSDGGFNYASTDLTALWYRLNEEKAEWIIYVTD
FT                   VGQQQHFNMFFKAARKAGWLPDNDKTYPRVNHVGFGLVLGEDGKRFRTRATDVVRLVDL
FT                   LDEAKTRSKLALIERGKDKEWTPEELDQTAEAVGYGAVKYADLKNNRLTNYTFSFDQML
FT                   NDKGNTAVYLLYAHARICSIIRKSGKDIDELKKTGKLALDHADERALGLHLLRFAETVE
FT                   EACTNLLPSVLCEYLYNLSEHFTRFYSNCQVNGSPEETSRLLLCEATAIVMRKCFHLLG
FT                   ITPVYKI"
FT   exon            complement(52510..52620)
FT                   /number=1
FT   intron          complement(52621..52733)
FT                   /number=1
FT   exon            complement(52734..52832)
FT                   /number=2
FT   intron          complement(52833..52926)
FT                   /number=2
FT   exon            complement(52927..52995)
FT                   /number=3
FT   intron          complement(52996..53380)
FT                   /number=3
FT   exon            complement(53381..53470)
FT                   /number=4
FT   intron          complement(53471..53551)
FT                   /number=4
FT   exon            complement(53552..53621)
FT                   /number=5
FT   intron          complement(53622..53803)
FT                   /number=5
FT   exon            complement(53804..53873)
FT                   /number=6
FT   intron          complement(53874..53978)
FT                   /number=6
FT   exon            complement(53979..54165)
FT                   /number=7
FT   intron          complement(54166..54268)
FT                   /number=7
FT   exon            complement(54269..54353)
FT                   /number=8
FT   intron          complement(54354..54523)
FT                   /number=8
FT   exon            complement(54524..54702)
FT                   /number=9
FT   intron          complement(54703..54802)
FT                   /number=9
FT   exon            complement(54803..54907)
FT                   /number=10
FT   intron          complement(54908..55020)
FT                   /number=10
FT   exon            complement(55021..55104)
FT                   /number=11
FT   intron          complement(55105..55233)
FT                   /number=11
FT   exon            complement(55234..55314)
FT                   /number=12
FT   intron          complement(55315..55421)
FT                   /number=12
FT   exon            complement(55422..55637)
FT                   /number=13
FT   intron          complement(55638..55726)
FT                   /number=13
FT   exon            complement(55727..55828)
FT                   /number=14
FT   intron          complement(55829..55906)
FT                   /number=14
FT   exon            complement(55907..55982)
FT                   /number=15
FT   intron          complement(55983..56079)
FT                   /number=15
FT   exon            complement(56080..56219)
FT                   /number=16
FT   intron          complement(56220..56305)
FT                   /number=16
FT   exon            complement(56306..56380)
FT                   /number=17
FT   intron          complement(56381..57129)
FT                   /number=17
FT   exon            complement(57130..57219)
FT                   /number=18
FT   gene            58216..60176
FT                   /gene="T25K17.120"
FT   CDS_pept        complement(join(58216..58293,58419..58458,58636..58759,
FT                   59344..59413,59530..59580,59673..59686,59775..59805,
FT                   59946..60176))
FT                   /gene="T25K17.120"
FT                   /product="putative protein"
FT                   /note="similarity to elongation factor P (efp) RP238,
FT                   Rickettsia prowazekii, PIR2:B71678"
FT                   /note="Contains Elongation factor P signature
FT                   [KRALLDNGSTIQVPSYLEAG]"
FT                   /note="contains EST gb:F20046"
FT                   /db_xref="GOA:Q9STQ4"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013185"
FT                   /db_xref="InterPro:IPR013852"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR015365"
FT                   /db_xref="InterPro:IPR020599"
FT                   /db_xref="UniProtKB/TrEMBL:Q9STQ4"
FT                   /protein_id="CAB38960.1"
FT                   /translation="MRGLHHFKRISISRSLFSFSNATSPGAVTTRRSLYSLSRSLLSST
FT                   PYAAGGCCRETPPLHSPWSALQRRGVKVNAIQLRAGNVIERTGRTFRVVEAEHKQQGRG
FT                   GASIQVELRDVDTGNKLNLRFGSEESVEKEMKVQLQLYDGRALSASIPKHITCTVVETQ
FT                   LPMKGLTSAPRYKRALLDNGSTIQVPSYLEAGEKIVINTEDDSFVKRYY"
FT   exon            complement(58216..58293)
FT                   /number=1
FT   intron          complement(58294..58418)
FT                   /number=1
FT   exon            complement(58419..58458)
FT                   /number=2
FT   intron          complement(58459..58635)
FT                   /number=2
FT   exon            complement(58636..58759)
FT                   /number=3
FT   intron          complement(58760..59343)
FT                   /number=3
FT   exon            complement(59344..59413)
FT                   /number=4
FT   intron          complement(59414..59529)
FT                   /number=4
FT   exon            complement(59530..59580)
FT                   /number=5
FT   intron          complement(59581..59672)
FT                   /number=5
FT   exon            complement(59673..59686)
FT                   /number=6
FT   intron          complement(59687..59774)
FT                   /number=6
FT   exon            complement(59775..59805)
FT                   /number=7
FT   intron          complement(59806..59945)
FT                   /number=7
FT   exon            complement(59946..60176)
FT                   /number=8
FT   gene            61345..61524
FT                   /gene="T25K17.130"
FT   CDS_pept        complement(61345..61524)
FT                   /gene="T25K17.130"
FT                   /product="putative protein"
FT                   /note="contains EST gb:T44583"
FT                   /db_xref="GOA:Q9STQ3"
FT                   /db_xref="InterPro:IPR039281"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9STQ3"
FT                   /protein_id="CAB38961.1"
FT                   /translation="MEAMKMRLFVAVLVAAMAFSAVQQAAAVEAPAPSPTSDASLAIPA
FT                   FFASVATLAFGFLF"
FT   exon            complement(61345..61524)
FT                   /number=1
FT   gene            64518..67571
FT                   /gene="T25K17.140"
FT   CDS_pept        join(64518..64653,64840..65005,65049..65757,65862..65929,
FT                   66067..66315,66416..66530,66692..66905,66988..67571)
FT                   /gene="T25K17.140"
FT                   /product="subtilisin protease-like"
FT                   /note="strong similarity to subtilisin-like protease,
FT                   Arabidopsis thaliana, AF055848"
FT                   /note="Contains Serine proteases, subtilase family, active
FT                   sites [GTSMSCPHVAG]"
FT                   /db_xref="GOA:Q9STQ2"
FT                   /db_xref="InterPro:IPR000209"
FT                   /db_xref="InterPro:IPR010259"
FT                   /db_xref="InterPro:IPR015500"
FT                   /db_xref="InterPro:IPR023828"
FT                   /db_xref="InterPro:IPR034197"
FT                   /db_xref="InterPro:IPR036852"
FT                   /db_xref="InterPro:IPR037045"
FT                   /db_xref="InterPro:IPR041469"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9STQ2"
FT                   /protein_id="CAB38962.1"
FT                   /translation="MISSMNFWRCRCSKDDAEQSMLYSYNNGFLGFSAKLNSTQAASLA
FT                   KLNQVITVFKSKSLKLHTTRSWDFLGLAVDNARRTPPPQLAYGSDIVVGIFDTGLFISL
FT                   KLLLLSILGIWPESESFRETPEAKPIPSSWNGKCVGGEDFDPSVHCNRKLIGARFYLRG
FT                   FEETYGTIDFTRDPEYRSPRDYLGHGTHTASTAVGSVVRNVSGFFGLGRGTARGGAPLA
FT                   RLAVFKTCWGKDLEGVCTEADILAAFDDAIHDGVHVISASFGYSPPLSPFFESSADIGA
FT                   FHAAERGISVVFSTGNDGPDPGVVQNVAPWAVSVAASTVDRSFPTRIVIDGSFTLTGQS
FT                   LISQEITGTLALATTYFNGGVCKWENWMKKLANETIILCFSTLGPVQFIEEAQAAAIRA
FT                   NALALIFAASPTRQLAEEVDMIPTVRVDILHGTRIRNYLARSPTVPMVKIGPSKTVIGE
FT                   TTAPSVAYFSSRGPSSLSPDILKPDITAPGIGILAAWPPRTPPTLLPGDHRSIEWNFQS
FT                   GTSMSCPHVAGVMALLQSAHPDWSPSAIRSAIMTTAYTRDTSYDLILSGGSMKSTDPFD
FT                   IGAGHINPLKAMDPGLVYNTRTDDYVLFMCNIGYTDQEIKSMVLHPEPSTTCLPSHSYR
FT                   TNADFNYPSITIPSLRLTRTIKRTVSNVGPNKNTVYFVDIIRPVGVEVLIWPRILVFSK
FT                   CQQEHSYYVTFKPTEIFSGRYVFGEIMWTNGLHRVRSPVVVFLSNAGFLASS"
FT   exon            64518..64653
FT                   /number=1
FT   intron          64654..64839
FT                   /number=1
FT   exon            64840..65005
FT                   /number=2
FT   intron          65006..65048
FT                   /number=2
FT   exon            65049..65757
FT                   /number=3
FT   intron          65758..65861
FT                   /number=3
FT   exon            65862..65929
FT                   /number=4
FT   intron          65930..66066
FT                   /number=4
FT   exon            66067..66315
FT                   /number=5
FT   intron          66316..66415
FT                   /number=5
FT   exon            66416..66530
FT                   /number=6
FT   intron          66531..66691
FT                   /number=6
FT   exon            66692..66905
FT                   /number=7
FT   intron          66906..66987
FT                   /number=7
FT   exon            66988..67571
FT                   /number=8
FT   gene            68240..69669
FT                   /gene="T25K17.150"
FT   CDS_pept        join(68240..69076,69382..69669)
FT                   /gene="T25K17.150"
FT                   /product="putative protein"
FT                   /note="similarity to various predicted proteins,
FT                   Arabidopsis thaliana"
FT                   /db_xref="GOA:Q8H1R7"
FT                   /db_xref="InterPro:IPR001810"
FT                   /db_xref="InterPro:IPR006566"
FT                   /db_xref="InterPro:IPR013101"
FT                   /db_xref="InterPro:IPR032675"
FT                   /db_xref="InterPro:IPR036047"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8H1R7"
FT                   /protein_id="CAB38963.1"
FT                   /translation="MDRISQLSDDLLLQILSFIPGKDVVATSLLSKRWQSLWMLVSELE
FT                   YDDSYHTGDYKSFSQFVYRSLLSNNAPVIKHLHLNLGPDCPAIDIGLWIGFALTRRLRQ
FT                   LKINIRTSSNDASFSLPSSLYTSDTLETLRLINFVLLDVPSSVCLPSLKVLHLKTVDYE
FT                   DDASLPSLLFGCPNLEELFVERHDQDLEMDVTFVVPSLRRLSMIDKNYGQCDRYVIDVP
FT                   SLKYLNITDDAVYDVRQIENMPELVEAHVDITQGVTHKFLRALTSVRQLSLCLSLSEKQ
FT                   HESGLCGIETPIGWKLPSSVPECLLFSLEAFEWIGYKGRRGDREVATYVLKNAACLRTA
FT                   KFSPESTDVGEKYHMLKELASVPTASTSSKLLFD"
FT   exon            68240..69076
FT                   /number=1
FT   intron          69077..69381
FT                   /number=1
FT   exon            69382..69669
FT                   /number=2
FT   gene            70963..72425
FT                   /gene="T25K17.160"
FT   CDS_pept        join(70963..71829,71909..72043,72132..72425)
FT                   /gene="T25K17.160"
FT                   /product="putative protein"
FT                   /note="similarity to various predicted proteins,
FT                   Arabidopsis thaliana"
FT                   /db_xref="GOA:Q9STQ0"
FT                   /db_xref="InterPro:IPR001810"
FT                   /db_xref="InterPro:IPR006566"
FT                   /db_xref="InterPro:IPR013101"
FT                   /db_xref="InterPro:IPR036047"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9STQ0"
FT                   /protein_id="CAB38964.1"
FT                   /translation="MDIISQCPDHLLLRILSFIPTKDVIVTSLLSKRWGSLWRWVPKLE
FT                   YDFTRQNMRFVKFVYRSLLQNNAPVLESLHLKNIILYAECRTVDIGGWIDIAVSRRVRE
FT                   LEISINCSDEKFRLPSSLYTCGTLESFILTIKHCHLVDVPLAVCLPSLKKLHLRCIGWA
FT                   YNATLLRLISGCTNLEELRLARPDDDGDYIMIHEAGSTIDYMSIFERRYMFEFMFDQMF
FT                   GKGSSNGINAPLKYFSISNNYRIHNFRGIEKMPDWVEARIAVTGGSHKYLKEITYAKGL
FT                   YVCLSVSEVMNPYDMIFHMLVDLTICTCTQGWWDLLTHMLQGSPKLRFLTLTNDHCREL
FT                   PSLETPACWKRPSSVPACLLSSLQAFTWSGYKGRQGDKEVVKYVLRNATGLKKRIFISK
FT                   SNDFGEKFCMLQELASVPTPSPSCQLLFDRIF"
FT   exon            70963..71829
FT                   /number=1
FT   intron          71830..71908
FT                   /number=1
FT   exon            71909..72043
FT                   /number=2
FT   intron          72044..72131
FT                   /number=2
FT   exon            72132..72425
FT                   /number=3
FT   misc_feature    72663..89904
FT                   /note="overlap to BAC M3E9, EMBL accession AL022223 ;
FT                   please refer to this entry for analysis and annotation"
XX
SQ   Sequence 89904 BP; 28688 A; 16570 C; 16097 G; 28549 T; 0 other;
     aagcgttagc tgctgaaacc gaacagccaa aatggtggga gaggaaagca gggccaaaca        60
     tgattgacat tacctcagct gagcagtttc tcaacgcgtt aaaagatgcg ggagatagat       120
     tagttatcgt agatttttac ggaacttggt gtggttcttg ccgtgcaatg ttcccaaagg       180
     taactttccc gttagctact taacgattgt atctcttcgt gtatactcga tcatctctca       240
     tttcattcag ttcgcgagtc ttgaaccatt atgtttctta agcttgctca aattatcggc       300
     ttgcttattc taaagctgag actcttttct tattcttttc cagctctgca aaacggcgaa       360
     agaacaccct aacatcttgt tccttaaagt aaactttgac gagaacaagt ctctctgcaa       420
     aagcttaaac gtcaaggtgt taccgtattt ccacttctac cgcggtgctg atggccaagt       480
     cgaatccttc tcatgctctc ttgccaaggt tagttcttct tgtcccagct ttctttaatt       540
     tcaaacgtca cttgtctatc acgaaaccag agaatagtta ctgcattgta tagtcttgat       600
     ggcgacctct aagtctaata agcgtctgca aacatttatg cagttccaga aactgagaga       660
     ggcgatagag agacacaatg taggaagtat cagtaacatc tcttcttcag cttctgagaa       720
     agttgaagat tcaagtgaat aatcaatgcc tggttcagat tgatcacaga ttattttgtt       780
     aaatcgcttc cctgtatata tgttgactgc attttccatg tggtgcatca taatttttgt       840
     acataaataa atgagtctga cttcgagttc atcgcctatc aagtatcagc ttccctaaac       900
     cgagtaaaac cgggaagtgt tgggtttcaa aattaacttg gtgagttaac agttaacaca       960
     cacatccacc gtttttagat agataagagg atgccctaat aaaaccactg ctttgtcttg      1020
     ggtaagaaga aacgttaaca tgttagttgt cctacaaatt cattcatcta taaacgttaa      1080
     agtctgtatt aacgaatgaa agtaatcaaa agctacatat ttattacaca aacaaaaatg      1140
     catcagttgc atctcgtcta agaaagcatt ttttcttcac tcgaagaaaa ataacaagaa      1200
     gttgaagcct taggctcacg agccaactcc tttaacatgt cgagtttcta atccgagtaa      1260
     aggatttgta tttcgtcgag aaagttgccg cttcttcaaa tgtttggcat ttgttaagtt      1320
     gcaacttgtc tctcttcttc acgttgtcca ttgtatcctt cccactggaa tctttgtagg      1380
     tggaataaca aacaaggagg aacagaaatc ggtttgctaa ttggcgggtt aatagttttg      1440
     taaaatggta gattaaacat gcgctctatc ctgtaacatt tctgagcttg agaacttgta      1500
     gttgaggaga attcagtagc aaattcgtta gtagcttcca ccgctcgttt ttcctagtat      1560
     tgtagctcca aatgtacatc attaatagat catataaaag aaaattataa tttcaaaaaa      1620
     ggctcaagtt gaagtatcca acggtggtca atttaagact ataccaacgc ctgtacttca      1680
     aaagtttctg caagtattca ttagcagtga cgaattcaaa tttgaaaaaa aaaactttta      1740
     tctgtaaatt ctccatcctt aacggtcaaa tttagtcggg cagcagacaa actctcaagt      1800
     ccgatcagga aacgaaacga gaacaaaaga aaagagattg gattttggtg acggcgtttc      1860
     cttcgccgtc gtgttcacca tgttcaagag agacgactac attcgaacta atcatgaccc      1920
     ctttttttca aagtggcagg tactctcgca tttcaagaaa tttagagatt ctgggtttag      1980
     ggttttgctc catctttcat tccgttgaaa accctttcga gatcaacaga atttcgaatg      2040
     aattctcttg gaaatatctg caatttttat ttaaagatct aacttttaac gcctaccaca      2100
     cttttcttca acgtttcttt gttggatctc tggagattct gagtaattcc attgatgatt      2160
     cttgggtttc tttcagggtt tcgcccgatc tatgtttctg cgtaaaccca tttcagaaac      2220
     tgcagaattc gcaagacttt tgcggactac tccttaattt ctcgagattt aggtccaaag      2280
     ccaaaggtca catttttaat ctctcttcat cacattgtaa cttgtatctt tgttggataa      2340
     ctaggtggct tagtctcatg tttgtcatca atataagctc tttatcttac gtaatgaagt      2400
     tggaaaacac acatttttaa atgtcaaact tattacactt gaaaacagat tctgatagga      2460
     gccaacgaga aggaaaattt cagagaaggg aaagatcttg ttggtagaaa cagagtccaa      2520
     ggagccttcc agggtctgta tgagctcagt catgaccatg gcagaaaaga tgatgttctt      2580
     gtggctaatc ttggtcaacc tgaaagcatt agatcccggc tccggtctta tagtagatct      2640
     tttgctcatc atgacttgct taagcagggt ttgtctcaaa ctattcttcc tactactcag      2700
     aacaaaagtg acaaccaaac cgaagagaag aagtctgatt ctgaagaaga gagagaggtc      2760
     agttctgatg ctgctgagaa ggagagtaat tcgcttccat ctatacttag actcagtcgg      2820
     tctagacctc aaccggtttc agagaaacat gatgacatag ttgatgagtc tgattctgct      2880
     tctgcttgtg gagtcttact agaagatggt actacttgca ctacaactcc agtcaaagga      2940
     agaaagagat gcacagagca taaagggaag agactttctc gtgtttcccc cgggatccac      3000
     ataccgtgtg aagttcctac cgtaagagaa tgtgaagaaa ctgagaatat atgtggagtg      3060
     attttacctg acatgatacg ttgcagaagt aaacctgttt caaggagaaa acgatgcgag      3120
     gatcacaagg gaatgagagt taacgccttc ttttttctgc tgaacccaac agaacgtgat      3180
     aaagccgtca atgaggacaa atccaaacct gagacaagta caggcatgaa ccaagagggt      3240
     tcgggtcttt tatgtgaagc tacaacaaag aatggattgc cttgtacaag aagtgctcct      3300
     gagggcagca aaagatgttg gcagcacaaa gataaaacat tgaaccacgg atcatctgaa      3360
     aatgttcagt cagcaactgc aagtcaagta atttgtggct ttaagctgta caatggatca      3420
     gtatgcgaga aatctccagt gaaaggaagg aagagatgtg aggagcacaa ggggatgaga      3480
     atcacatctt gaattcaaag cagtggagta taactccttt tgtaactacc taaccaaaat      3540
     gttatgtatc gagccggttt ggtattggta aaatctgttg atttgccgta tcataccttt      3600
     aactctagat aataaggttg tatgaattaa ctaagtaggt gcaatttaat cgaaccgaat      3660
     atgcatttct gtaagaagca gcttcgatgt tctccatcaa tgtcttgtct ctgtaataaa      3720
     ttttgttgct atctgccata atgtagaaaa caagctcact actcgtatgt gtagttgttc      3780
     agcctatcaa cttctgtctt ctttctcatc aactttcaac attgatacac atttgtttta      3840
     agtaagcatc actctagaac ttaatggacc tccttcttgt tttttgccac atctgctttt      3900
     gtctactagt tctgttgtgt tgcctttgac acttgaaaat catctgcaga accattctaa      3960
     gtcatagcaa tctgaggggt cctgttactt taaggtcctg aacagaaata gtatgatgtg      4020
     tatgcattgt ttcaacctgc aagatagaac tgggaaaatt tcttctgcaa tttgtctttt      4080
     tgagttaaga aaccgatgag catgataaat attttgaaat cctgagaatc aacaatctgt      4140
     gtctcagtat ttcgtaaggt aagatacatt ggaaagtatt caacaaaaac gtataagcaa      4200
     ttatgtgttt acatagagag gtcctagagt tttcaattgg gattctgaca ctgtttatat      4260
     ggaggagtgt tagcttcagt ttcctctacc aaaaaatgga atgtacaatc tagtataata      4320
     atatgtggtt ttaaacacca caaagaatca gatcatatgg ttgatcttag tattaggtga      4380
     aaactttcct ttttcgtgtc gtcacagctt ctgcctcagg ttcctctcga ggcgggactc      4440
     ttaagtgcag cttcataata tcatacactg tgaatccgat tgccacagac ggtacaacct      4500
     aaagaaaccc gaaaggaaaa gtgtttgtaa cttggttgtt cattgtccga aaacaaagat      4560
     agatcgatga aactagtctc aaaccttaag gtaattgatg ctaagccctg agaagagttg      4620
     cttccaacct tcttctcttg caatcttgaa aagggtttgc attgttcctc ttcttgtttc      4680
     ttccttaacg gctgaatata gtctctcaac ctgcagggag tttcggttat aatactactc      4740
     aggatcattt tatgaagatt caaggatgtc ttcgattcga tagaagaaga accagatcaa      4800
     acctgcattt gtctccggac aacatcgaga gggtatgtta aagtctgacc aagcaatcca      4860
     gcgactgacc cacaaacgag tttcagggaa atgtcttgct tatgttccgg agggacatga      4920
     cgtttcatct cctcgtagaa gtagaacttc aaaccagcat aagggaagat cccatagaga      4980
     gaaggagctg atacacaagc aaccaaagaa agatcaattt tttattgagt cttagagaag      5040
     gagaagatct ataacaaatc caaagaaatg gttagtaatg tacctacacc acgatatagg      5100
     cctcgggctc cagattctct gtatgtcctc gagaaacaat ctacaattcc tctgtatatg      5160
     atttgttcca cgggaatagc ttttacttgc gtctttgctg aaccaacaac ctgcactgct      5220
     gaactctcta tgagcctact aattatgtat tatctcgaga tgagacataa aaacacaaga      5280
     tctgaagcag cttacctgat aagcgagctt agtccggacc aggtcaagag gataggtgaa      5340
     gagaaccgca gtaccaccag caaatgatcc agctacgaga tcaagcaatg ggcctcgagt      5400
     agtgtctggg aaaccaaaga taatccatct cctgtattcc tcataagcca tgtaatgaag      5460
     agctgcatag ggaactatcc gagcaacact tgcaccattc cctctgttca caaaccaaaa      5520
     cgaaagttac agaatcatct gactgaacta gatcccaaaa cgcatctaac actaaagaca      5580
     aacgtacctg tagaaaccca tcaaaccttc agttttgcca atcttgttga ttgatccaac      5640
     aagtcctatc cttttaaact catcccttct ggtctgacaa aagatcaata catgatcatg      5700
     agcttctata atccagcaat tgtgtaacca attcagaata caaacactaa aagctttcta      5760
     atttcgatgc ttgaatttga gtacatgact cagagtcaga ggacaaatca atcttagttc      5820
     tggtaatcta gaatcaatac ccataatgat tgttggtacc tggaaaagaa tcttaattcg      5880
     ctcgagtgga gcaacggcgg ttttagctat accacccgtg acgccgccgg caataagctc      5940
     cttagcgaat aaaggaatcg aatcaataat tccgttcttc tcttcaccct ccgccatgga      6000
     aatagaagtg gagagagaaa agatagatac ggtttaatgg atcttcttct tctcctttta      6060
     ccaatctttg tacagttgaa gctgaagctc aatgaaggaa gaagaagaag aagatattaa      6120
     aattgagaga gcgaaaaaac gaattgttct tttgtgatca atcaaaagac ttggtttctg      6180
     tctgattctc accttctcct ccaagttatg caaatattat tctccattaa ttagtggaag      6240
     ttaattaatt agtatgattt taattttaat ttctgctttc gctttatttt atttgtcttg      6300
     aagattcgaa gttaggttcc tttttaaatg tgacgattag actctgaatt gataatgtat      6360
     ttttgaacga gtaaacaatc aacgacaaat tacaaatctg aatctaaaaa tgtatcgacg      6420
     ctggtctctt cgaaacacga gatacaatat caattaagat gtaaagtgag ctgaattaca      6480
     cttccaacag gaacttcatc tgtgtgtgca tcaacacttg cttgttgtga gctctagaga      6540
     gtcgacagca tttacataac agtaaaaact cctgttgagg aattacttat gtgcttcgac      6600
     ggccttagag taaaactccc atgactcgtg tgtctcagtt atggcagttt gaccgaatgg      6660
     attctccgct acaaacttct gaacgttctc cgcatccgct aatctttcta gatacttcct      6720
     tagctcaccc tcaggccctg tctcaagaaa taaaacatca gtgtgctatt atgcttacca      6780
     ttttattgaa agagaatgat gagtgattta agactaaccc aatgcagaat cttgacggtt      6840
     tgtgtactgg tacgggctag ggaagattcc agtgtgtggc taaaagagag gaagagcaat      6900
     accaacggat gttgaggtta aaagtgacac attcaatgca taagcctatt caaaggtgct      6960
     cgagtacact tacaggatta cacaaggcct tgtcgggtga atcgtcaact agcaaagtgt      7020
     ttgtctcatc atactttcgc tttccacaac tgatgcatgt cccaatatgg tcccatactc      7080
     ttcgtaggtc cttgaggaac aaaggtttat ccttcttctc ctgagtttta aacttcgttg      7140
     tagtgcatat attctgatcc tgtgtccata agattcatta gctagctggt ttttggacca      7200
     actattagaa tgagttctgc tcatacgtaa gctacatatc tcatagtcaa agaaatgcaa      7260
     agttcacaaa gattgtagac tgtgtttcta caatctcaat ctcaactgca tttctcataa      7320
     tacagtcctt ctcatatagg aactgcattt ctcataatct actctcaaag tcaagaaaat      7380
     agctcataga ggttgcaggg atcacttaca aaacagaaca acagattcct cgcatggttt      7440
     ttcatgacaa tgttgatcat ataatccaac ccactagtaa gagaaaaagg agagacagag      7500
     ttaattgagg aattaaactt cgtatatgta taagacacct aactaagaag agtcaaagac      7560
     aatgcatttt gggttttgaa tcagttcaag aagctcacac acgtctggaa gaccatatcg      7620
     caacatcaaa tctctcaaag caaaagtcga gaaaactagg aagaaaaggc ctcctgaaga      7680
     ctataaaagg acaaagaaat tactctgcag taaaagaaac ataaaacaac ttacaagtag      7740
     cgacgttgaa attgattctt tcttacctga tctgtatgat actttaccat ctggaagaaa      7800
     tgtacctgta aaaccctgaa caatatctgc aaggattcca tttaaatcaa atataaccaa      7860
     ctttctggta cgttgagctt tacatgtgca tctaggtaca tctccagttt ctgatgaaat      7920
     aactccttga gctacgttat cattttgtat taagacagaa cttgacaatg acgtttcaag      7980
     cttttccctg tcaaattctg gttcttcatc tttcctaggt aatgaaacat catccttccc      8040
     ctccatatca tcagttttat gatctaaaga attttttttc ctcttgctct tctttgtttt      8100
     gacctcaacc ttgctaacac cttctgctcc caaatcattc tgatcaactt cttccttttt      8160
     ttcatttttc tttatactat cctcctccat attgtcagtt ttatgatcta acaaattttt      8220
     cttcttcttg cttttctttg ttgtcacctc aaccgtacta acaccttctg ctcccttggc      8280
     atcctgatca acttctccct ttctatcctt tttccttttt ttggtatttt tatcatcttg      8340
     aacgctttcc cccttagttg cagaatcttc aatgttacta gccaaatcct tactggcaat      8400
     ctccccatca gcattccctt cataattttt cacaccttct ccattcgatt gatacaacaa      8460
     agactgtact gactcactat ccatggtggc aactgattcg cagtttgttt tgttttttat      8520
     cttcctcttc tctcttttgt gaccatcatc actaacacct tctgcgtcga gtgcatcctg      8580
     attagattca atatttttat cttttgtcat ttctttacgt tttccagatt tctgaactcc      8640
     acttttctct ctcgttgcag atttttcaat tttaattgtc atatcctctc ccccgaactc      8700
     ttgtccagca ttcccatcaa aattttgcat gtctttttcg tttgactgat tcaacaaaca      8760
     ctctactgat cctgatggct caaagacctc catatctgca gatgaagttt tcttcttctt      8820
     tcccttccgt tttttgctcc ttacatcaca tacacctgct ccaagaacgt cctctttaac      8880
     ttcagtgttt tcatctgttt ccttctcttt agtttttccg agattctgaa taccgttttc      8940
     ctccccattt acataatttt ccgtctgact tgccgaataa ctaattaact ctcggccacc      9000
     attcccatca ttattttcca cacgctctac tggcccgctt ttcatggagg tagacaaagt      9060
     atttcctaat gggtcacaca cctctattgt ttcggtcttt ctcttctttc ttctcttggc      9120
     tttaggatcc tgagtttggg ccacagtttc actgatgttg acatctgtgc actctttttg      9180
     ttccactgta tcatccttgg atttcagaca actacttatc acaacactag caacagattt      9240
     ttcctcttta gtcgtcgatt ttgatccttc agcttcagaa atagtatcgt atttaacttc      9300
     acgaacgtcc tctttaactt cagtgtttcc atctttttcc ttattcccat cattattttc      9360
     cacacactct actggcccgc tttccgtgga ggtcggcaga gtatttccta atggatcaca      9420
     ggcctccatt gttttggttt ttttcttctt ccttttcttg gctttagtac tctgagtttg      9480
     gaagacagtt tcattgattt gaacatctgt gccatctagt tgttccactg tatcaacctt      9540
     ggatttcaga caaccattta tcaaaacact agcaacggag ttttcctcta tactcatcga      9600
     tcttgatcct tcagcttcag tagtagtatt gtcagttaca gcaacctctg cattggtgct      9660
     accaatatca acaccacttt ctttcagtac atttctatcc ctccttttgt ttctctttct      9720
     tttcgaggaa ctagtcatat tagtagcatc tggcagtgaa tctttgcagg ttgacagatt      9780
     tgggtctgta caaatttgtg ccgctccagg cttctcacat gaatcctgag ttagttcacc      9840
     tgacctttct tgtaccatac cgtttgacaa aggattgttg ggtggatgca cttggtcttc      9900
     gctggtgatt ttttcaactt catccaacaa tttctcttca caggacaagt cctctttctt      9960
     cttcttcttc tctctccttt ttgatttttt tgtactagaa cccttcctat tatcatctgg     10020
     tagagaatct tcacatgaga ttgggtctgt atgatgtagt gtagctctag gctcttcaca     10080
     tgagactgaa tctcgttgac aggactctgc aggtaatgaa gacaaaagat tctcggataa     10140
     ccgaacttga ctttcactag tggatttctc attttcccct tctttttttt cttgagatga     10200
     aaaggcctca tctgcgttcc caatttggct actgatatga gaatcattat ccttcacctc     10260
     attatccagt ttcctcgatt ttctcttctt tttccccgat ctcttcttat gcttatcaat     10320
     caattctgga ttcgtttgac cgtcatttga gtttccagtt tctgaaagtg tttccactga     10380
     aacactctcc attactcctt taatttagtc ggaaatcagc tgcagttcaa aactatcaag     10440
     ggaaacgttt tctcaagttt agcacaagtg aagtgatgat tcacaaagaa cggataaatt     10500
     aagatgcctc acataaatcc atcaaacggt agctctagaa aacccaacac ggagctctta     10560
     agtgattgga aactgagcaa tagagactat gtattaaatg tgaatcaaac aattccaacc     10620
     aaagaagcag ccatccagaa aattatgcac tttctaatac cattgttcgt gaaatgatga     10680
     ttggcagtgt tcttattcac taaaacacca aaacgcttct taacaaaaac cattaacaag     10740
     agaaaaacga aaaactgcca gattcaatcg agctgaggat attccacata aatgatggca     10800
     accttaaaac cagaagtttt agtaactggg tcacatctta aatctgaatt tgaaaaacaa     10860
     aaatcaccct cgaagaagag acggacatgt caaggtatca accgaaatta gagcacaggg     10920
     cactgtctca aaaccgacca ggagatttct caggctacgc ttaatacaaa tagaaggaga     10980
     agaagaagaa gaaaaagatg agattacctg gaagttttca aattgacgaa gagtatctct     11040
     gtgaaggaga cgaagaggcg cggcgaattc gatagcaagg gttaactgaa tcttcgtttg     11100
     tgttaaaact tccggtttat attgaaaacc aaaacattat caataaccat tcaggtttac     11160
     aagcatgact ccaaataacc aggttttttg gtttgtgaat cacaactgaa atgttttaat     11220
     ttaaacccaa ctaattaggc ccatatatgt ggcccattta tatatctatt ttgattctgt     11280
     tcatcaaatc aagaaattta ctcatcatat tgatcatcaa aattcaaagt catactaaag     11340
     ttcgtgactc acgtttaatt catacaagta aatggtactt tttttttttt ttgtaaacga     11400
     agcatgcaaa aaatgattta agaactgcaa agtactagtt ttatcttttt gtaaccgtca     11460
     aagttttgga tttaagctcc ttgcatctct ttgaccaata aaacccatac tgtatatttg     11520
     actaaaagag agacccctga agattttgat cagtgttgtg ttctcaagtc tatagattat     11580
     tgctttcgag tcttcagtaa atctgtaaaa gaaaggtagc aacatacctt atctctatat     11640
     agaaatgctc caaaaccaaa acacatgttt tctttaagta tcacaatggg tttattgtat     11700
     aactcggtat ttgaaattat ctgccaataa acctgtaaag caacttgaac tttatagaaa     11760
     aaaactaagt tgcacgcgta gcaacaattt ccatctatca catgctttat ctgcatttgt     11820
     acaataagca cattttaaca caattgggca aattggagct aatcataacg gcttggtgtt     11880
     cttaaactac ttgacacagc taattgtaac gttttggtga ttcttctcat ttctaaagct     11940
     ttatatcaat ctaattaatc gttcaataaa agttaattgc tcaatcagtg agtagattat     12000
     acatacatac gtgagaatag actgactgtc gtattttacc ttcttacacg aaagtgtttg     12060
     tttttctttc gttcgtattt ttttatttat attttgggca tgagaatcag tgtccaagtg     12120
     gaagctatta gctatgttgg ttgataattc attttgtata tgtgcaaatg taaagcttca     12180
     tatatatgtg acccattcat gcattattca gcaatgattg aagattgtaa taaagtgtac     12240
     tccttaatta taagatatta ttacaaaatt tacaacttga ccatactcca tgtgtgtttt     12300
     taattctcga ggcacttttg tgttcttgat tatatttaca actaatcaac aattattata     12360
     cagccattta tacatataaa aaaacacagc catatctgtc gaaaaattaa tgaagtcccc     12420
     aattgtatat acaaatccat ttttcacaag ttccaacacc atatatatga tgagtataat     12480
     aattctaatc aattgcttca gtttggactg ataatgcaag tgttaacatc aaattttatg     12540
     ttggaaaccc tatactaaga agggaactat taatgatttg gcttctctaa ttgttttggt     12600
     tagcaaacat gcagtactat acataattgt agcaaagcaa tgacacatca agaacacgaa     12660
     cacaaaccac tatttgctgc tctaagttta tttctcttca tattgatatc aaaatggaga     12720
     acaaacttta gtatacaatc attagttttc cgtgtgcgtg tgtgtgtata cagatcaatc     12780
     accatactaa ataatattta atcgtatacc aataaacgag ttaccaaata cgtatttcaa     12840
     actttgcatt tatatattgg catttttaat ttcttaattc ttgaattcaa tgagaaccca     12900
     aaacaatagt agtacagtat aatattgcaa aacgcgttat gacatgcaag aatatttcaa     12960
     acgtgtttgt acgaacacgt tgccgtactc tgcaacacaa gttctccact gccagtgtta     13020
     ctttatcttc tcaagtatta atttgttttt gttatgtttt ctgccagtga attactttat     13080
     cttctcaagt attaatttgt tttttgttat gtttttctat atatatagtt atatactgcc     13140
     aattactata tatttttatt aattagttta atttttttat tatcttcaaa attaaataaa     13200
     taattattat tttaatgtag ggattttaat gtgtaaggat taagagcatc cacaatagtg     13260
     gactcttagt aaaactctaa acaaataata aatattttat atgatttaaa tattagataa     13320
     gtctcttaaa tttgaagaaa attagatcaa ttgtcttaag agacaattga tctaattttc     13380
     ttcaaattta agagacacat cattaaaata tattatttat ctatacttat acttgtaagt     13440
     tagttaagaa acccatgttt agagacttcc attgaggatg gtctaagggt atttcataag     13500
     ctcatgtgaa taaaatatat atacatgctc gtctctagta taataactca atactcttca     13560
     agtgaaacaa aaacatatgt acagttcctg tcttataatt tatatttctc accatatggt     13620
     aggaaaatat gtacgtcttc tcaaaatttc tatggtatat cgtaaattgg taatataatt     13680
     gaaattaccc atgaatactt aagcttatta gatatttata ttattctata tgcatgtgaa     13740
     gccaaaattt gccttttcgc taaacaaatt taggcacatt atattgctcc aacataatat     13800
     attattgtta atccttctcc taactatgaa cagttaaggg agaaatcaag aacctcttta     13860
     aataaataca agttcatgaa tacataaaaa tatttctatc tagccaagtt tatgtgttca     13920
     cacgctggtc acgctcgcgc caaatgataa ggctcgtatg attattatcc atgccaaagt     13980
     cgagataatt ctttacttct tcccgttaat taatgagtat tttaaaagca attttaatca     14040
     ttttgaaatt atacgttttg aactgacgat atgcataaat agaccatgaa gtgtaggtcg     14100
     acgtaaaaaa aaaaaaaaac tctacactgc atgcatatcc taacaaaaaa tgtttacgtt     14160
     ttacttctaa aacattttaa atcacaaaag tattaggtta ttcataaact tctcggatat     14220
     caatctttaa aataaataat aaataaaaaa atctcgaata tcaatatcgc taaaaaaaag     14280
     aaaaaaaaag aaaaaaaaaa aaagctagga gtcgccgcat tattgataaa gatatagcaa     14340
     actatatacg gtggaatcag aaggtttggt tggaaggata tatgatacga cttaccaact     14400
     gaagatgttt agttaatcta tttctgacaa atgacaagaa gagtgaaaca tgtatctcgt     14460
     ggcctctttt cattggtctc atgagactgt ggaagatacg acttttcaca aaatcattta     14520
     taaaaaatat ttttgctgac agcaaatcat tagggattag gatcatcata cttctcagtt     14580
     tggttgctag ttgctacaat tatctcatgg ttttgtcttg atctttttat ttcttttgac     14640
     tggttatgaa tgcttttaaa cgagtaatgg acaccgtacc ctctagtagt gaaattgtta     14700
     acatgttaaa aactatatta attatatatg tagtatacta gtatgtcagt gcgattttag     14760
     caaagtcgat atatatacct tttcgtttga ttgtacactc aacaaattat gtaaatcctt     14820
     ataaccggga acgtaaccta tatcaaagca agaacaacca agttaaaacc aatcctcgga     14880
     attaaacaaa aacaaattgg aatcttcttg gtataattta tttccttcta agatgtcatt     14940
     acctaacgca ctatatgatt tgcctaagaa ataagtattc tcaattgctt gataatgaaa     15000
     tatcctccaa ttgctggtat atcaaccttt cggatatagt taccatgtgt aacaatctat     15060
     tgtctatggc tcgagctaaa cacttgcatt catgtagctc atccccaact ccttgaaagt     15120
     gggacctctg gaaacctagc tataaatcac gttaaaaatc ttcttaaaac aacttttaga     15180
     attagcatat gatacagtat tgacctactg tacaatgggt ttcaatgtat gtgtaagtga     15240
     atgacaagaa atatcagtag aacttatagt tttcttaaaa aagctttact taagctgtgt     15300
     aagtactttt taaagtaggt gcattggtta tctaatgaaa atagtccaat ggtcgaaaat     15360
     aaatagacac tccacacaca ttaattagtg aaatccacat attacgaaca atagtttata     15420
     acattaacag aaaaagttca tagactcata gctatataac tagataatat acttaattaa     15480
     taacaaagat tatagatcgc aatatcgttt gatgcatgtc tcgtatattt tcatgaaggt     15540
     gctctcctaa ttagccgcac aaacagtccc caaactccac ttctctttca cgttctctat     15600
     tacaacttgc ttctttgttt attttaaatt tatactaaaa tagtcgagct attagtattt     15660
     aaattagtac atacatcaat gattgctccg taagatatca tgaacttctt cttgaagatt     15720
     tcgtgttaga attagtaatt gattgcaatt tcttatacac ttatgagaac caatcaatca     15780
     attggtgact aaatttgatt ctatgttcct atgaaagtac acaaaattgt aaacaatcca     15840
     ttggattgtc acgtttgtcg aagacataat ccagcatgat ttgaagccaa tctatgacat     15900
     taaactagaa gaaatcaacc aattcattaa ctccccaaaa agcttgcatc taacatgttt     15960
     gttttcaaaa cttaacaaac aattaatgtg taaataaatc acgtttctaa atgtggatcg     16020
     ttacaatgtc tttcgaggat gatatagatc atttaattca acttagaaaa tgataatttt     16080
     tcactctgca aactaaaatc gttgtggtat atacacacat gtatatgtga tgcattacgt     16140
     ttaaaacgct ttaattatcg gagtttggct ccatgtacgc tagctataac actctaacca     16200
     tcccgtcttc tcaatatata ttttacagtt gaaataaaga ttaaattttg caatatatat     16260
     atagatattc acactaatcc taaaaattta tcacatagta tattagtttt ttttcttcaa     16320
     agtctaggtt attgtaattt ctatttataa gaccatataa aacatataga ttagcattac     16380
     cctttgtgtt gatcatgtac tgagattcaa tctacagttt tatttccgaa tcttaagctg     16440
     gtgggttcga tcacatgcaa attacaattg tctattagta ttacgtaaat acgaatatac     16500
     atccatatgt aagaacacgt gtgtataact gtgtatatct ccaatatacg tgcatctaca     16560
     tctataagtt tacattgttt tcgttatctt ctacctaaat ttattaattt tcatttgggt     16620
     cctattgtta tgtcgattaa taccctttaa tttaggctga tgttctaagt ccaaacatac     16680
     aaacagccaa tcttaacaca aaatcttaat ctcagcatgc gggcaaaatt gcgaccatac     16740
     aactattatg ctatgatggt tctagtaata aaagcaggca tttagtttgg aaaaaaagta     16800
     aaatctcctt agagtacttt aattagtaac cagtgctata aacgaattgt aaccaacacg     16860
     caatggaatc aataacactc tattaactta atatagatat gagaaactcg tgcttttaat     16920
     ctttgttaaa acgtcgacaa aaaaaaagtt tttttctgtt aattagttct cctcttttta     16980
     aagttttaaa tttttgattt cataactcac tattaattgc gatatgtggg gtcacctaag     17040
     atcctccaag aacttatatt cttgatgaac atatattgtt cacaaattgg aatcataatc     17100
     ttatcgtatg attgtatgta tatgtgtcac gtagttggac ttttaaccac tattagatct     17160
     ttccaaatat cctctctctt tttttgcttc aaatttgttt tttttgtgca cacacatctt     17220
     atattattaa tatataaaat tggatgagct ttataagagt tttaattaca tataggaaaa     17280
     atagaactaa ttaataagat ttagatatat gtataaacgt atttatatat tgacatgtaa     17340
     gttttaaaat aatatatcgt catgggaaat atttttaaaa atcttaaaat acagtatgga     17400
     cttatatatt catactaaaa cctagtgggg tttttttttg tgtgtacatg aaaagtggta     17460
     aaagtatttt ctctttttta attttgttag attaaaaata tgttaaggta gcttgttttg     17520
     tttatcgtca tgtgttaaag tgtactatat ggtaaagatt tatacagtag catgtgtaag     17580
     cgggttcatg agtaggagag aattaaattc tgccttaatt aaacaaaggt ttcgattagc     17640
     cgtacgtacc gccattaata gggagcataa ttatcaccca ttagggagca tactttgacc     17700
     actaggggaa aattagaaac ctatggtaat cgtattaatt aatacggcca aaattaattc     17760
     taattaacat ataaaactgt ttcccacaac taatttttat agatatatca ccttttagat     17820
     aaaatataga aattctttct tcatatatat gttactaaca aataaaaatc ataccgatgc     17880
     aatgacctac aatctgaccg gttagctcaa caactcagta tttgagaaat gtaattttgt     17940
     tcgattacca taggttttta tttgtataaa tctaaatata atcatattac ttcttttttt     18000
     atcgaaatat aatcatatta actcacgcga agaaactata ataatccatc tgacttctgg     18060
     ttcgtaaata ttgtcatact taattagaga cgaattgttc tcatggtaat cagcaaaaga     18120
     tcgaatttcc taatttctaa tactagtcca gaaatatggt atagattttt atcataattt     18180
     tttttgtcta gatataataa agtgtaaatg gatagccacc cacccactcc tctcgtataa     18240
     tgtaaatttc tcattttttt aatgatgcca aatccatata atcggaattt caaccaccgt     18300
     atttgggcta tagatcataa ctaaagttat ggaaataaat gaataaatta aaaaatgtta     18360
     agtagaaaaa ataagtatca acaagagaga aggaagaaga agacataagc taacagttgt     18420
     ccgaaattga ttttggcaaa aggtgatctt tgattttgct taaaacatcg aatcagaaca     18480
     tttaatttag ttgtttcctc atttctttca tctatggagt ttagtatacc caataaattt     18540
     gattagttac ttattccagc tcctattatt atatttaaca cacataatgt aaaacagacg     18600
     cgtataattt atatagaaac tgtatgtagt taaaaacgac atactagtac tgatgactct     18660
     ttgtttacgt aaatttgtat tctcaaagaa aaaaagtaac taccttttgt tatggtctct     18720
     aagaaaaaac aaaagtactt tacagttttc ttagtgacca ttctgtaaga atatcaaata     18780
     gtgaaaaata ggtaaacgag aatctttttt tctgtgtaac aatattgtat tagtgaagga     18840
     ttattaatta cgagactatt atctaaaacg cattagtgac ccttttggat ttaaatcgta     18900
     gcagccgact aaaccaaaat atttagaaag ttttccaaaa acaaacaaca ttaaaacaca     18960
     tttaaactcg tacacaataa tagaaactaa actattttta gcagactaaa gtctaaacaa     19020
     cattacgttt aaaaattgat aatcagtgtt ttatagaact ggcgatctcc taaagatgaa     19080
     ccaccgagaa gtttcaagat aaaaacaaaa ataaaaatag ccaaacactc ttatctattc     19140
     atccatttgc aggtcaatga caccgtattt ttccacaatc gaatcttcct tattctttac     19200
     acaaacttct tctctgtatg taagtaaact aatattaaaa ttgaacttgt caaagacttt     19260
     cctcttggtc acgtctgcta tatatactcc ttcattcaca caaatgttta actccaacac     19320
     acttctcttt ctctcaacct ctctccctct ctctctccga ttgtgttttt agagctgtca     19380
     cgtgtcacgt gtcaggttcg aagctctaag aaaaaaatgg gtcttcctct aatgatggag     19440
     agatcatcaa acaacaacaa cgtcgagctt tctcgagtgg cggtttcaga cactcacggc     19500
     gaagactcac cgtacttcgc cggctggaaa gcttacgacg aaaatcctta cgacgaatct     19560
     cataaccctt ccggtgtcat ccaaatgggt ctcgctgaga atcaggtaat aaaatctttc     19620
     atatagtcaa ctttttttta ttaattgtta tatattgcga taatgtatta attgtctctt     19680
     tcgatcattt ttttcctaca aacaggtctc gtttgatctt cttgaaactt acttggagaa     19740
     gaagaatcca gaaggttcga tgtggggatc aaaaggagct cctgggttcc gtgaaaacgc     19800
     attgtttcaa gactaccacg gtctcaaaac tttcagacaa gccatggcta gtttcatgga     19860
     acagattcga ggaggcaaag ctagatttga tcctgaccgg atcgtcctca ccgccggagc     19920
     caccgccgct aacgaactct taactttcat tctcgccgat cctaacgacg cccttctagt     19980
     tcccacaccg tattatccag ggtacgtcac actttataat aagatatata atgaattaaa     20040
     ttaagaaata tggtcattcg tatatatgaa gataaactac aaagaaatag ctgcaactaa     20100
     ctaacaccat ttaaaagaaa gttataatct agcaaatctt ttattttcga tatttaatgc     20160
     attgtattta ccgaaccgtt tatttatttc attacagatt cgatagagat ttgagatgga     20220
     gaaccggagt gaaaatagta cccatccact gcgacagctc gaaccatttc cagataaccc     20280
     cggaggcgct agagtcggcg taccaaacgg ctcgtgacgc gaacattaga gtccgaggag     20340
     tgctcataac caacccatcg aacccattag gggcgacggt ccaaaagaag gttctagaag     20400
     atctccttga cttctgcgta cgcaagaata ttcacttggt ctcagacgag atctactccg     20460
     gctccgtctt ccatgcctcc gagttcacaa gcgttgccga gatcgtagaa aacatagatg     20520
     acgtgtcagt aaaggaacga gttcacatcg tctacagtct ctccaaggat cttggtcttc     20580
     ctggtttccg cgtgggaact atatactcgt acaacgataa tgttgttcgg acagcgagaa     20640
     ggatgtcgag cttcacgctt gtctcgtctc agacacaaca tatgctggct tctatgttgt     20700
     cggatgagga gtttacggag aagtacatta ggataaaccg ggaaagactt agaagacggt     20760
     acgataccat tgtggaaggg cttaagaagg cagggattga gtgtttgaaa gggaacgcag     20820
     ggctattttg ttggatgaat ttgggtttct tgctcgaaaa gaaaactaaa gacggcgagc     20880
     tccagctttg ggatgtgatc ttaaaggagc tgaacctgaa tatatctccg ggatcttcgt     20940
     gccactgctc ggaggtcgga tggtttaggg tttgttttgc taatatgagt gagaacactt     21000
     tggagattgc gttgaagaga atacatgagt tcatggaccg acgaaggagg ttttgaaatg     21060
     ttaaaaaaaa aagtaaagta aatccgtttt tttggtggtt aaatatatgg gggaggggta     21120
     attaattttt taggaaagag aagataatta atttaaaccc attgatgtaa aatgggtttt     21180
     gatttgtttc tcttttctag atattattgt ttgttttctt gcttggacaa agcaagttaa     21240
     tttcatgttc atcaaggttg atttgtaata tttattgtta taaacgaatt ttttaaaata     21300
     taaagcatta cagaaacatc tctatcggaa aattatccct attacttaag tacggcaaaa     21360
     acaaatatat ttatattgtt aagataatga tacacctcgc aaatatatta tagacagtag     21420
     atacagattt acttattgtt cttgaaggtt atacatctgt atgtaatatt tgttgacttt     21480
     tttgtcaagt taatatttgt tgtcgtatac agaaaatggg tctaaataat tttatttcaa     21540
     tatggttatg tcattgttgt tgtaattttc tgtaaagagg ttagtgttgt tatgtggtcg     21600
     ggtctttttt tgacttggtc actgtacaac tctaacaaga aatgtgttct ttttcttctc     21660
     ttaatactag ttatccgaat acacacacgg tttcgatgag atcgaactag ttttgtgtgg     21720
     ctaccaatta gtgaggtatt tatgacgatt tatgacaaaa aaatattgaa acaactatta     21780
     tattgtattt agggttacat gtataatttt aggattttga taaccaaata attaattgca     21840
     gtaacaaata ttcttaaata aaacattttg atgtttgttc tagattaaca taatagaaac     21900
     ctttaactaa tcatataact cgaaatataa tatctaaatt acaaacaaat cagcttataa     21960
     aagaagtgca cattcaagtt ttccgtacgt tacaatgaga aatatatttg ttgtgatatc     22020
     attcgggcga tttttaaaat ttggtctacc agatattcat tttcaataac gaaatttgaa     22080
     tgattaaatt ttaaacaaat ggttgattcc tagctaaagt ctctaagtta tttcgttttc     22140
     ttggccaagt cgaggtcgta taccacttgg ttgaataaaa acaaatcaat ttaagtgcaa     22200
     agacaatgga ccattgtcaa cggtctctac taaaataata taaataatgc aaattatagt     22260
     tacatgtatt caacacacat atttttttct aaaaagtgta taaatataca gtattgtatt     22320
     tggaatgagt tcatctatac aataatgaca gggaatgccg gaatggtatc tatggtatag     22380
     aagttgcatg caacagaact atagacattt cttacatcat gcacctagaa ctaaaccaat     22440
     catgtttaat acatcatttt ttttatatta aaaacttgct ttagataaat cactagatcg     22500
     aaagtcagga ctatagtata taggtaaagt tgaacctggc gaactctaaa tttacaattg     22560
     aattctgaat atttttcaat tgcaccaaca tttccaaatt tatacgtatt tttataaatc     22620
     catatcatat atatactttg acttagttag tttttttatg ttatgagtat ttattgcttt     22680
     cgttatgtca tgcacaaata ataaacatat acgtacatac tttgacttac atagcttata     22740
     gctatgtata aaattaatgt tataatactt caacttacag ctaattagga gaagtagtat     22800
     ttgatttgac tagtccttcc aaaggaaacc ccccttaatt aagcttatta aattgagttt     22860
     cgaaagcgtc aaggaaattt aagaatgtaa gactagtaga ctttgcatgc ataatccttt     22920
     taaattaatc accgatttga cattttagtc tcttaatttt gcatgcttca ttatgtcttt     22980
     gtactttact acttttgact ttatacatgc tcatgtcatt atctacgtat ctaatacaat     23040
     ttcttgtact cgaagttttg ggtcaaacct agttaccttt tcttcttgtt aattttagca     23100
     tgaattgatc attaatctca ataacattat aaaacagata cacatttatt ctaaccagtt     23160
     tccttaaccg attaattatg atacatttca aaaaccggct acgtgatagg cgtcttcgaa     23220
     ttttggtgcc tcttatatat ttagttccaa aagctttgca cgggaatact tttgacttta     23280
     gtacgttcgt gtattttata gtaatggtca aaagattcaa taatttattt gtaattttgt     23340
     gacaactggt accaaaagtt ttgtgacagg tgcaaagata gacttatatc aaactttcgt     23400
     ataataagaa agtttttttt tttgtacgtt tgtcaacaac aacatgcaaa aacatgatat     23460
     tttcaaataa aaatagcatt tttcatacag acagtgcaag tttaacgaat caaatatagc     23520
     cttttcattc ataactaatg ccgaatctaa tctaaacgca cgatgatgca aaatacaatc     23580
     aaaaccccac gacttctttc aagaattatg aggccattta ctttctcttt tgtttttctt     23640
     tggtacgtaa atttacaaat gtgattgatt tgcctactaa acgaattttt ttttatctac     23700
     ccttatgtat tctgatagta aatgttcaaa ttcaatctta cttcttagaa tcaaaaatgt     23760
     gaagaataaa aaacctcatc cacacgtgtg tcgcggtcgt taggattttc caacccaatg     23820
     ctactttttg agggtcaaag gtcaattgaa cagctggaag aatcttagcc gtcagatcag     23880
     tccccaccgc acacgcgtat cacgctgaca ggctggcgcc taaaatcatt ggccaagtcc     23940
     cacgtgtgaa ctaatcatca acgtcgtcat tagttttact acattggtct cgtcttcgtg     24000
     tcgtattacg atcgagctgc ttcacaatta tgttcttatg gacttatcta tacaacaacc     24060
     cgaaacctat aaatctttat tgtcaaaagg aaatacacat tacacactat acacgtactt     24120
     atattggacc caaaagtggt taggttaaaa gtgtttgtat cagttctagt aattactaaa     24180
     ttagaatatt ggtatagttc cgtttttttt ctttttctaa atgataattc aataattcat     24240
     atcatccatt gtatgtaatc tgtaaaaagt acggacagaa attcattgat cagaaacttt     24300
     ttttttttaa taaccaaatt ttgtggcatc atcattaatt ccgaacacag agattgatat     24360
     atcacactta catatataga ttagttggat gattgctata tcattgctat tgaaaaattg     24420
     caaaaagttc ttctaattca gatgatataa aatgtgactg tacatttact tattatttaa     24480
     taaagtcgaa tttgtagttg aaaataaata cttgtaatca agtggtttgt actactagta     24540
     gtctagtacc cacgtcgtat cataacttca ttcaaatttg caagtgtatg tgttggagac     24600
     tttgaattat atactaaaaa taaataggca aaaaataaac tgaatttcca aaaattcttt     24660
     aaatgatttc gtacgtgtat tattgcttgt gatctttgtt tttgtttaga tgattttagt     24720
     gagacgagaa aaaaagagaa gaagataaaa atgcatgaca tcacatgtca gtggatccag     24780
     agtattattt gatgacaatc tagtcagatt aggcattcgg tgtttaatca agtacttgta     24840
     tatgatagct agctaatcat taagcaaaaa aatgagatcc aatgactaat taatatattt     24900
     gattagcgtg tttaatgaag atgacatata attataatac ggtgttgggt gagatatact     24960
     ttgttactcg ctttgtacat acaacaagtg tttgcattat tttattcctc ttgaatatat     25020
     tgaatattac ggatgagtct gattgtttct caatagtttt ggaatggcaa taattttatc     25080
     aggaaacaaa aaaaacgaaa aacaaggtga taacaaaaag aacaatagga atatgaatga     25140
     aaaaaacaaa aaagaacaag aaaaacagaa aatgataata agtaggaacc aagagaaaca     25200
     tagaaataga acaaaatgat tatggtaaat ggtaacaaaa aaggtgaatt aatatttaat     25260
     ataataatta ctaaataatc atttatttga attttgttta ttattttcat ttaaaattaa     25320
     agttctgtat aaatttaaaa taatttatat tataaatttt tcttcaaaac atttatttat     25380
     tttatagtaa aattttcaat tatattacaa agttaaaata agtttcactt taaaacattt     25440
     atttatacta atttaaaata aattcataac attcattaaa ttgaaagttt gataaatttt     25500
     tttatatata tcaatatata ctaaagatat gtaaaatatt atatttaaat ataaatatta     25560
     tcataaaagc tattttaaat ttatttaata aataaaaacg aattttattt ttttgttcct     25620
     cttggttcct ctacaatttt gttctatcat tttttttttt ttgaggaatg atgaggaaaa     25680
     atgtaagacc catatgtata aaaatggaac aaaaatacct tgcaaatggt aaaaaaaact     25740
     gaggaacaaa gaggaataca aactttccta ctcattcttt tcctaaaaaa tggttatgaa     25800
     taggagccaa taatttagta atttacacaa atcgaatatt tctatgcgtg agaggtgaga     25860
     cctaacaatt caattcaaat ttgacattat ttgggcctcc ttcttaagat tcgcctacgt     25920
     ttgatcaatc taatttcata ttgggctatt aagagttatt aaaggctcat atgaggcctg     25980
     taatgttttt ttcgccgcat tatcggaaaa acctcaagaa gaagagtggt gacataacaa     26040
     aaccccaaaa gctcccaagc ctagagattc tgttgttgat ccgattcccg ctctccttct     26100
     ccggtagtac aatctccgtc gccggttaca tcagccaggt aagagacatt agtttttatt     26160
     ttgtttcgaa gtttcatctc ttttctttcc actttatccc cttcaaggaa tttgtgctag     26220
     atctacgctt ttaggtcgct ggcatttgat tgattttgga ccaacaaaag ctaatttaaa     26280
     tgttcatgag gtcttgagat ttgatgatta ggcttttatt ttgtcgagac tgatgttagg     26340
     tcgaactatg ttgatttagg tttgggattc gatttgattt tatggaattg gattccttag     26400
     atagatcctt tatatgcatc cgttaggtcc tcttttaatt tgtaattcta aactgtgtct     26460
     tagggaagag ttttaagaga tggcatcaaa gttgctacaa ttgaaatcca aggcatgtga     26520
     agcatcaaag tttgtttcca agcatggaac aacttactac aaacagttgc tggataagaa     26580
     caagatgtat atccaggagc cagctactat agagaaatgc aatgaattgt ctaagcagct     26640
     tctctacact cgtcttgcta ggttagtctt cgctctctca tctgatcctg gatttcgttt     26700
     gatgtgtttg ttagacaaga aattgtgcga aatcccgcta atgatgtaga taatcctgct     26760
     tcgttatcaa atttggttag gggcagtgtt ataaaagaat tgtgaaatta tacattctag     26820
     gtttgatggt tctgaaccat gaaactcatc acatacctag ttacagtctc tactttgctg     26880
     catctgaact agatactaac aatcccctgc ttatatagag tatagtattt gtgtagattt     26940
     cttaccagaa tagtcatttc actgtttcta gatacgttat tcagaaactg cgtgtcttct     27000
     ttgttgctat gactgacttg tttttttcaa atggatcgta gcattcctgg gcgttctgag     27060
     tcattttgga aggaagtcaa tcacgtgaag ggtttatgga agaatcgggc ggatttgaag     27120
     gttgaagatg ctggaatagc tgcacttttt ggtctggaat gctttgcgtg gtactgtgca     27180
     ggagagattg taggaagggg cttcactttc accggctact acccttgaag aaagaaagca     27240
     accccctcat aaacaaacat gcgtttcaga tccattgaat accgaaaagc ctttttatat     27300
     cataattagc ggcttattat ctatctcact gctgacatta gaagcaaagt taatttctgt     27360
     ttctctggat aatttataca caaaagtttt gaaggtgagg catcatcact cgtgctagct     27420
     ctaataatat cagtcgacta atgttggcca tttggttttt tctttgtcat tttcatttat     27480
     gtgaataacc atttttcttg ggtttagagt ctataaaccg tttggtaaga tgtatcattc     27540
     gtgaaacctc agcacatacc aaccttacca gagaagagta agacggcatt atattataaa     27600
     ccgtttggta atatgtatca ttcttcttct atcacaaaaa aggaagaaaa tcctatattt     27660
     ttgacaattg tctgaaaata cgattaggtt cagagtattt caacgttgtc tctgtcattt     27720
     gtctatcgca atttcgcata aaagcaagcc ttgtaggtgt agaagccatc acaccagatt     27780
     gtagtggatg atcggaaact aagacttcag tcatctggta ttctcctctc tctctctcga     27840
     ccggtcctca ctataagtct tctctttgta acatttttgt gatcattttg gatcgttagt     27900
     tttgtagttg ttcttttttt ttatgagtgt tttgatagtg aacataaact tgattcataa     27960
     gtcaactgta tgctcaatca attggttttt gaagaagtta gttctaagaa tcaagcaatt     28020
     ggataagata aaatcagata aaatctacac gccttttatc aaggcaaagc ttatagtgtt     28080
     taaagctgtt ttccttgaaa acttgaaaga tctacacttt cagaaaaaag ttgtaaactg     28140
     cagcaaccca taatcaataa agaaccagta gtagttttct tcagttatgc aagcaaagat     28200
     tatatgaatt agcatggcta tttaatatat gcttttttcc ttgagcagag actttacagt     28260
     gtttgaggaa cgaagattgt gagacacaat ggctaaggat gaagccaagg gattgctgaa     28320
     aagtgaagag ctctataaag tttgtcctta catactcatc tctacgttag ttcacttctc     28380
     catttctctg atacatttct gtgaaaaatg ttgtagtata tactggagac tagtgtgtac     28440
     ccacgcgagc cagaggttct cagggagctt aggaacatta ctcataacca ccctcaagct     28500
     ggtatggcta ctgcaccaga cgctggccag ttgatgggga tgctgctgaa tctggtaaat     28560
     gcaagaaaga ctatcgaggt tggggttttc actggatact ctcttctcct cactgctctt     28620
     acgctaccag aagatggcaa ggtatttgca tagatatgac caaaccaaaa gaaaaagtgt     28680
     catgatgttt ttcgttgttt tgcttctgta tcatttctgc aactgatttg gtacacgagc     28740
     tctgcaggtt atcgccattg acatgaatag agactcgtat gaaataggat tgccggttat     28800
     aaagaaagct ggtgttgaac acaaaattga tttcaaagag tctgaagctc ttccagccct     28860
     cgacgagctt ttaaacaatg tacaacttca tacttctttg tctttcaaaa aaagaattag     28920
     tatgtatcct gagatggtct ttttgttttg atgtttgtga tgcagaaagt gaatgagggt     28980
     ggattcgact tcgcatttgt ggatgcagac aagctgaatt attggaacta tcatgagagg     29040
     cttattagat tgatcaaggt tggtgggatc atagtgtatg ataacactct ctggggagga     29100
     tcagttgctg aaccggactc gtccacgccc gagtggagga tagaagtcaa gaaagcaacc     29160
     ctcgagctga acaagaaact ctcggctgat cagcgtgtgc agatctcgca agctgcgctt     29220
     ggcgatggta tcactatttg caggaggtta tattgagcga gtattgttgt tctttgtgat     29280
     ctttagggtc atatgattgt gagcccttta tattgagcta ttgtgatgca agagtgttat     29340
     tgttctatgt gatattttgg ttcctgtgtg aatgtgaacc ttttctatca agtttgtgga     29400
     tttcttcaaa tttcaagatt ataacagaca gttacgaaga aacacaactc attttatgtt     29460
     ttgtgtcttt tggcaaaact ccaaattctg aacattgctc taaaatctaa tataaaaagt     29520
     aaaaaaatga atggggcgtt ccgagaatcg aactcgggac ctctcgcacc caaagcgaga     29580
     atcataccac tagaccaaac gcccacattg atatatagtt tgctagcttt taatacaatg     29640
     tatattaaat aatttagttt tgtgatataa acagtaaaca gaacaagata ttttcaccca     29700
     aagttaaaaa atccaacgtt tgttcaaaaa taagaaaaaa actatccaaa gttaaattat     29760
     caaatgttaa aaatcgttag acgttaatca caatataaag gaactctttt tttttttttt     29820
     gagttaagaa acacttagtt gggccataaa aatataggtc tagtagatga aaggcccata     29880
     aaatcaacta gggttagttc ttcttcttat agagcgccgc atataagctt catccttctc     29940
     cgtcaccacc ggctctgtat ttcggcattt gtggagagaa gaaggtactc tcatcccttt     30000
     ctctttctta tcttaatctc cttttttaaa atttgtgaca aagtaaaatg agctaatctc     30060
     gtctttaaga tcatatgtca aaactgaatt tgagttttga tatattcagg taaagagaga     30120
     agatagaaac ataaaatgtc ggagaagaag ggaaggaaag aggaggtggt gaccagagag     30180
     tacaccatca accttcacag acgccttcat agctggtaat ttccaaaaca ccaaaaacac     30240
     ttttgtctta ttgcttcaaa gcttttactg ttagatagtg gaattggaat gttgataatg     30300
     agctcttagc taatgtttta attcgattgc tctctatgga ttgtgacatt gaaatgtttg     30360
     atcttctttg tgtgtaaaac tagtaccttt aagaagaagg ctccaaaggc gatcaaggag     30420
     ataaggaagt ttgctgagaa ggaaatgggg acaaaggatg tgagagtgga tgttaaattg     30480
     aacaagcaga tttggagcaa aggtatcaga ggtcctccga ggagaatcag agtccgagtt     30540
     gctcgtaaga gaaatgatga tgaagatgca aaggaagagt tcttctctct tgtcactgtt     30600
     gctgaaatcc ctgctgaagg actctctggc ctcggcacta agatcattga agaagaggat     30660
     taaactatct tatagtaaca acaacatttg atcagatttt tcgagttttg tttttcgaat     30720
     ctttattgga gagaacattt atcttcttga atccttaagc cttgaatcat agtatgcgat     30780
     tgagacagaa tctcagtctt gtgtcgtaag tagtcttcaa caatccttac acttgtttcg     30840
     gtaaagtttg agcatctggt tcgatcatga taatatctgc agctatgaat aagtttatgc     30900
     acctctctca agtgaattgc ttgaataaat caagagtatt acatgtatga actggaatct     30960
     agttcgagtc aatcatgagt ttttaaacaa aacgaacttc agagtttcgt atctatttac     31020
     aacaacagaa gaatgttctt taggggataa tagagtcaaa acttgcactc ttgctatcac     31080
     aaattcactc tgacgaggtt tgaaagtagc tattatctct ctaccgtgct ttatatgcat     31140
     acatatagtt cctcagtttt ttcacttcct cagatgactc ctctagaaga tggtccacgt     31200
     atagacaaat tccagctcca ctgcaatttc gaagtacaga aaagttgatg caaactttag     31260
     ttttacatac acaggggcat ataaaacaac acaaggttat atctaagcga tagatacaca     31320
     taccaaagcg gcccaaacgg aagccagata gcatcccacc ggaatttcgg aagcctagaa     31380
     cacgggtgag atttataagc ataaatttac aaagagcacg aatggaagga atagacaaga     31440
     aatgtccttc atgttgaata cagcataaac gactaacaca aggattcatg ccactaacaa     31500
     tggcattata ataatgaaag tttgcgaagt gcaagattgt atcgaaaaga aaagaaatgt     31560
     atactctcta gtgtacctca gcaagtaata aagccaaaag atggtcaatg cagatccaac     31620
     aacacaagag taccagaacc atcgtctatg atcattcttc ttatctcgta gcccgacaat     31680
     ggagagggag caagccatga tagcgatcca ctctgatcca aaaatccagt gataaaagat     31740
     ttattgttct agtaatcaaa taacatgcga agccaaaaat gaattgaaga taaagcaaca     31800
     aagtcttctg aaggcagtaa ggtttcagta tgaccataat ttgttttatc ttactgtact     31860
     agcaaagacg caatttgact tccctcaggt cgaaaacact caaaatgcaa tcactctttc     31920
     taattctaca ctaatccact aacagatatg ctcttagatt catatgcata taacatatct     31980
     gttttttccc atgttgttac aggatattac acagaaactt ccacacaagc tcagaattgg     32040
     ctgtaccacc atatcgaatg gcaagagaaa tctaataaac cgtgactaca aagtaaaaaa     32100
     aatcacatag atgtaagaca aaccagctga aatgaccatc catgacttga gatcttccat     32160
     aaagtaggca tgataccgct gctcaaaaaa aatggcatcc ataagaaccc atggaatata     32220
     gaacgtagat aacgtgacat ttgtgtatgt atgtataagt gcttgcaact ccatacgcag     32280
     gcagaattag tgtatcatac aaagattgca agtgtattag ctcacaatag tcagcaagaa     32340
     actcaaagct ctaaatccgt aatctatcgt taaaaaacaa aatcaatttt aaactgaact     32400
     cttaagtttt aatccaactt tgtcttctaa gatcaaaatc gctgcaactg aagacaagtg     32460
     atctgatctg aattttaact ttgaattcaa ttcaacttaa gcaacaaaac tagtcaatca     32520
     aatggaattg ctagaaggac gaacaaggcc acacttaagg agagattatc agtaccagtt     32580
     cccatggtga catgaactgc tggaaaatgg agtagaagag gaaagctcca aagcagatca     32640
     gaagaaccac aaacacgctc tacacaaaag ataaacacaa acttacttaa gaaacagaac     32700
     tcctcaaaat tttgcagaaa ttgaatattg ttcttagatc ataccctcca ttgaagactt     32760
     tgctgagcat gagcttcctc aagataccga acgtactcct cctgctctgt aaaacgacag     32820
     tgatagcaat aaactattac gaacttgctt ttacaaatct gccaaaaatt ccagaggatg     32880
     agagaaacaa aataaacctt gcgtatcaat aggccgagaa tcgacgtctt cagaagtagg     32940
     aaggacgaac ttatcatcat cttcgtcacg acgagttctc cgccattttc tcgctaactt     33000
     cttcatttga tttttcttca gattgcagaa gtagaagatg gagaaattag gaaaacttca     33060
     atgagcatca tcgtttcttc aacgaaagtg tctccagcca aaacgccttt aagctacggc     33120
     ctattaagaa gcccagccca tagtttagca agattgattc ggtttcttat ctccggcttg     33180
     gtttgctgtg ttgaaataaa tgggctattt aattcaacgc aagtgggcct aactagaaca     33240
     atttagttac actacttttt ttggtcgcaa aactacaaga gtacacgtaa cgaatgattt     33300
     aagggattag ggatatttca gaaaggtaac acatatggca atatatgcca tatgaatcaa     33360
     acattcaatg caccgattta atccgtgagc aaacataaat attatgaatt atcctcgttt     33420
     ccatattagt taagcatttt agattcattt ttctatatcc tctctgattt aatccatatg     33480
     cgcaaatatt tatgatgaat tatacttagt tccatatgta ttacaatttt tagattcatt     33540
     cttctttatc cttttcgatt taaatcttcg tagtcaatta ctcccttaaa aaacgttatc     33600
     aagagttaaa atgtttcaaa tattctctaa ttaattctcc cctctcctct cactccctta     33660
     tataataaac gctcgtttct catattaatt cacttatcat cgcaaaaaaa gggttcttca     33720
     ctaatatttt tctcatttta actgtttgag atggctcaaa tgtcgatgac cgtcgagaag     33780
     agtatcaaag ctgacgtgac ggtgagccat gaccgtgtga aaagggctta cgtcactttc     33840
     cttgctggaa acaaagacta ctggatgggt gtagttggtc tagccaaggg acttcgtaag     33900
     gtgaaatctg cttatcctct tgtggttgcg attctcccgg acgtgcctga ggaacaccgt     33960
     caaatcctgt tggctcaggg atgcatcatc cgtgagattg aaccggttta tccaccggaa     34020
     aacaaaaccg gttattcaat ggcctattac gttatcaact actccaagct tcgtatttgg     34080
     gaggtaaaaa actttcttac tatatgtcta tatttgtgtt tattcatcat ccgatcgcat     34140
     cgtttatttt ttgttaatgt aattatcaat tactttgatt gctacattag tttaaaagca     34200
     taataacgtg gactaatgtc actaaattat taaagattat atatccaaat ttaatattct     34260
     gattgttacg tttgttttaa aatcatgata acgtctaacg acttgttaat atatgtaaat     34320
     gcagtttgtg gagtatgaaa agatgattta tctagatgga gacattcaag tatttagtaa     34380
     catcgatcat cttttcgata ctcctcgtgg ctacttgtac gctgtcaaag attgcttttg     34440
     cgagatttct tggtccaaaa ctcctcaatt taagataggt tactgccaac aatgtcctga     34500
     aaaggtgaca tggcctgttg aaagtcttgg ttctccaccg ccggtatatt tcaacgccgg     34560
     tatgttggtt tttgaaccta atctcctcac ttacgaggat ctccttcgtg ttgttcaaat     34620
     caccactccg acatattttg ccgaacaggt ttgttttgtt ttctttatca ttattttatt     34680
     ttagtttctt tattatacaa atctaatatt aatgcttgtt ttttgtagga ttttctgaat     34740
     gaatacttta cagacattta caagcccatc ccttcgacct acaaccttgt aatggctatg     34800
     ctttggcgtc atcctgaaca cattgacctt gaccaaatca gtgttattca ttattgtgca     34860
     aatgtacgtt taaattcctt atttcgtctc tacatatatg cattaatgta gatttaatgt     34920
     atttctgtta ctcaaatttt gtagggttcg aagccttgga gattcgatga aactgaagag     34980
     catatggatc gtgaggacat aaaaatgttg gtgaagaaat ggtgggatat ttatgaagat     35040
     tcgagtttag attacaagaa ctttgtcgag actgagtcca aactgagtcc gatcaatgca     35100
     accttggctt ccaaggaatc tgttggcgat gtccttatta gtcttgcccc ttccgctgca     35160
     taaccaattc tttatgtgga agctctatct atgcaacttt tttttccttt ttgttttaat     35220
     gagaggttta ggctatatat aaatttttat cataactata tagcaacctc gtttgagttt     35280
     gtgtttgtga gattagagtg gttggtcttg tgtttgtgtc aatgtcgacc ttgaccaccc     35340
     tttccctctc tctttttttg ttttagaatc aataagaaga aaactctttt ggcttaattt     35400
     tcttctgttc ctatttcttt ttgcgttttg cgttttgtat aacaacttta ttagattcga     35460
     caataacttt tgttttgatg actgaattct tacgactggt atgtttgtcc catccctcat     35520
     gcgctagatt aaaatttaaa accatagttc atcatcttta aagaaacttg gcttccatgt     35580
     tgaattattc ttgcaatgcc tttacctccg ttgagagtat tttgtaaaga gaaaaggtgt     35640
     tttgagattg taatactgta ccattcaata tatatgactg gtaatgcatt ttacactcgg     35700
     tttactggta tgtttgaccc atccctcatt atgcgctaga ataaaattag gatatttttt     35760
     agtttgagtt tgatgtaatg atttgtggat tggaatcgtg tggttggttt tttctcgtct     35820
     ccttgctcaa acctttctta tggttgctta aagttctcat taattggaga tggcattgta     35880
     tcgtttaact gatacattaa agtctcacta tttatgacat tggtttaaat gaataataaa     35940
     acaaaggata tatagattat actacatatt cgtaaagtta atgcggattt taattagtat     36000
     agaagagaag gagagtataa tttaaaacaa aatgatctca ggacattatt gttaattcca     36060
     tataagttgg cattttccga ttctgaaact atttgattct taccaatatg gtaagcaaat     36120
     aataactgag acattattta tatgaatctt acttttgaat cgtttcctcc attagccaat     36180
     tagattttat atggaaatgt atctcataat attagcgtat ttaatgaata cagttgacca     36240
     aaagaaaact atacctcata aatcgtaata ttagcgtggt taaatactac tataattcta     36300
     ttcttcagtt acaatgcatt gaccaaatat catccatgat tcaataattt tgaccggtct     36360
     gatcgttatg aaccgaaatt gatttcggat attttaactc ttgaaatttc acattactat     36420
     gattggtatg ccgtcactgt aatacgtcac catcgcttga acatgttttt accaaaaaaa     36480
     tatggttttc ctttcttttt ttcttcttaa atgaaataat gatgactagg tattcctgct     36540
     atagccaata catatagagg aactagagtt tggatttatt ctttatatat gtttcattcg     36600
     gacagtgtgt ggttaagctc aaatggtttt gtctaatatc aaattattgt acttgatcca     36660
     tataaataat aaatatacaa acatttttac ggatttttat gccaacagta atctgctctt     36720
     gaatttatta ttaaatatta acatatcaat ctttatattt gcagctcaat tactcatacc     36780
     gttcctaaca atatacgagt atctgagcta gtatatggtt agatttttag tttagatttt     36840
     tttgttgtgt tttatgaaaa aaacaagaaa aataataacc aaatcaaaat cggatcttct     36900
     ttggttttta tttggtttcc attagttaag attagctata tatatttgaa ctttgaagca     36960
     agattagttt tatatctatt tcaatgaatt tttattggtt gttttcttta ttttctactt     37020
     agtgagtcat gtacaattat agaaatttga cgccatataa attttttaat ttgttttttt     37080
     catccatttt tctgtgatag tttggtttga ttttatctga ttgatcacct agttatgaat     37140
     ctgaattaat cacacattaa ataagttatt ggattttaag atcttggtaa ggttatggct     37200
     cttccacact taggaggact tcctcaaagg ggtgttgttg gtaattaaag tttaattata     37260
     taacgcacac ccaataggga atgtgtcact caacagtccc aggtggctac atagaatgga     37320
     agcattatgc agtcagcatg gcaatttttc atacgatacc attctttata cagtaagcat     37380
     ttaatctttt ttttttaaac acggttatta aaatttaatt taataatctg cagcattgca     37440
     cacggctgga gaatacgccc attttaagaa tgagaaagac aaggagaaac ctgatcggct     37500
     gcacattttc aagtaatgat tattattttt aaaacattag taactgactg agtcttattt     37560
     aatcctaaaa aaaaataaat acatatacaa tgattgaaag gcaagcttaa ttagttatta     37620
     cgttcctagc ctatcgattg tttatatcgg taaatatttt ataaattatt gtaattaaca     37680
     acaaaaaaag catacaattt taatggtttt gattatattt tgcttatatt atgcaacaaa     37740
     taagaagaag tgaagcttgg gtttattcat tttacacatg ctttattagg acagagtgtg     37800
     tagttgaaca taaatgagtt tgtctagtat tcaattattg tactcttttt tttttgggtc     37860
     atcattcaat tattgtacct gatagtagcc gactgcttag atcttgagtc ttgattatat     37920
     tattgtcgta tcaatcaata catataattg cagctcaata ttcgtcattg cgtgtctatc     37980
     tcatcgtcct tttgttgggt cttattatgc ttgttttcat ttaagtacaa attattaatg     38040
     gttttgaagt atgtatatgc cttcgtagta aaattttaat gttgtgattt tggatgtgag     38100
     aaaaattgat atatgtcaag taagttaata gtacttcatt cagagtaaag cttattttaa     38160
     ttaattaatt acactacagg ttctccttgt cttcctcctt cataagatgg gtgtgttttc     38220
     attctccagc ggtgtgcaat gctccagaaa aaaaaaaaat cttaagtggc tatacacgta     38280
     tgtttttaag taattacatt tcttaaacat gattaagtga ttaattggtt gactttaatc     38340
     ctaataagtt gaatcactaa tattctatat attcttgtta ttacagcaca agttatacac     38400
     tagaagcaaa aagttcacgt ctatctatcg aagacgacga agcgttcttg gcacccgaga     38460
     taaatgcctt cggggatcag ttcaggtttc ttttttcttc catctatata cattgaatta     38520
     aaaaagatat tttgaatata taaagaaaaa ttggagtttt tttcttttgg tcgtcggatc     38580
     taaaatcttg acttgatccg taacgattac attggtattt ggtcgcaggg actacgatgc     38640
     cgagaatgag aggcagaaag gcgtggaagc cttttagaaa tctcaacaca ttaaccaaac     38700
     tgtcgacttt gtaagattct taaaaactaa taagggttta tatatattta attatttata     38760
     caacatctat atagatctat gggatccacg tagaatatat atgtgtaata tctatataaa     38820
     ttaaacaata taatttttca ggtgatagag acgagggcag aatttggtaa attggataaa     38880
     gaagtgatga gcatttggga atgttgtgag cttcttaatg aggtggtgga cgagagtgat     38940
     ccagatctcg acgagcctca aattcaacat ttgcttcaat ctgccgaagc catcagcaag     39000
     gattacctta gcgaagcttg gcttcatcta accgctctca ttcatggtaa tttgttatta     39060
     caaatagtct aatatagtgt gcctttttta taatcagaac tatatatgag tatctgagtt     39120
     agtttttttt tttttttttt tttttggagc aacatctgag ctagttcatg gttagatttg     39180
     tttagatttt tttttttgtg tgttttatga aaagacaaga aaaataataa gcaaatcgaa     39240
     gtcaaatcta ctttggtttt gatctggttt caattagtta agattagtta tatatgtatt     39300
     tgaaacagga ttactcttat atctatttta atgagtttta ttggttattt ttctatgtag     39360
     tcagtcatgt ataattatag aagtttgacg ccatactgat ttgtttaatt cgtttttatc     39420
     catttttctg tggtggtttc ggtttgattt tatccaattg atcacctagt tgtgaatcaa     39480
     aaataatcac acttctgatt ttattgcatc ttcagatctt tatgattctt ccacacttcg     39540
     gaggactttc tcaatgggat tttgttggtg attaaagttt aattttgtta ttagtatata     39600
     tagtcattaa tattttaatt atgcgaatta taagggtatg tggaactaat aatttatttt     39660
     tctctcacaa aaacttgcag gtgacataga ttccttgtta ggtgtgcatt tgatgaatct     39720
     aacgtacaac acggggtaat caatactagc aatttatgat caagaaaaga atattagaca     39780
     cccacattat atggtttttc ttaagagttt ataccaaaat acgattaatt taatgactgt     39840
     tattttctct ttcttttcgg cagtatttaa ccaaaaatgg catctacagt caagcatgtg     39900
     gactaaacaa tgagcatgat gtcatggggc catgacgact acatgtacat ggaatttaca     39960
     ctcaaggatg tggattaaac aatatagtta agcaaagttc attttgactt gatcttcatc     40020
     acgtcaacat gaactttgat tttactgtat aacttgtatt tactgtaata acaacaatat     40080
     ataacaatta gaggttgtag atattatgat caattactta atcatgtctt gatcctaata     40140
     actacggtct ctgaattgct gtatattatt attattacag caagtacaag ttataccgca     40200
     agatcaaagt tcacgttgat gtggagaaag tcaagtccta ctagatgtct ctgataggtg     40260
     gtggtggaga aagttcacgt tgatctagaa agtgagtatc tattcttctc catttgcaaa     40320
     gaaattatga attttcaact aattattcgt tttgaatttt tacagtatat tccggaggtg     40380
     gtggtgaagt gtggagaaga aaagaagtgg ggcatcactt agaagaattc aagaaataca     40440
     gatagtacaa tatcttaaat aaagagacat ttgtatatgt atcataagtt aacataactc     40500
     cataaacaag gagaactagt gtatctacaa agattgtaag tgtaatccat atagtaaaaa     40560
     aaaaaattag cttctcatag tcgagcaaga agttcaaagc tctttttttt tttttttttt     40620
     ttattgtcaa caatttagtc ccagcccata taagagtata gcccaaagcc ccaaagtatt     40680
     ataagttatt atccaattat ttatagacta ccagtaaaac catcgtatct tctaaaccga     40740
     aacagaccaa atcaactcac ccaaaccaat aaacgacacc aactcaagtc aagcagcaca     40800
     taagaaaaac atttcacatt atctgtgttt gatataatgc aaatgattaa attgtaatga     40860
     tactggtaat tagattcaat tttccaatat tttgatgata ctgataacta tctacaatgt     40920
     taatatttgt aacattgaat ttgtggaaaa tatagatagc cttaacattt aaaagaagcg     40980
     tatttgaagt acatgttgaa gatggtgagt agatatttcg tcatgcatgt gtggaaaagc     41040
     aaatcagtag aatttagata acatataaat gaaggccacg taatggtgag tcactccttg     41100
     atttatttta agaacatttc tgacttgtac aagctacaat tcaagctaac actttttcat     41160
     acttttcgag gacaaaactc atgcaatatt taagtttaag gacaattcat tgttattttt     41220
     ataaattatt ggcatattat ttttcttgtt gcatgtgtgt tagacactaa aaaacgaatt     41280
     gagacttgtt attaaaacaa atttctatga ttgtgttagc aaattactaa catttgttct     41340
     ttggtcaagt aaggcttttt ttactgtaca caatataatt agttctgacc agtagaggat     41400
     tttattggtc acattaatta gcgtccgttt aaaattactt accaaccaaa aaacagtata     41460
     tagatttaaa acttttaaaa gatattttga taactgttat ctggttattt ccaaaatcac     41520
     aacgtaaatt taatcaatat aagcaaaaat aggaattatc gattcttatc ttctgttttt     41580
     gacatggaat tatcgattct tatctaaaat gataaaaaaa aacacagtca acataatagc     41640
     taaaaaaacc agtaaaatat agcaaaaaat tacaccagaa aatcaaatca ctgactgatc     41700
     ataaatttcc ttatcgtaaa atttagacaa tacaaaaaaa gaaataaaca gaaagtcgtt     41760
     cctggtttgg ataaatataa aaagtagttg tttagaaaga aacaaataat tcgtcaataa     41820
     ggacttagat tttctccaaa tattaaggag gggaattgtc tcataatcct tatccaccac     41880
     tataaatacc gtaactccta attaaactcg taaagtcttc atcgcagaag tatatataat     41940
     caaaaagcaa atcgagttat tttctctctc aattcatccc aaaccgtcgt aaccattctc     42000
     tttcgtttcg tttcgtttct tctcttttaa aaacctttct tcgaaaagat gacgatctct     42060
     gttgagaagc cgatttttgg taagaatcta ttctcacaat cttttgggaa ataacgtctt     42120
     tatcaagata ttattatttt ccggctaaat caacgatttt ctaggaaaat aatgtatttt     42180
     ggtggtggct aattcacaac aagtttttgg gatttttttg tgtctaaatt atatatatct     42240
     tacaaagatt tttttctttc aagaagaaga ggtttctgca ttcgagaaga gtggggacaa     42300
     tatcggagag ttgaaattgg acggaggatt ttcgatgccg aaaatggaca ccaatgacga     42360
     cgaagctttt ttggctcctg agatgaatgc atttggccgc caattcaggt ttctttttct     42420
     tccacatttt tctattcaat tcaagaatga agaaaatatt taattaaatc aaactgagtg     42480
     ttttttgttt gtttgtttgg ccggatctaa accttgactt gatccataac gtgtacattg     42540
     gtggtatttg gtcgcaggga ctacgatgtt gagagtgaga ggcaaaaggg cgtcgaagag     42600
     ttttacagat tacaacacat caaccaaact gtcgactttg taagattctt aaaaaagtta     42660
     ttagggttta tgtgtataat gacacatctt attataactt atgtgatcca ggtagtatat     42720
     gtatactttt atttaattaa taaataatat aaataattgt atgttttgta ggtgaaaaag     42780
     atgagggctg aatatggaaa attagataaa atggtgatga gcatttggga atgttgtgag     42840
     cttctcaatg aggttgtgga tgagagtgat ccagatcttg acgagcccca gattcagcat     42900
     ttgcttcaat ctgccgaagc catccgcaaa gattacccta atgaagattg gcttcatctg     42960
     accgctctta tccatggtaa atttgttgta accaatagtc ttttctatga attaattaga     43020
     gcaggaacga tacgtcctcg tccaatattt tgaccgaatg agttgttcta atggaatttt     43080
     cagatcttgg gaaagttatt actcttccac aattcggagg acttcctcaa tgggctgttg     43140
     ttggtaagtc aagtttgatt ttgtcattaa tattttgaat atgcgaacta tatttgaaac     43200
     taattgttta ttccctctta caaaaaccta taggtgacac attccctgtt ggatgtgcat     43260
     ttgatgaatc taacgtacat cacaaggtaa ataattgatt caatctctta agttgttgat     43320
     agaaattaat ttattagttt tgttgaaatt tctatacata ctctcaaaat ataggattct     43380
     catttctttc tcatgagttt atacccaaag caagcaacaa ttaactaaca tatcgtttct     43440
     cttatccaca gtactttgtg gaaaacccag attttcacaa cgaaacctac aacactaaaa     43500
     atgggattta ctctgaaggg tgtggattaa acaatgtcat gatgtcttgg ggccatgacg     43560
     actacatgta cctggtaatt acttgattat ttttacagtt tagagtaatg ttttttcaga     43620
     aaagtttaat caatcttgag ttttgtaaag gataaagttg atgttaatta atattttttt     43680
     tcaggtggct aaagaaaacg gaagtacctt gccgtcggct ggacagttta tcataagata     43740
     ccattccttt taccgtaagc acttcaacta agaaatatat gattttagta acattataaa     43800
     tttgtagcta tgagtaaagg ttattttaat aaatcaattg aatatatgca gctttgcaca     43860
     cggctggaga atacacccat cttatgaacg aggaagacaa ggagaatctg aagtggctac     43920
     acgttttcaa gtaatcacat tttcttaaac atgattaagt gatttgttgt ttctcctaat     43980
     agcatctcta aactgctata tatatatatg aattttatta cagcaagtac gacttgtaca     44040
     gtaagagcaa agttcacgtt gatgtggaga aggtcaagcc ttactacatg tctcttatca     44100
     agaaagtgag tatatattgc atgctcatta caaaaaacaa tgaaaagtgt attaatattg     44160
     aaaacattca tatatttcta aattcttcag ctgactataa attctttctt ctctttttcg     44220
     attttgcagt atttcccgga aaacttgagg tggtgaattc ggtggagtaa aaaagtgccc     44280
     atggaggatt agtcgtttta tttacttaca aatattttta cacattttcg agttaatgtg     44340
     aatctattgt aattgtgtta tatatatctt atgttaatca tattcaggct gtctctgaaa     44400
     tgtaatcaca atcaaccctc gtgaatgcta aagagtttgt acgtcgggtg atataagatc     44460
     ttaaataatg aagtttattt ataataatct aagcctccaa ggtctaaaaa ttgtgcattg     44520
     taatgtaaac aaagttttat taacgtaact ctaagtgtac aatattacat tagtactgat     44580
     acatccatgc gaacaatgtc atgaccttta atgctcatac tcagatagag gtgttcaaat     44640
     tgatcacggt atctttgcat cttcgcttct gttaggtcat ggacagaaga gaattacgta     44700
     ccaaacaggt gtaattcgta agatacgtaa tcacatattt ctatatgacg atgataatga     44760
     tctagtataa ctgtcatttc gtatgaaatt atctacaaaa tttatgttga tcacatggtt     44820
     aaaactttga aggattcacc atgttatagt tgaaagcaag aacttgaata tttgcatttt     44880
     gatttcagca aagaacatat ttttaacgtc ttaaatagca aataatcaat catcacattg     44940
     acatgatcat gcattgacaa ttcgtagcta gattattcta tatataagca gaatgtaaaa     45000
     tgggataaat ggaacttatt tatatgacgt gggactaaag catcatgacg tggaaaatta     45060
     caacgtgagg catctaacaa agattgcttt gttatgccaa aaagggtaaa accgtcaaca     45120
     ccctattatt ttactcaact acctaaaaca tgtaacatct tttgaaaacg caaagctttt     45180
     ctgtcgttgt tcttatgttc aggtcacttg gtgatctctt tggtgactgg aggaacatcc     45240
     accacgccat tgcagttacc atcgtcaagg agagccgaca tcggtttctc tttattatca     45300
     aagacatctt tggggcccaa gaaactcggc tggtttgtcg aagagagtag ccttgcccac     45360
     atcctgtctg tgatcaccac atggttctgt ttctccgtta tcctctgtaa cataaaaatg     45420
     atgtttacat aaaagtgata ctatgattat gatgatatga ggatgatgac tttaacggtg     45480
     atgataactg atgacagtat gatgatactg gtataatgat catgcatcat caatttttgg     45540
     tgctctattt tttgattgcc aaagcatgct atcacatcat taaaatttaa atcgatttta     45600
     tgacttacgt aaaagggtat gtaggtttgt cttccgttca ctagaccact gatatagcca     45660
     gtgtatccag ccattgcacc gtgcactgca ctctgagcca gaagtgtaca ataaacattg     45720
     tctgacgcat tgctaggaac agctcgaatc atgtatgttg gatctgaaat taagacaaga     45780
     aaaatgaaca atcaagaaac tcatggtgga gagaatgcaa tgcaagggat ataaattgta     45840
     cctatgtact tgaggttcat caccatcttc ttctgattaa aatgatccta caaccgagta     45900
     aaaccaaaat ttagtagtag gtgagtttag tctgattttc ctatgcatca atgtttgatg     45960
     ctgtctctgt aatttatggt ttaccttgat gctttgtgac agccaaaggc caacatcttt     46020
     aagaagtttg ttaccagatg catctttgag tgtcatagat tccatgctct tcgacattag     46080
     atcttgtcct gcaccttctg caatcacaag aaccatgtga ccgctctcct tgagtcgttt     46140
     ctctatgtac tcaaacagtc cgccttctcc ttccaggtaa aatggtgact ccggaatcaa     46200
     acagcagtcc acatctctgc ttgctagagt ggcatacatc gctatgaacc ctgttaaagc     46260
     agtgaacaaa cttgtgaaat agtctaataa gagagcttga taaggcaaag aagaagtaga     46320
     agagtgaatt ctcaccgctg tagcgaccca taagcttgac aactccgata ccattctcta     46380
     tactctcggc ttccacatgt gctgcattaa tagctcgttg agcctcttct acagcagtgt     46440
     caaacccaaa agatttgtct atcacctgca caaatacaaa agtcaagttc tcaatttctc     46500
     cacataagaa atacagctct tctatagaga caaagcagta gaaagagata catacaggta     46560
     tgtcattatc gattgttttc gggattccaa taactgcaac tttcaggcca cgtcttctaa     46620
     tttcctacat ggttaccacc aaaagatcag taaacactga aattgtagaa ttgtaaggta     46680
     gaagtgaaat ttacctcaaa tatgacagat gctcctcgct gtgttccatc tcctcctata     46740
     atgtaaacct gaacgatgaa aaaaactaca tcaagaacga gtttgtatgt actcttggaa     46800
     cagaacacgg tgtaaagagg tgatggttat caaaacctga ttgattcctc gatcttgaat     46860
     gctgtcaact atctttgtgg tatcgtgacc acctcgtgag gtcccaagga tagtccctcc     46920
     acgcttatgg atatcattta caactttaga gtccaaggag acagtattct tagcataaaa     46980
     gcctctatat ccaccctgaa aaagtctcaa gcatgtgaaa atgaaacaaa tgaataccgt     47040
     gtttgttttg gtaagaagga gattacaatc acagaaactt acatctattc ccagtattct     47100
     cttcactcca tacatataag atagactgct cactatttct ctaatcacgg tattaaggcc     47160
     aggacaaaga cctccacagg taactatgca agcatgcact tcatcagatt cgaagtatac     47220
     ctgcagagaa ctaagtcaac aacagaccct attgaaatgg aaaaaggact ttaaagcaat     47280
     tcgataaaac gacgaaaaac cttctgacgt ggcccggctc gtctaaaatg aatccccctt     47340
     ggaccatcct tgtgaacaac gatctaaaac aacaaaaaga agagtcagta agacaaaaca     47400
     tgagctccaa attctcagga tgccctgata ttatagaaag aacccaacca aatatatacc     47460
     ttttgaggaa cactgtcatc agcatcaaca aagtattgcc tgaaaatttc caaaaataaa     47520
     aaactaatgt aacaactgca ggctaatgat tgaatcacca taggacacaa ttaggaacct     47580
     tagtcaccaa aacatctgtg agaaaggact tacttaacca ctgagtaagc tggattgtct     47640
     tgcaatggat taggataagt ctacaataac ataaaaccaa aagaaaattg accattaatc     47700
     aaaacttaac catcattcga tcccaaaaat aacatggtaa aaggacaaaa actcttaaac     47760
     catgctacag attttgatcc aggttcataa ttcttgagac ccaaatacaa aagacccctt     47820
     tttctttacc ctgggctatc ttatactaat cagaatctgg gaaattcatt tcatctatct     47880
     caaattccaa acaaaaaaac taaacagtcc tcagctgaaa aaattgatat ataaatatct     47940
     atcaacatag atcaaagttt caaccttttg caacagttaa agctcaaaag caaaagcttt     48000
     aatcaaatca gattaaaaaa agagagaggt aaacatacag gaagaccagg aaggtaatcg     48060
     gagagatgcg gtacatcttc tagaacataa ccacaagagc cattgatgat cttcggtttg     48120
     ctactctcca cagtactcat aacgaacgct cgaaacagag gaacaacaat ttcaggggaa     48180
     aagtcttata atataataaa aaacgatttt tttttctggt atagagactt ttgaactggt     48240
     caactacaaa ttgaatacga aagcaggaag aaaggtaaaa agaaagatga atcaaatccg     48300
     ttgatcaaaa acaaggcgac ccatttttat aggagtagag aaattttgac cattgtagtc     48360
     ggtaaacaaa ttacaaagcc aggtagagat agagagagag aggaaaccat taaaggtctt     48420
     agctatgtgc ggaaatggtg gttttggtca ctgctttgta gattatttga cagtaacgac     48480
     gactagtaca agtacttgca gagaaagatc gatatttttc tagaattgat atttgtttat     48540
     tggttttcta ttttgttacc ttttattgat tttttccaac tgttgggctt ggttatcaag     48600
     tcaaggtcaa gccatgcatt aatacggtcc gaccgataac cgaaataacc gatccggttt     48660
     attatttctc agaattttga aaccatgaac ctttacatga tcaaaggata caggtactta     48720
     ttgttacaat gcatttcaaa ggaaaacaaa acacaaacaa cacataaaca tcactaattc     48780
     agaattttaa aaccatgcac cttaacatca gaagggtcac ttattaatta ttacaatgca     48840
     ttttcaaacc aaacctcgga ataatctttg agtttctcct tcatgatcat gtcgattttg     48900
     ctacccattt ccggagttag atgattcttc cagtcaccaa ctatcccttt gcggaaatgg     48960
     ttcttgtact ctatgccatt gattgacttt ccggtcttgt taacctccaa actgctcagg     49020
     ttaggcagag aacacatctc caagatctta tttagagatc cgttcttttc ttcttcctta     49080
     gaaaatggac aacccaaaaa ctctgcgagt ttcttgagct gaccatgagg atctgttttt     49140
     atctcatcat acctcatgaa aagcacttgc tttggctttt ccaagctagc tttccagtaa     49200
     ctcaggatat gatcccaaaa cggaccaaac aagcagactc cgctgcaaaa ggactcaaac     49260
     atagactcaa gaatggttct gtcctcttct ttattcagac tcctgcaaac gatatgccaa     49320
     cgtgacacca gcgaatcttt cgcgtccctg cagatgtaaa ccaccttgca aggagagtcc     49380
     ttgacagcta cttgcagcgt gtggaaaggc gtgtgagtag agaacaacct tggagatgat     49440
     gatgagagct aggtcaagtc cggtgtttgg gtatcccggt aaagattcat ctcaaggaca     49500
     ggtacgaggt tgtgaggatt gttggataga agaggatggc tcataggatc atcatgagaa     49560
     gggttctttg ttctctcaaa aagcgcgaca gtgagtgcct tgagccacag ggtgccggat     49620
     tttgggtacg atgcgacgat aatatcagtg tcttgaggct taaaacctct ctggaaattg     49680
     agaacacctt ggagaaagtt gtagtaatac caagagcctt ggtacttgca gaggtttcga     49740
     ccgaggtacc ctttctctga agaaagtgaa gagattagag tctttgtttc ttccgttaag     49800
     tcttcgtctc tcaagttcat ccacttctcc atttttcttt tgtttttact tttagcgact     49860
     tattttgaat gctgtgtttg cttcaaaccc ctagtatcac tatttatatt aaaatgttaa     49920
     aatatatgat ccaataaaac gtttacacat cacttttaaa aatatttatt ttattttatt     49980
     acgaacatgt atctcaaaaa tcgagaggca atagtgacgt acaaaaacaa aaagagagat     50040
     aacgtggtag gggattatga aattatgaat cagaaattat agtgcatgta tttttatact     50100
     agaagtgtaa tacatacaaa aaaaagttct tttactcgtg aaaagtatgt cttcctataa     50160
     ctagcatacg ataactataa acttgatatt tttaaaagta aaaattctgt cttctttgtc     50220
     tatgagataa taggacatta aaatccaaag attccaaaat tatcttttct gctgccaagg     50280
     attccattca ctttccaact ggtatctacc atcgattttt atctatttgt acctcagcct     50340
     gcccgaatgg tcatttgatg attcaataat atacaatgtc ctgacctata catatcactt     50400
     agggcatcac ttattcactt taatcgagag tgtttatatt ggaaacgtac atgacatcgc     50460
     aatgtcagca ttaattattt aaatatttta atatattcct atcgcaagat aatgtctaag     50520
     ttagattata ggttcaacat tctgcaactt tcatatattt tttttttaag ctggttaaca     50580
     ggttagttta agtgtttgac gtaaccataa gagaattgat tcattttagc ttgtgtgtaa     50640
     tagttggcgg gaagggtaat tttgttggca tactcttctc tgctatttaa ccagggcttg     50700
     aataacaaat atggatgtga cattgacaca gttcataagc aaatatacaa aattgaggga     50760
     gcaaatttac gtaacatttt gtaaaattta cgtgtatata taatttatca ttagcttaca     50820
     atttttatac tcgtagaatt gcacaacacc ataattaatg cataaaatct ccatttataa     50880
     ttcaaaccat catttagaaa ttaagagatg accatatgta acatgttagg gtagatgtga     50940
     ttatggtgct aaactaaaga agaagactag attgttggaa cgaaattaga actcacggaa     51000
     cacgttggca tgtccaggag aatagttatt tacatgacat cattgatagc ataaaaaaca     51060
     tggataaagt taataacgtt caaatggtca ccataattac aacaatttcc tttaaagcat     51120
     tcacaacaat ttctgatcta gaatggttat atctactcga atttgaatgg aaaaaaaata     51180
     aaaataaaaa taagataaaa gagtcaacct tatgtccaat tcaagataat tgttaaaaaa     51240
     acaatccaaa attcgatttc agtcgttcat aatttatatt caattgggat ttgggatcaa     51300
     gataaaagag tcaaccttat gtttttatga gaggctagag aaaaaataga ttatgattaa     51360
     taaatttgat agaagaaaca gagtaaaacg ttatccacag gccacagctt gcacgtaagt     51420
     aatacctata cattatcgtt tattcgttat ccttttttct cttactaaac cgtatctctt     51480
     cgcttatcta catgtgtaat cctctacctc cctctatata tatacaaaac acaactttta     51540
     tcaaaaaaaa aaaaaaaaac tagaacagaa cacaaacatc tcgacaagaa ctctctgttc     51600
     tttcttatca aaaaaaaaaa gaactctctg ttctgttctt attgatcaag aaaccttttc     51660
     ttgtcctttt ggttaagact tcaaaagaaa gatcaaatca gaatctaaac ataattgaca     51720
     aaagaagaag agatgaacat tcgcgatggt aatcttattt cgactacaaa agaagaagag     51780
     ggtgttattg gagtttcagg atcctctgca aaagtttcat cttcatcttc tatctctatg     51840
     tgttcatctg atttaacaga ggatgcttct tcttcttctt cttcttcttc ttcttcttca     51900
     aatgggcctt tcgacgatct ttcggacctc atctctcagc tccctatcat gtaatgacac     51960
     taaatctctg ggtgaaatat tatctcacag tccttattct ctttgatcgt tccatcttgt     52020
     ctccatagac agtgttaaga atttgttttc ttattgtctt tgtttttttt cttacagtca     52080
     ggtcaagaaa ggaggacttt caaagtatta taaaggcaaa tctcaatcat tcacatctct     52140
     agcaaatgtc acaagtctac aggatcttgt gaagagagga tcaagaacga agtcatgctg     52200
     caaaagggat tatttctatg gaccaaaggc aacaatctcc atgaaagcca cgagaacatc     52260
     ctcaaaacat tcaaattcaa gattaacctt taaaccattt catgattcac ccaaatcagt     52320
     tcaatgacat gacaaaacaa ccttctgggt tcagtttaac attgtattca tttgtataca     52380
     agtttgcccc aagctaaatg agaacagaga gaatttaggg ccaaataacg ccttttacac     52440
     taattgtgca gaaaaattgt caaaacgaat taaaaacatt ttcctttggg tcgtttactt     52500
     gtgatgtgat caaatcttgt aaaccggagt gattccaaga aggtggaagc atttccgcat     52560
     gactatggcc gttgcttcac aaagtaggag acggcttgtc tcctctggtg aaccattgac     52620
     ctgtaaaaga tcatgtttta agtgagatca acattatagt ggttgattat gcagctatgc     52680
     agtctaatat cacaatatca aatgagaaat gtagagtctt gtgaattgca cacctgacaa     52740
     ttggagtaga atctggtaaa gtgttcagat aaattgtaga ggtactcgca cagaacactc     52800
     ggtaataagt tggtacaagc ttcctccacc gtctgcaaat tgttcacaca tgagtttcaa     52860
     gttcatcttg ttgccgagaa aaagaagcca aatatgaaag aagtatctaa agagagcatg     52920
     tgttacctca gcaaatcgaa gcaagtgaag ccccagtgct cgttcatctg catgatccaa     52980
     tgctaatttt cctgtctgca atgaataaga tgttgaaaca taagaattac tctttattgt     53040
     actgcgtatg gtaggaacta ataacagact tcgtaggtgt tcgacgatcc atatcttatg     53100
     aaaatgtgaa agatagcaca accaagaaac taaaaaggac aaaaaggccc agggtgtata     53160
     caaaatgaat cttgagactc caaaaaatta aatgctcact atagacactg gcattaactt     53220
     aaaagtttaa acacttctga aaattgttta agctttcaat ttcaaactaa atagtttata     53280
     acgtcgcatt tccttgatag agacaatggg aaagtttcag gggcagccaa gaggaacaaa     53340
     gaataaaatt cagcgattca tgttcatgca gctaaagtac ctttttcagc tcatctatgt     53400
     ctttgccaga ctttctgatg attgaacaga tccgagcatg ggcgtaaaga aggtaaacgg     53460
     ctgtatttcc ctgctcatga catatgatca ataaggttgt gtaggtgact gcaaaatgca     53520
     aatttgtaaa ctaggtggca aatttcagta ccttgtcatt aagcatttga tcaaagctga     53580
     aagtataatt tgttaatctg ttgttcttca ggtcagcata ccttgaaaga atattaaaca     53640
     aaaccgcaca ttagcttgta gccatgaata taaaccaact gtcaaaacat ctggcaaatc     53700
     attcatcata attgagcagc cttaattata aaacgtcacc gaaaaccgga agatactgaa     53760
     tagaattcac tattatcagc agtagaatag agatgatact tacttgaccg caccatatcc     53820
     aactgcctca gctgtttggt ccagttcttc cggtgtccat tctttgtcct tacctaaaca     53880
     gagaaaaaac atgtaaggat taatagacca aataataact caacaagtga tggttcaaca     53940
     tttcaaaacg tagagagttt taagacaaag ttagataccg cgctcaataa gggcaagttt     54000
     actgcgagtc ttggcctcat ctagcaaatc aactaggcgg actacatctg ttgcccgagt     54060
     tctaaatcgc ttgccatctt ccccaaggac gagaccaaaa ccaacatggt taactctagg     54120
     gtaagtttta tcattgtctg gaagccaacc tgcttttctg gcagcctaat tcacagtaac     54180
     atgataacca cagttacgac tgacagtttc agtcaataga aaatatttca caagacgtca     54240
     aaaacaataa aatattcatc aaacctactt tgaagaacat attaaagtgc tgctgctggc     54300
     caacatcggt cacatatatg atccactcag ctttctcttc attgagccgg tacctgggcc     54360
     aggcaaaatt tagcaccagc agacaatcca ttgaacaata tgcaagttca gatcaaactt     54420
     cagtaagtac agacacggaa agtcataaca tgtgagatct attttcaaaa gatcactact     54480
     aaaatccgga tttcatgaaa taactaacgt aaagataacc caccaaagag cagtcagatc     54540
     tgttgaggca tagttaaaac caccatcact ctttacaacc atgagtggga tgtcgaagcc     54600
     ttcaaggaaa atcacacgag caccttcact ttcttcaacc aaccccttgc tattcaattc     54660
     ctcaattact ttagcaatat gagggttgta aaagctttct ccctgtcatg aattaaatca     54720
     atgcattttt cattacccat ccatgtatct ctttttccat tatatctcaa ataatgttgt     54780
     acaggtccag ctattacttt accttttctt caagctcaac tcgaaggcgt tggtaaacct     54840
     tggcaaactc agttcggctg atgtcacaga tcttagccca agccttacgg taaacaggat     54900
     caccaccctg cgccatagaa aggaatatat taagacttgt gagtaattta gatcttgcaa     54960
     ccaaaggcag ctgcaaattg agacactgca aaacagaata acacactagt gattatttac     55020
     ctgtagacgg accacagcct gttgtgcttt ttccttaaag gcctcgtcca gatcaaattt     55080
     atgttttgat gccttgtaaa acacctatca aacgacatct ctaaggttag aaactatatt     55140
     gctttggttc ttcacatgca agcatattat gccaatattg ctacataata aaactgtaaa     55200
     gcttgagagg gcatattata gaaggcagct gacctgaaga tctccaattg ctgtctcggt     55260
     cacactatct gtatcaggaa atttctcaaa gaggtactca attagcatgc caaactgcag     55320
     aataaaagca gcttttattt cgctgataaa tattggaaca caacaattac aaaaaaagaa     55380
     ccaaggtcaa aaaaccattt gaagagcaga aaagtagcta cctgtgttcc ccagtcacca     55440
     acatggtttc tgcgtagaac ttcaacatgt gagtactcga gcatgcgagc tagagtgtca     55500
     ccaatgatag ttgatcttag atgaccaaca tgcatttctt ttgcaatgtt gggagaggaa     55560
     aaatcaacta cagctctctt aaccgaaaga gtaggtgccc atgtgtcaac tccatcgatg     55620
     agcatatttt caatactctg caaatagatt aaaaaacaat tatgctaaac acacatttta     55680
     tttacatgag cactagaaaa ggactacaca attacaacag gagcacctta gccatccact     55740
     tagctgatag tacaacatta ataaagccag gtccagctac agagcatgat tctaccatct     55800
     cagaagtagg gagactctta acaagggcct atgtgaaaaa aggatcagaa taaaagttaa     55860
     agaacatacc aaaagccacg aaattataaa gaccaaacaa acgaacctgt ccaacagctg     55920
     gaggaccctt gaactgagta ccctttcctt taattatgga ccatagtccc attgcgttgt     55980
     tactgcagac aacaatatga tgtaagaata taatttgaca aagagaaaac aacttaatta     56040
     gaactataat ttcactgaac caagtgagag ggggagcacc attggtaatc tccaaatttt     56100
     ccaagagcgg aggcagccac caagggctca acactaggtt catcaggaac cgttaatttt     56160
     agagaaacat caaagagctt cgcgagttga cgtttcagat ttcccgtaaa ttcttcattc     56220
     tgtcaaaaag aaattagtca tgaaacaggg aaataagaat gttataaact ttctcctgga     56280
     ttttaaaaaa aaactgctga cttacagctg ccattgctac cacggactta gctctggatg     56340
     agaaagcaaa tctccaagcc gttgctctca atttttctgt ctaggttaca aaaccccaaa     56400
     gcgaaatcag tacatccaaa ttgcaattaa aaaaaacaaa caatgaaact ttgattgtaa     56460
     gcagtagatt gctcttcttt attggagtta catcaaatca ttgatacagt gcacacaaac     56520
     cgtgttgaaa tataaacaaa aatgaacact taccctcttc agcatttcta tagaaactaa     56580
     aacgaaaacc acgcaaacac aatatcattt cgcaaagttc caacagttag aaaaaaaatg     56640
     agcttagcca agaataagaa tctaatctca acaaatgggg agaatgtagt cgagcagaga     56700
     taaaccacaa gtagagagaa aaatggagat aagaagagct cggagagagg attttaccag     56760
     ttggagaaga agaagagaaa taagcaaagt gatgatggga acgagaaaaa cgattcaagg     56820
     agaagagaca agacggcggt ggtgttgctg tgaccggaaa gagggttagg cttattattg     56880
     ccatttccaa ttttctgtct ctctctttaa tttgtttccc tttttttatt tttttatttt     56940
     atcttctttt tttttttaat tgttcaggta attttcgtgt tgggccgaaa aaatattagg     57000
     cccattatgc cattaggtta ctgtgtttat taatgcgatc cgattcgttg aacatttagg     57060
     ctaaagttga acaaatcaac ggcgaatttg aggaagatta aataaataag aagggatgga     57120
     gaatcatacc acggtggtaa aagtcagatg atcggcggag aaacggagct ttgtcgttaa     57180
     agtttctctt ctgttttcgt cttttgggaa aatgaacata tgatgatgaa ttttaagggt     57240
     tcttttgatt atttatttcc ttgttaattc gttgaatatg tctcttaacc accggggtaa     57300
     tagacatttt gatcgacccg aacctgcaaa cttaattaaa ccgggctgga ctattcggat     57360
     agaccaacta aagcgcggtt tacgtcaaat tggctattca gaatctggtt ttcgtctgaa     57420
     cagatgaagc aaatatactc tcagaatcaa gcttatatta ttgatactga agaggcaact     57480
     gcatatagat gcaagataaa caccaagtga cattaaggta agaaagtagc acctgaagga     57540
     ttagaccttt actttcatca tcagcaagag gagatgagga aaaactcatc actgactcaa     57600
     ggatggagtt tctaatgtaa atttgagcat cgtcttctaa tatcagttga tctacctttt     57660
     tccctctgga tgactcaaaa tcgtctggat aagcgagaat atataggaaa gtccttgctt     57720
     tccatgttga agctttcatg cctcaagaag ctcagcaaag ttgggtgagc tctggacata     57780
     aatctgaaaa gtacgaccaa cacaacactg tccgttgata cggttgaagg acacggcggt     57840
     agtgtttgaa ggcattaata ggtgttgggc cgaaaaatta ataaatcata aaaattaacc     57900
     tttatgattc tgaaatcttt gtacacaacg gaagtcttct tcatatagaa cttgtgacaa     57960
     tcgacacaag tctcagaagc tccgagatta tgagaactgg aataataata gcaatagctt     58020
     cataaacact aaacccctaa tctttctatc aaacgtttct caacatatcc gatgtatcct     58080
     ccataggaga agtattaaac gactacgcaa tagtttcatt tgttgtccct gtaatgagcg     58140
     aaagcaagaa gaggactaac gtgagcaaag cccatatcaa caacaatgaa cagagtaatg     58200
     aatcaaagag ttgacttaat aatacctctt aacaaaagag tcatcctcag tgtttatcac     58260
     aatcttttca cctgcctcga gataagatgg tacctgaggt attcaaggtg gaaccaagag     58320
     ttattttggt atttagatga accagactag ttcctgttac atgaaatttg aagatcaaac     58380
     aatactaata gctccaactt cctagaacga catcttacct gaatagtgga accattatcc     58440
     aggagagctc tcttgtacct gcattttaag aaataaggcg ttttctcata acttataaac     58500
     gattgattca tggtgttaag gaaacaaaat ggtacatgtg ttaaacaaaa tggtacatgt     58560
     gttaatcaat aatatgttaa acgcttatac cgtatagaga aaaagcgttc ctgacttttg     58620
     agaaaaagga cataccgagg agctgatgtt aggcctttca ttggaagttg tgtttctaca     58680
     actgtgcatg tgatatgctt agggatagat gcagataaag ctcttccatc atacagctgc     58740
     aactgaactt tcatttcctc tgtcaatcac gaggaaagaa gggacaaaga gatacatgac     58800
     aaatatgtta gtatttctag cacatgcact caacttgctc aacaatgact gtctgcactc     58860
     aagagtatcc atattgttgt tgagacaacc atcaacaaag gaaataagta tgacatgcac     58920
     cacgaaagat atcatcttgc taccaacctt ttaaatatac agcagctttt ccaaatatgt     58980
     ccaatggcac ttcaacttgc tcaaacgtat taggcctgtt ggatttacat aatcaaggaa     59040
     atcaacttta gcaacacaag atcctacagt gtttaagttg atataaaaca ggtaatgaga     59100
     ttacacaaaa aaatatggac tcactcaatc agatatgcag tatctccctc tgcatacaaa     59160
     cacgtgaaag atttctcttc aacaaaaact tctgcagtaa attgatgcaa tcaatcaata     59220
     tcacaaaaaa agtaatcgac ctatcctacg atgctaatac caaaatggtt agagaaccca     59280
     aaaaaaacaa cttttagtag gtaactgatg aattaacact aagctatgga ataagcaaca     59340
     tactctcaac cgactcctca gatccaaaac gcaagttaag cttattccca gtgtcaacat     59400
     cacgaagctc aacctgtttt ccacagagaa gagagtttag gctaagagac ggaatatcaa     59460
     caacagaaaa atatgaaata atcgatcaaa acattagact gttgattaaa gagtttcagg     59520
     tatgcatacc tgtatggaag ctcctcctct accttgttgc ttatgctctg cttctacaac     59580
     ctacaacatc aaacaaaaag ataattagcg tttctcaata cctggaacta aaaaaaactg     59640
     aaggtataaa accaaacgtc caaatgacta acccgaaaag tacgccctga atgtgcaatg     59700
     gtccatcaaa attttgttaa atcatactca tccaaaaacg ttcagatgta aggagaaaac     59760
     ttcaaaaagc taacctgttc gctcaattac atttcctgcc cttagctgaa attaacaaac     59820
     caagaaatca gagtgcgaac atggacacag atcatcttta ctcgtgtgag ctcaaaaagg     59880
     ttcaataata gtttattcgc tagtcaaatg agtaagaaac tttaatctct gcagttaaac     59940
     tttacctgaa tcgcgttaac cttaacaccg cggcgttgca gagcagacca cggagaatga     60000
     agcggaggcg tttctcggca gcatccaccg gcggcgtacg gggttgatga caacaacgac     60060
     ctgctcaaag aataaagaga cctcctagtc gttactgccc caggagaagt ggcattagag     60120
     aaggagaaga gagatcgaga gattgagatt ctcttgaaat ggtgcagccc tctcatctcc     60180
     gtttaaccct tgcaatcgga aaactgattc tcgctcgcta ctccattgat cgagaaaaga     60240
     attgaaaaaa acaacaaaac aacacggcgt cgtttgctat gctgacgtcg caaggacgcc     60300
     gttaagacag aactaatggt tacggcgccg ttttcgatgc tgatgatccg gagctaatgg     60360
     gttcgtttca cgagcggaaa gacggacaag gccttctaat tataatgggc cttaaaaagt     60420
     agcccattaa acttgttata ctttcttcaa atacttgaga tgaaagcaac tgtcatgaac     60480
     aaaaaaaaaa ttcaatacat tcttgaagtt caaattctat ttatacagat tatattaata     60540
     ctacttttct tagaagatgt catgattgta aagcttacaa gttgtttgct tgttgtcccc     60600
     ctcccactat aatgctttga gattaagatt tcaactagtt taatttttat ttaatcacca     60660
     aactattgaa ataatatgat tactactaac agcaactaat gatttctcaa aggggaaaaa     60720
     tgttatttaa tacttgaact ttcaaaaaat ggccaaatta atcgtgcatt cttgaaatgg     60780
     tcgttttata cctcaacaaa aagttgactt ctaatttaac ctataattta tcgttgattt     60840
     ctaatttaac ctataattta ttgttgaccc ggccaaatcg actcaccgtt aacactcctt     60900
     aacagcgctc ctaacagccg ttacaaaaca tggcctaaca gctgttatcg ttggtttaag     60960
     gacgaaaaca gttgttagtt atgctgttag gagagctgtt aagaagtttt aacggtgagt     61020
     cgatttggct gggtcaatca taacttatag gttaaattag aagtcaactt tttgttgagg     61080
     tataaaacgg ccatttcaaa aattcacggt aaatttaaat attttttgaa agttcaggta     61140
     ttaaataaca tttttccctt tctcaaacta cattcttttt tttaaatgat tttgtcaaag     61200
     ctacgctgaa taaaaaaaaa gtgaccgaga taattttatt gattcaaatg tggaaaatct     61260
     tagaacagta cataagaatg aaaaccgaaa taaaaaaaca agaatatgat ttttataaca     61320
     ttaaaaagac aaaaacaaat ttgtctagaa gagaaaccca aaggccaaag tggctaccga     61380
     ggcgaagaaa gcggggatgg ccaaggaagc atcggaggta ggactcggag ctggagcctc     61440
     caccgcggca gcctgttgca ccgcagagaa agccatcgct gccaccaaaa ccgccacaaa     61500
     gagtctcatc ttcattgcct ccattgggtt atctctaggt ggttcttgag aaagcacgaa     61560
     gagactatat gtttagtgtt ttgtggtgtg ttttgatgtg ttgtgacttg tggtttatat     61620
     atacacatag atgcatgtaa ggccaactgt gtaattatca ctttacagtt tgattaacac     61680
     atcaacacaa ttaatcattt tcgaattgtt ttaattcttt gtatttggtg aacaaaaact     61740
     ttattagcac atcaatctct gtaaagccaa ctgagatctt agttgaaaaa gaaagaaaaa     61800
     ataaacagtt ggaaagagta ctgcagctga ttttagttat gtcatcgcct tttgtttttt     61860
     attgtagaaa tgaatataat atgttttagt tctttgtatt ttttaactaa tacagttcat     61920
     agtaggaacg ttttctctct gataataaga gtgaaagaaa taggaaactg tttttttttt     61980
     tctgtgacgg tcgtgaaatg aatagaaaat agataagaga agcaatgagc tgtttggaat     62040
     ttgattgatg gttccatgtg ctctctggta tataattggc tcaatccatt tctcccccaa     62100
     ttattgctca atattcgatg aaacaagaac ttataaacgt aagtctccat tttataagag     62160
     aacataaaga tgaattaggt attttctaac aaaagtattt atcatttttt gtacttctac     62220
     attttgaaat ttatctgtta ttctttaagt tttagaacta cgaagtgcta tcatttaatc     62280
     ataaatagtt tcgtcacgct atcaaactta gttccactat atttctctga ttagcaggta     62340
     caagctcatg ttattgccta ttgcccatac acagtactgg ccatacaaga ctttcattca     62400
     aaccaaaaga aataaagaaa tgaagaaccg tgaaactctc ccatttacac tagccttttt     62460
     tcttggaaga caagaaacca aaaactcacc acaccaaacc tagagaccca agaaagttag     62520
     cttaaaaaca aacaccgtcc ttgatcttag agttgattat atctggatac aaatccataa     62580
     cgattgagac ttgctattaa atgaaaaatg aagatatctg tctctcgcag agcgctcaag     62640
     gagtacagac attttaacac caataccgag gtagctactt tcaataccac ttaaaccgga     62700
     tgattaactc aaaacctctt gatctttact catttttttc cccagaagtt atgaacgaac     62760
     acaaaacaaa tctaagacag caacatttgt cttaaacatc tcgaggtaaa accgaaatga     62820
     tggtctaatc atcaatgact atacttcaaa aaaaaaaaaa aaaatctaga catattcaca     62880
     tggatacaaa ctgtaatcaa gaaacgagat tcaattttcg gcaaatcgca agaactacat     62940
     taagaacaga gagaaaaaag aggaatttta caaaaggaaa aaaaaatgaa aaactttaca     63000
     atgaagataa cattatcgag tttgatgatt ttgatcactc aaaatgcaga cgaaagtgat     63060
     gctgatatgt agcgatggaa gaagaagagg aaccataaac ataaacgtga tcacgatcgt     63120
     cttccgcagt ttcaggatag agcaaacctg gagaaggaag acatagacaa gtcaagagac     63180
     ataaagccaa tcgacctaat tgctggagcg gaaagaagca gactagctca agcatctctc     63240
     ggctgcttat acgatcggac ggtgggatca atcgtaaacg ctgccaaatc tcagccgaca     63300
     aatgggctac agacataacc gtctggccgt tgaacaccat gttcatacac acacagaaaa     63360
     aaaaactgta actgaatgat gattccgtga ttttcgttca atttgtctgt gtatgtgtat     63420
     acaatgtaca gaggtcgggg gcttttctag atcttgccac gttgacttcc atgtttagtc     63480
     atcatcattg atcgaatagt tcctaatcca tttttaaaag tattttattg attaaacaac     63540
     taggaaataa tcaaatatga agcctttttt gagttagtat ttgaacaaaa ttaaaggatt     63600
     ctacactata tttcgtttcg attcttcaac aataagaatt cttgcaaatt attagaagta     63660
     aacctaccgg agatctgtta atattagttc ctttttaatg tatttttggg ttatgttctt     63720
     tagtgaattg atgaaatatt atgttaactt ctagttgaag tgagaatgat gagactcgca     63780
     agctaatgtg tctatagaat tcaccttaac ccattgagct acattctcta taggtttcac     63840
     ctaaattgca agttaccact ctttgttcta agtaaaactc tacaaaggaa cattcctaag     63900
     ctacttattg atcctaacaa tttgttatag cgttgatgat aaaagttaag ctatacataa     63960
     caaatggaga catctttcaa aacaggccta ctgttagagg aattagacga tctagctatt     64020
     aacaagttta gacctaaaag tgagaatgat gtggctcgcg agcctatgtc ttgttgagtt     64080
     tgtcacaatg attgattata tattattaat ataagcttga gtttgaatta gttataagag     64140
     tgtgagtgat ttgtagcagc aatatgtgtc aaactagatc tttctccggc cgtataacat     64200
     caatggaacg acttcttggt tggatctttc ttgctcttac attactactt cactcatcaa     64260
     ttcaagcaac aacatcaatt tctcatgtaa atcactaatc attaatcctg tgcatgaata     64320
     taccttttca tttgcagaat ttctttatgt ttggatttgg catgtcttcc aggtttacgt     64380
     tgtatattta ggtgctaacc ggctaaaaaa cgctgctttg gcttcaagcc accaccttca     64440
     tcttctttct aaagtcttca caaggttacc ttcttcaaaa ctcatctctt ctacagtcct     64500
     ttttttcttg tcagtcaatg atctcgtcca tgaatttttg gagatgtcgt tgtagcaaag     64560
     acgatgcgga acaatccatg ttgtacagtt acaacaatgg cttcttaggc ttctcagcaa     64620
     aactcaactc aacacaagct gcttctttag caagtaatac ttccatcttt atattttggc     64680
     ggcaatatag ttctcatcat taaagaaatc ggtttggttt tggttatcct tgaataacga     64740
     actttttatc ggaaccaata aacatgtaat ctaatcgaac cagttccatt tcgttcagtt     64800
     acactaagac cggtttggtt aaccgggaaa ctattgtaga attgaaccag gtcataacgg     64860
     ttttcaagag caaaagcttg aagttgcaca caacaaggag ctgggatttc ttaggtctcg     64920
     ccgttgacaa tgcccgtcgt actcctccgc cgcagctcgc ctatggatcc gacattgtcg     64980
     tcggaatctt cgatactggt ctcttgttta ttcccgactc ttctttgttt cagggctctc     65040
     attttgagca tttcattgaa acttttgtta ctttcaattt taggaatctg gccggaatcg     65100
     gagagtttca gggaaacgcc ggaggcgaaa cctatacctt cgtcatggaa cggaaaatgc     65160
     gtcggagggg aagactttga tccatctgta cattgcaatc gtaaattgat cggtgctcga     65220
     ttttacctca gaggattcga agagacgtac ggaacaattg actttacgcg agatcctgaa     65280
     taccgatcgc cgcgagatta cctcggtcac ggcacacaca cagcttccac cgccgtcgga     65340
     tccgttgttc gcaatgtctc cggcttcttc ggtcttggac gcggcactgc tcgcggcgga     65400
     gctccattgg ctaggctagc tgtgttcaag acgtgttggg ggaaggatct ggaaggtgtt     65460
     tgcacggagg ctgatatctt agcagctttt gacgacgcca tccacgacgg cgtccacgtg     65520
     atttcggcct cttttggcta ttcgccgccg ttatctccgt ttttcgagtc gagcgcagac     65580
     atcggggctt ttcacgcagc ggagagagga atcagcgtgg tgttctctac cggaaacgat     65640
     ggccctgatc ctggtgttgt tcagaatgtc gctccttggg cggtttctgt cgcagcttcg     65700
     acagttgatc ggagttttcc caccagaatt gttatcgacg gtagtttcac tctcacggta     65760
     ctccccttaa atcctgtagt cagagtcaaa ttactgaaag attgattctt gttagcctca     65820
     gaattagaaa gaacaaaact ttgaataatt caatctttca gggtcagagc ttgatttctc     65880
     aggagatcac tggtacatta gctcttgcaa caacgtattt caatggaggg taattgctca     65940
     aaaatcttct aaaatgttgt attcgaattc aattcgtgtc actttctata catttttaga     66000
     agacacttgc aaatccgtag cttattagca gcattggtgt ataactgtaa ggactgatat     66060
     gtgcagggtt tgcaaatggg aaaactggat gaagaaattg gccaatgaga caataattct     66120
     gtgcttttct actttgggtc cggttcagtt cattgaagaa gcacaagctg ctgctattag     66180
     agcgaacgca ttagcgctaa tatttgcagc ctcaccaacc agacagctcg ctgaagaagt     66240
     agacatgatc ccaacagttc gtgttgatat tcttcatggg actaggatta ggaactatct     66300
     tgctcgttcg cctacgtaag ccacattatt cggttataca ttttgtttcc atgcgctgag     66360
     ctaaaaaacg gttagagaaa agaaactcat aagaattctt ttggtaaaaa tgaagagtgc     66420
     caatggtgaa aattggaccg agcaaaacgg ttatcggaga gactacagca ccctccgttg     66480
     catatttctc ttcaagagga cctagctcac tatcacctga tattctcaag gtacaatcat     66540
     ctactttttg gttcattcag tctgttgcat caagttgtat gtttgagaat gcaattgtgt     66600
     tgaagtattt gagatatagt gagtttaaac cagaaccaaa tttgtcactt tactgaatat     66660
     tgtttttttg gtgtatcgat ggtttatgca gccagatatt acagctcctg gcattgggat     66720
     attagcagca tggcctccta gaactccacc tactctgtta ccaggagacc accgatctat     66780
     tgagtggaat ttccagtcgg gaacttcaat gtcatgtccc catgtggctg gagttatggc     66840
     gcttctccag tcagctcacc ctgactggtc accttctgct atcagaagcg ctatcatgac     66900
     cacaggttct atttctaata ggccctcctc atatgttgtt cttacaaacc caagtctgat     66960
     attgttatat cttatttccg tttccagcgt atacaagaga cacaagctat gacttgatcc     67020
     tctctggtgg ttcgatgaag tccactgacc cgtttgatat tggtgccggg catataaacc     67080
     ctttgaaagc catggaccca ggtctggttt acaataccag aaccgacgac tatgtgctct     67140
     tcatgtgcaa cattggctac acggaccaag aaattaagtc catggttctc cacccagagc     67200
     cttcgacaac atgtcttccg tctcactcgt accgaacaaa tgcagatttc aactatccgt     67260
     ctattaccat accgagcttg agattaacca ggacaataaa acgtactgta agcaacgtcg     67320
     gtccaaacaa aaacacagtt tatttcgtgg acatcattag acccgtggga gtggaagttt     67380
     tgatctggcc gcggattctg gtgttctcga agtgccaaca agaacactca tattatgtta     67440
     cattcaagcc cactgagatt ttctctggtc ggtatgtatt tggggaaatc atgtggacaa     67500
     atgggttaca tcgagttaga agtccggtgg ttgtgttctt gagcaacgct ggttttcttg     67560
     caagcagtta aattagacgg aaagtcacta ccgtagggct caagttgaaa gagctatggt     67620
     ttgtttcttt tgtttgagat ttcccgggca cactttataa ataggaacta taaaaaattg     67680
     ccacaactgg tgaaacttgt ttagtgtatt taagcatttt taccaagcac aatttacgat     67740
     taatgatgat ctttagtctt ctttaccatc aataatccaa agcctaatgt taattacagt     67800
     gacaacggtt tggtttccgt ttaagtttgg tgttggttcc ccctgaagaa tttgggtcgg     67860
     tttatttctg gttccgaatc aaattggttc tcgtcaaatc aacatgtttt atgataatct     67920
     aggattctag ggtttcttgg ctcctctgtt aaatcctctc atgaaaattg aagattggag     67980
     tttgtacgac ttggccaaaa tcttatgatt aaaacagttc aacgagtcag cttctgaatc     68040
     atctggtctc atccaggaag cactaaggaa cgagctacga cggtaactcc cgaacaaatc     68100
     aacttgtata agtttttgtg ataactataa atgtaagctt ttgttttgtt ttatgaactt     68160
     ctttaggttc tctaatccaa tcgtagactt gtcctttggc cactagctga aagtttggga     68220
     atcgagagca ttggttcaca tggaccgtat tagtcaactt tcggatgatt tgctcttgca     68280
     aatattgtcg tttattccgg gaaaagatgt tgtggccaca agtcttttgt ccaaaaggtg     68340
     gcagtctctt tggatgttag tttcggaact tgagtacgat gatagctacc acactggtga     68400
     ttataagagc ttctctcagt ttgtttacag gtctttgcta tcaaacaatg cacctgttat     68460
     aaaacatttg catctgaatc ttggccctga ctgtcccgct atagatattg gactatggat     68520
     tggttttgct cttactcgcc gtctgcgcca gctgaaaatt aatattcgta cttcttccaa     68580
     cgatgcgtct ttcagtttgc cgagtagcct atatacctct gatacattag agaccttgag     68640
     actcatcaat ttcgttctat tggatgttcc ttcttcagtt tgtctcccgt ctctcaaagt     68700
     tctacacctt aagactgttg attacgaaga cgacgcatct cttccaagtc ttttatttgg     68760
     ttgtccaaat cttgaagagt tgtttgtgga gcgacatgat caagacttag aaatggatgt     68820
     cactttcgtg gtgccttcct tacgacggtt atccatgatc gacaaaaatt atggacaatg     68880
     tgatcgatat gtgatagatg tcccttcttt gaagtacctt aacattacag atgacgcagt     68940
     ttacgacgtc cgtcaaattg agaacatgcc tgagttggtc gaggcacatg ttgacattac     69000
     tcaaggagtt actcacaagt ttctgagggc tcttacttct gtccgacaac tttctctatg     69060
     tttatcactc tcagaggtaa tattattgaa tctgttttac atattattat tcctctcaat     69120
     atttactttg tgttgttgtt gtgtatatta aaaaaaacag gttatgtgtc cttctggtat     69180
     aatcttcagt cagcttgttc atctgaactt gtctacagtt gttaaaggtt ggtgggatct     69240
     tcttacttct atgctccaag attcccccaa actccaatct ctcaaactca tcgatgtatg     69300
     tgatctctat aatatgcttt tatctggttt agtttcccaa tataatttga cttataactc     69360
     tgtctgatat gttggtctta gaaacaacat gagtcgggtc tttgtgggat agaaacccca     69420
     attggttgga agctgccgag ttctgttccc gagtgtttgt tgtttagtct agaggcattt     69480
     gagtggattg gatacaaagg gaggcgagga gatagagagg tggcaacata tgtcctaaag     69540
     aatgctgctt gtttgaggac agcaaagttc tctccagagt ctactgatgt gggagagaag     69600
     tatcatatgc tcaaggagtt ggcatcagta cctacagctt caacttcgtc taagcttcta     69660
     ttcgactgag aatagtaata tttaggtttc ttggtatctc tcgtttatga tttgtgttta     69720
     gtttttgcca agactggttt aacaaaaaaa aacgcttgat gaaccatgtc aaacccagtt     69780
     tgcttctctt atgtaactca aaactcaaaa agtgtgactt ggcgtctaat agttttggta     69840
     atgtatatct caaacgaggc atgaccatct ctgtttttag attgtgtcaa tgacacacag     69900
     cttctgatct gattccctga aacattgcac agctttacca tcttctcatc tatgtttgac     69960
     ccagcatatt aacgttcgca aatgattggt gacttcaaaa ttagcacaat ctgtatgtaa     70020
     cttaattaca aaatggtaat ttggcattgc accaacacag tattttgccc ctatatctct     70080
     gattagggtt ttacttttca ctgaaacagg cctattcctt ataaacggcg aaagaaagag     70140
     aggttttcga ccagggtgga cacgaaacga atattcggga ttttggtagt atttgtggtc     70200
     caatttgcta cgtccgaata gttaattttc tgttttgtat ttgcttcgaa agtaaccgaa     70260
     tatcctgctg cccagctatc cgttaaaatc tgagctattt gtcggatatt cgatttttta     70320
     tatttcatta atatatatat attaaaaaat attaaaagaa atcataaatt taatccaaaa     70380
     taagtaatat ttcattgatt ttttatttta ttttaaaaac taaaagttta atttgatgaa     70440
     aataaactta tatataaaaa gtgtaacatt attaatatat atatgtaatt atctataaac     70500
     atatatatat ttataatgga tcggagcgga tatccaccta tttaaatttt attatttgtt     70560
     atttgctctg cttttaacga atattacttt tcaatattta atttacctca tacacttacg     70620
     gatatccaga tttttcgaat caaatcgaac cgaataacgg atcaaatcga aactaacaaa     70680
     tattttgcca agcacgaatc tttagttcgc gaatttaagc tcctggttac tttcttctag     70740
     ggttttctat aattatgatt cctctcgtct attctagtcc ttaattagtc gccgacgaca     70800
     aaaagaaaaa aaaaaaccta gaaagcttga caaacaagga acgacgcata tctccaaaca     70860
     atcagtgtaa tttctgtgat tctctgtttc cttttgttgt gtctttgatt cggatatttg     70920
     tttatcctca agtctttcat cgtttggttt tgtagtgttg acatggacat catcagtcaa     70980
     tgtccggatc acttgctctt gcgaatactg tcatttattc cgacaaaaga tgtcatcgtc     71040
     acgagtcttt tgtccaaaag atggggatct ctttggagat gggtgccaaa acttgaatat     71100
     gattttacaa gacaaaacat gagattcgtg aagtttgttt acaggtcttt gctacagaat     71160
     aacgctccag ttctcgagag cttgcatctc aagaatatta tcctttatgc tgaatgtcgt     71220
     accgtagata ttggaggatg gattgatatt gcagttagtc ggcgtgtgcg tgagctggaa     71280
     atttctatta attgttcgga tgaaaaattc agattgccta gtagcctata tacatgtgga     71340
     acgcttgaga gcttcatact caccattaaa cattgccatc ttgtggatgt tcctttagcg     71400
     gtctgtctcc cttccctcaa aaaactacac cttaggtgta ttggttgggc atacaacgca     71460
     actcttctta ggcttatatc cggttgcact aatcttgaag agttgcgttt agcacgacct     71520
     gatgatgatg gcgactatat tatgatacat gaggcaggca gtactataga ttatatgtcc     71580
     atctttgaaa gaaggtatat gtttgagttt atgtttgatc aaatgtttgg aaagggtagt     71640
     agtaatggga tcaatgctcc tttgaaatac ttttctattt ctaataatta tcgtatccac     71700
     aacttccgtg ggattgagaa aatgcctgac tgggtcgagg cacgtattgc ggttactggt     71760
     ggaagtcaca agtatctgaa agagattact tatgccaaag gcctttatgt atgcttatca     71820
     gtctcagagg taataacaaa tcttgtgatt tatttacata tatatatatt actgttcctc     71880
     agtaataata tgactgatgt tgaaacaggt tatgaatcct tacgacatga tcttccacat     71940
     gcttgttgac cttacgatat gtacatgtac tcaaggttgg tgggatcttc ttactcatat     72000
     gctccaaggt tcccccaaac tacggtttct cacactcacc aatgtatgta ttctttttat     72060
     ttacttttag tttggaaaat atgattttga gaaatgataa ctaagtctaa gttgttctta     72120
     attggtatta ggaccattgc cgagaacttc ctagtttaga gaccccggcc tgctggaaac     72180
     ggccgagttc tgttcccgcg tgtttgttgt ccagtcttca agctttcacg tggagtgggt     72240
     ataaagggag acaaggagat aaagaagtgg taaaatatgt cctgaggaat gctactggct     72300
     tgaagaaaag gattttcatt tcaaaatcaa atgattttgg agagaagttt tgtatgctcc     72360
     aggagttagc atccgtacca acgccttcgc catcatgtca gcttctgttc gaccgaatat     72420
     tttagtctgg agatcagaga tcttgttgat tcttagatat ttgctttctt gctctccaaa     72480
     accaagtatt aaagaatgat tataatggct cggtttactt gtggtttggt tcaatttgtg     72540
     tgtttttaac ctataacatt ttagttcggc ttactaattc aaacttgttt ggcctgagtt     72600
     atctgagaat cgataataca atcagatatc tgatcagtag ataatgtttt cagatggaga     72660
     tcatcagtca actgccggat gatttgctct tccgaacatc ttgtctttct ctactagaag     72720
     tatagaagag accttttttt tttttttttg ctaaaaatgt taattttcat tatatgaata     72780
     agaggctttt acaaaaacga aaggcctata caagagtagc cgaggcaaaa aataaaacaa     72840
     ggctacaata gagattttgg gaagatataa ggttagcgaa tccaaagcac catgaggttg     72900
     cgccatctct ttctgtggta acgagaggag atgatgttac gaatctcgcg gtcgacaatc     72960
     ttgaagatga taagaggtgc gatcctaaga ttgttatgga ggacattgtt gcgctgacgc     73020
     caaatgttgt agatgatagc atgggctgag acttttctga ggagggaagg cgccgaagta     73080
     gaggaagaac gcatccaaga gaggagctct gcccaagagc aaaacagcct ctgtcgcgga     73140
     cataagcgag aaaacgctaa tctccaaacc tgagccgcaa attcacagga aaaaaggaga     73200
     tggtctctgg actcagtctc aatagtgcat aagcaacaat cgaaagactg gatatggccc     73260
     caagaggcaa gcctttgacg agttgggagt ctatccaact gactaatcca catgttgaag     73320
     gcatgcttag gaacagcacc cttgaaccaa acagcctttg cccagtccaa ttccggtgct     73380
     cttggtctaa tagcatccca agtccttgcc gaagagaacc ttgacaaaca acaccgccaa     73440
     caacccaatc aaaggagtct tcaattgtag caggagaggg ggtcatgatg gtagagatgt     73500
     gttcatggat ggcttgagct ggagcagacc gagatagggg gagcttccag ccattaacac     73560
     caagagcctc aaccacccta gcgttaagag ggatgcgaag tgatctggag ccataatcac     73620
     ccataacctt tatcagcggg ccaagggaag tccaactgtc atgccagaag tgagctatgc     73680
     ggccattacc caagttgcat ttaacaaact gctccgccaa aggtctaagg aacaagagca     73740
     tacgccaaga ccatggatct gatggggaag gagccacatc ccaaaaagac ctgcttctaa     73800
     gatggtgatg agagtgccaa gaaacccaaa gcgaaccttg atgattaaag agaagccaaa     73860
     taagacgcaa acaaagcgtt ttgttccact cggagaatct tctaaggcca agcccacctt     73920
     cattttttgg gaggcaaaga gcagaccaag agacctttgc tcctctacta ccatcaatgt     73980
     ttcccgctca aaggaaccta gcacaaaggc tttcaatctt cttaatgcaa ccctttggca     74040
     gcaagaaagt ggacatccaa aagttgacga taccatagat aacggaagca ataagttgaa     74100
     ctctacctgc gtaagataaa caatttgttg cccatgatct gaattttttg gagatttttc     74160
     caggagaggc tcatattcag cgatgcgcaa cttcctacac ataagcggaa gcccaagata     74220
     ccggataggg aggcagcctt gcggaaaacc ataggccgcc aaagagtttc tctcagcctg     74280
     ctctagacca gcacaaaaaa aatgactttt gtcgttgttc acctttagtc cagaccaaga     74340
     agcaaagtcc tcaagagtct cacaaatacc gtgcaaggaa gaactaccac catcaaagaa     74400
     tatcataaca tcgtcggcga acatcaaatg agagatggag agatcagaag ctttcgggtg     74460
     gtagcgaatg taacctgagt caaaccgaga attgagcaac tttgagaaga cttccattgc     74520
     aagaacgaaa aggtagggag aaagagggtc accctgtcgc agccctttag cactcttgaa     74580
     aaaaccacca caacaaccat ttacagagac agtgaaagtt ggtgtggaaa tgcattggtg     74640
     aatccaatta atgaacttag tagggacccc aagagcaagc aaagctgcaa tgataaattc     74700
     ccaacgcacc gaatcaaaag cttttcgaag atctaccttt aacatacctc tcagagagat     74760
     gttcctccaa ttgtatccgt gaaccatctc agtggcaagc aagacattct cagcgaggag     74820
     ccttccaggg agaaaagctg attgagaagg agagataaca caagagagca gcttctgaag     74880
     acgatctgtg agaagcctag caatgacttt gtacagggta ttcatgcaag agataggtct     74940
     aaaatctgaa gtacaagagg cattaggaaa cttgggaatg agaacaatgg tagttgcatt     75000
     ccattgctta agcaagttac ccgaaataaa aaattctctc acagcagcgg tgacctaagc     75060
     accaatgcaa ctccaagctg ccttaaagaa ctcaaccgga aagccatccg ggccacaagc     75120
     tttgttacta gggagaccaa agaaagcagc cttgatatct tcatcagaga acatggcttc     75180
     caaatcagcc acctgagaat agggacatct gtaagtaagc agcaaattca tgtcatcttg     75240
     ctccaacgaa taagggtcgt tatcatcact caggagattt tcaaaataaa gagcacagtg     75300
     gtcagcgatg ccttgttgcg agtcaatttg ggtccctgaa tcatccacca aagtagtgat     75360
     agtgttaaca gatttcctgg aatcagccat tctgtgaaaa taacgtgtgt tgccatcacc     75420
     ctccgcaaac caagtcactc gggaacgttg acgaaaaaag ctctcttcag cagtggcaag     75480
     gatctgccat ttacgttgag cctctaattc atgagcagca ttttccaggg agggattatc     75540
     aagagtaaga ttttgaaaac tcaaaagagt ctcatgagcc tcctcagttc ttttttcaag     75600
     gtttgaataa ttcagcctac taaagtcttt gattggtttc ttcagagcct taagcttctt     75660
     tgacacccgg aacatagacg atcccaccac attagtcgag taccaaacat cccacaccaa     75720
     atttaaaaac tccgggtttt tcaacaaaaa gttaaagaac ttgaagggcc gcttcgcttt     75780
     gatcgggtct aattccagca caacaccaca agatgcatga tctgaaaaat ctggcggacc     75840
     aaacaaacca aaagaggatg ggaataagtt ggaccagctc tcattgacta agatgcgatc     75900
     aatcttcttt gcaaccggtc tagttttact tttattccac caagtgaaag agctgccttt     75960
     gtaaacaaga tcagacagtt cagcatccaa caaacattct ctaaagtctc ttatcctcct     76020
     atccacattg agtgaaacat gcctagagtg ctcatgagga tgaagaacct ggttaaaatc     76080
     tcctagcaag atccaaggtc tattaaaagt gaccggagaa gctaccaaag cagtgatctc     76140
     tctccataac tcttttctct tatcatcttc gttggccgca tataccacag agataacaat     76200
     ccaagtgcga gaattaggga aaagaacctc gcaagtgatc atctgcaacg atttggcaac     76260
     aataacaacc tcaacagatg ggtcccataa cacccatatc ttccctaaat ctgagaaacc     76320
     atagttctca tcaaaaaacc aaccaggcag cagagcatta ataaacttct tgtcctttgg     76380
     ttgcttcacg tgcttctcta tgacgcctcc aaaaataggc ctattgacct taaaccattt     76440
     tttaaagccg ttacgatgac taggaatgtt aaaaccacag gacattccaa caaaaaattt     76500
     gtgtacacat attaatgacc ttaaaccatt ctttatagaa gagaccttga ttttacttac     76560
     tcttgctcca agattcacca aaactacact ttctcaatac tagtcatttt atactcatta     76620
     aagaactttc ccgactaaga ttgtctgttt ggtcaatcta tttagatgat tggattccac     76680
     gacatatgta ccagcgagtg atgctctttt tttggtacct ggtggttcta tttacttccg     76740
     gttatgttaa gaattttgtg aactaatcat gttttttttg ggttagctcg cctctgccgt     76800
     gctcgaagtc tgactggttt ggctagagtt actgaaacag agtttatttg ctattgttta     76860
     aaatgtttag gctcatctaa gattaattta ggttgaacta atatatcctg gagagtttat     76920
     ggatgaacta atttaataat gagtatcaaa tatgagttgg tagataaaca gtagaaaact     76980
     aaggcctcag agatcttggt ggtaaaccaa tcatcaactg aaagaacaaa gttcttcatc     77040
     aagagtagca aatattttta ttacatcact ggcctcattc aaaaacaatt caaaagtgga     77100
     acttattttg ggaaatctat atcgatgatg gtaaaatcag aagtagctgg tttgtgatca     77160
     catctttccc gagggaattc aaagggaatc cgaacgattt ttttcgtcat cttttaccat     77220
     caaaaaaatt tatcaaagaa aatgtcataa aagacctcaa aaaacgtttt ctaaatcggc     77280
     gaaaaacaaa aaaggtgtta tgatgatgat gatgagtcag aagtagctga ttatataatc     77340
     acatgtttcc cggaggaatt caaagggaat ccgaatgatt ttttcgtcat cctcaccatc     77400
     aatatcaata ctgctccaca aaagttccaa tattcaacca aaaaataaac acaaaacatt     77460
     caaatctacg actaagaaga aaactacaga taaggctttg ctaatgagat cactaaaatc     77520
     gaatttcgca gaaaagataa gagatctaag aaagaaaacg ctaatctaga aaagagagaa     77580
     cgaataagcc gtgaagttgt ttgataaatc aagaagaaga gagaaaaaag ttatatatat     77640
     acgccgcgac gaagaggttt gactacgaga agaagcccta ataatctcta tgcttgacga     77700
     aacgctgccg tatcctcatt agctctcttg ggctttttgt ttttttggat gggcccatta     77760
     ctttatttat tccacttttc tcttattagt accgtgaggg ggcaaaacaa ccctgttcat     77820
     gaattggaac cataagcgga aaaaaacatc tatacgaaaa acctgattat acagctttgt     77880
     ttgttctcaa atatgggaca caagtgaagg aggaggatac aaagacagaa acatgaaaac     77940
     tactacataa attaatacta tcttatgggc aatatattaa tacagacatg agtatgctgt     78000
     gttcttagca ataatcatgt tgacctgcaa tggatagatt cagtctcagg tatcaaaagc     78060
     ttcggaccag aagcggtctg tcaagacaga gagcgacttt gtcgaatata taagatcatc     78120
     ggatcaacac tttgcctact agcgacttcc gacgaccaac atcttgaggt tgcctgcctc     78180
     ctaacgaaga tgcgggtttt gttctaattt aaaccgacac ttcttgcttc aattctaaag     78240
     cttgaggtgt tgatgttgtt gctctatcct tgacaaatgt ccttaggcat ccgttgatta     78300
     tgcgtggtgc tgatccatcg cagaaccgtt ttgcaagatc aacagccttt tatcacatca     78360
     tagttgttag ttagttcact acacaatcaa ggtcatcata ttgcaaagct gaccgaagat     78420
     ggatctacat ttaaagaaga cagatacctc gttaatgaca atcgggtgtc gggtttcaag     78480
     gactgccact tcagacattg ccaagtgaag aatcgaaaac tccaatattc ttccagctgg     78540
     tgcactctgt gaatagatcc agcaacatct ataaggcatt tattgatagt aagagatgaa     78600
     aaaatatgta gacaatcaca cagccaaaat aagaagctgc ttctagaaac tcaagctaat     78660
     tctaaagcaa ctgttgagct caggctgcaa acagctaata ttaatgagag acaatggaag     78720
     aaactgatca gcattgaggc tttgagtttg gtggttcatt atttttcaac tatccagtat     78780
     ttgaccggag ttgaagttca aatgttcaat ttataccttc caatctggcg gggaaatttt     78840
     ctcgatgata acgacatgac tatcccattt atcaactacc gcagccaaga gtttctttgc     78900
     aaacctttgg aaaaacacat agtgggaata aggtggtatt cacaatttat ttccgaatag     78960
     cagcaattac tacacattat atattttata gattaccgta aaacaagttt gctgtacacc     79020
     agctttgggg gagctgaaag cacttcggct tctgcaggaa aaggagaata aacaacagtt     79080
     cacatgttac aagatgggaa attcccatga gcccatccaa acaagagtct ctttgccata     79140
     tatgagtaaa gcagaagaga aaacttattt taagaataag agacctaccg attttcgatt     79200
     ctttttcatc atggcgcaca agctcatctt cttcttcttt tgtttctgtt ttaactgggg     79260
     gtcctccaaa gctcatgtgg ttgtattcca acaaagaact cttgtcaaac tcgtatccag     79320
     gctctgtaca aaccgaacaa tatgcattga agttatatca caagcagtta aatcacgaag     79380
     aatcaagcaa atgatccaca gaagttacaa tgagattcct acattcatga ctgtgttgca     79440
     gatggaaaca gaacatgata acaaaaaata cgtttggttg atacttacct cttcttgcgt     79500
     ttattctctt ctcaaagaga cgaattgggt cagagccttc taagcatgcg gcataaagta     79560
     ttacactgtc aatatcatcc agcaacatga tcagagaggg tagatacatc attcatattg     79620
     ataggagata atcatatcaa agttcaattt tttggctgaa atcaagtaaa aagagagaac     79680
     taatggctta atacttctac cctcgagaaa aattgactgt tgagtgaggc aaggttctgg     79740
     gtttagggtt ttaggttaaa ccttaaaacc cagacaatgg aacactaagt tgagacttat     79800
     tcttgtcaca ccaagccgca tagatgactg aatcgtttcc aattctagta aaggcgaatt     79860
     ttcatttgca gctaaaattt ccaatttttt tcaaatcaac gaaacgatta cgatttcaga     79920
     aacgcttaaa gtgagaaaac gaagcttaca gagcgagctc gcgtgcggct cgaggactgc     79980
     ttaatcggcc gctcttatca atcttcggca tcgggacatc tttcacctcc tccgcggaaa     80040
     tagtcggcgt acggagagcg cttctagtcg gagagagaaa tagccgtagt gaagacgatg     80100
     acgaacgttt atttcccgtt cgcagggaaa ccaagttcgt tggccggagc gaatcaacca     80160
     atgtaaatcc tatagaacgg tgagaatctg gtgaaacatt actggagaag taacagaggt     80220
     tcgaagaaga acgtaagcaa agcggcgaga aggttccctc catttttgtt tcgagctctt     80280
     tttctgcttc gccgtgttag tgtgagaagc agataacgat atccgtaaaa ttgaaaaaaa     80340
     aaacaaaata tctccggaaa aaaggattaa aaaaaaaaaa aaaaaaaaaa agaagctgaa     80400
     acacacgaca acgttttagt ctgatcaaaa tgaaagccaa aaaatgtggc ctatacaggg     80460
     atcgaacctg tgaccttcgc gttattagca cgacgctcta accaactgag ctaataggcc     80520
     actacgtttc taagtggtgc acttagatat ttctctcgga atttcgtaga ttgtgattct     80580
     gtgacagttt tctttcaaga caagtatcaa gtgcaacaaa aaaacatcgg atatgggact     80640
     cgtactcgtg ttcatgaaga taataaactc tcatataact acttgactaa aacgatatat     80700
     tcgtatgcat tagaaaaaac aattgtatat aactaataaa catcacatga ttaagtttta     80760
     actgcaaata acgattttgt taccactgtt aacgctcgtt aattcggatg tctgattttg     80820
     tcaaaaaaaa taaaaaataa aaatatttaa aagacataaa aactaattta ggtattttgg     80880
     acaaatttag tagcacggat attaaatagg caaattaaaa ttaaatggag atttttcagc     80940
     ttttttccca taaaccgacc taaataactc gaatataaat tgtcatgacc ttttaacatc     81000
     gtttaggttt ctaatcttta aatccttcat tgactttgcg ctcgcctgta aactttaaga     81060
     tgatctcatg cttttggttt tagtaatcat ctcaaattaa gcattacacc aagacaaaat     81120
     ccacaagcta cgggaacaat attatagaac tcaaaagttg atatatgcga ttgaacaaat     81180
     atcaagtatt cctccacttg gaagattatt gtttaatgtt tactaaagaa ccgttttaaa     81240
     attaacactt gtcgcgtatt agtcacgaaa ctgctgtaat tctacacatt gtggttgttg     81300
     aaagtggttt tgatttggtc tttcgttaga tgaagtcaat gtctactgtt aactaattat     81360
     ttcaaacctt tgttgagctg tttctttacc acataatcag attccatgat ctttaatatc     81420
     actagcagaa atcgacatgc aaaagtgttt gtttgacgat ttctctactt taccgctggt     81480
     tcactgtaac tgcttgatca aacatattag tattatcctt tgttaatgat atatattacc     81540
     atttcgttaa tcataacttc ttcaataaaa atgtgaaagg tgcacaggcc gacctaacgg     81600
     taatatacgt atgagcttaa ttaatgtagt ctagaaactc gaaaaatata aattgttaat     81660
     tagaggatct ttatctctaa aaatcgatca ttgacttttc gttcgaacga cgtgactaaa     81720
     ttgtaatgcc gtactgcttc aattatttcc agttatgtat aataaagaaa gacccgcaag     81780
     ctacgttcgg taaaaaaata gacctatgtc acactatgtg gaaaacccta agtttaacgt     81840
     tcatgacgct atcaaaattc agagtttatc gtttaaatga tttgaccaaa actaaaaaca     81900
     gtacacgatc attaataagg caatcctgtt ttcgaataaa atatgaaata agataggccc     81960
     accttgcctc acatctgatg ctaaatttct agtcgttata taattgagat attattatct     82020
     ctctataaat tgatggcttg acttagtatt cggacagctt tgaggttttg tcacgtgatc     82080
     cgacaagcta cgagttctat atatacatac agagagcagt aagtttctta tactcaaaat     82140
     aatcatctct cataccactc atcaatattc aaacaatccc tttctctatg gattccgagt     82200
     cggagctcat gatatctctt atttctcaac tgttatctat cttaggcggt ggggaagaca     82260
     cacatacacc acagctgaag tcaaagttga tagcacttac ttgtcaacta atctctctgg     82320
     tcaactctct ggatttggat tcgcagccgg agccggagtc gaagctcaaa tcactaatta     82380
     agcagataat ttatgtcagc aactctgttt cagaaccagg accagagtcg cagtcggtat     82440
     cagtggtgac taaaatgatc tctatcatcg gctctataga ttttgatctc aaggagtcag     82500
     agccggagct catgtcactc acttctcaaa tattcgctct catcatggca atggacgagg     82560
     aatcggagct cttttcactc ctttctgagg tggccagtct cgtccagacg gaggaacaga     82620
     agctcatcaa taaccaacaa gtgccgcctc tcaccaccga agaagaagaa aaagatgatc     82680
     ttatctacgg ctatacagat gatatgaatt gggagtcgga gctcatgttc tatatcattt     82740
     ctaaaatgat atctacatta agaggtgagg atatgtgtca agaggtggca agagatttca     82800
     tagcatacgc taatcaactt attcctctca tcgaatcact ggatatggat tcgaattcag     82860
     agccgaagca ggagccgaag atcacatcac tcgttaggca aataatctct ctcagcaagg     82920
     ttgtttctgg accagagtca cagttggtat cactcgtgac tcgaattatc tctatcacca     82980
     gctctacaga cttggatccc acggagtcac aatggaggct cacgtcagtc acttataaaa     83040
     tatctcgtat cctcaaggaa ataaaggatt cggaggattc ggagatggca tcactcatta     83100
     atcaaataca cgacctcgtt gacgcagagg agggacgaaa gccagagtca aggctcatat     83160
     caagcatcac tcaactaatg tctcacatca actcttggag tttttattca ggaatggacc     83220
     ccaagatcat atctctcatt attcgaatca tctatctggt cagatcaatg gatttggatt     83280
     cgcagacaaa gcccaagtcg gagctaatgt cactcgttac tcaaactatc gctgtctaca     83340
     actctatgga tttggattct cagccgcggc cgctaaggaa ggtcgtatca gttttttctc     83400
     agtatggttt tgacgtaaat tctacagttt cggattcaga atcggattca agtgagaatt     83460
     acgtgtcaca cattaaagat tcattaaaac ttgagccgga gcccgagctt atttccttca     83520
     tccatcgaat aggctccctc gtcatctcta tgaatccaaa ctgggagaag cttatttcct     83580
     tttgccctca atttgaagta atactgagcg atgatggaaa gtttcaagtg gaagaaggac     83640
     gtctaagcaa aaatcagtta tccgacgata tcccaatgaa gtggaattgt ctccaggtaa     83700
     actggaattt attgaagtta catgcaggag aaaaagactt tactcatttt cgctgtcgag     83760
     gttgcaatgg tgacaaccat aaagaaaatg aaaaggctcc acttgaagtc aaacaccctc     83820
     ttcatcctaa acatcctctt cagcttgttt tgtcgcaatc ttctggtggt agaacgaggg     83880
     aatgctattg ttgtgatgaa gatttgctgc atatattcta ttgttgcttg gcttgcaatt     83940
     tttctatgaa tgtagcttgt actaagaagc cagctgtctt atatagaaac catccgaggt     84000
     ggcacgagca tacacttgct ctgtttccaa ggcaggcttc cttaacttgc aacctttgtg     84060
     ccttggccga ttcaagctcc ccgatctata tgtgtccccc ttgcgacttt gtcgtccatc     84120
     ttagatgtac cggcttacca cgtgtcataa agatatcccg ccatctccac cgtatatcat     84180
     ttacattttc ttttgaccga ggagatttgt cttgtagtgt ttgtcgcaga aaaatagacg     84240
     aagattacgg gggctatact tgcatcaagg acggctgttc gtatgcggct cattcgaaat     84300
     gtgcaacaca aaaaaatgtg tgggatggca tcgaacttga gggagagcct gaagaagttg     84360
     aagaagaagt agttgacccg tttgtgacaa taagcgacgg agtcatacaa catttcggtc     84420
     acccacaaca tcatttgaga cttgacgaga acacgagcag agattacgac gaggataagt     84480
     tgtgtcaagc ttgcgtcatg ccaatctatt ttggtaactt ctactcctgt acgcaatgca     84540
     attatatact ccacgaagca tgtgccaatt tctctcgcaa aatgcatcat ccggtacatc     84600
     cacatgtgct cactttagtg aactctgacg gtgctatcaa cgttagaaaa gaatgtgcag     84660
     cttgtccttg gatgtgcaca actggtttct tctatgaatg cagtaaagaa gattttcagc     84720
     tacatgtgca gtgcgccaac ctgtctgagc cactagtcca tgaaagtcat atgcatcctt     84780
     tattcctaac atccaaacca ggagagagga gattatgttc cgcttgcaaa gagtcgtatt     84840
     ttagtgtgac aagagaaaca ttcaactgca tagagtgtga ttttgctttg tgctttagat     84900
     gtgctacttt acctcaaaag gtgaggtata agcacgacaa acatatgctc actctttcgt     84960
     atggggaaga aacaagtacc atgacatatt ggtgtgaagt ttgcgagaga aatttaaatc     85020
     caaaggagcg attttataag tgtgatgagt actgctctat cacgctacac attgaatgta     85080
     tgttgggggt ggctttatac atcaggcctg gttcatcgtg gatctgcttc aacaataaaa     85140
     agatgtatgt tctacccaac aatcatcata tgtctcgacc tcgttgcttc atgtgtaaga     85200
     agcgttgtcc acagaaaata gttttcaagt acgacgaagt aatattttgt acccaaaagt     85260
     gtagggggaa atatagatac tagaagagtg agcaagtagc ttgatggtca ttgctaacat     85320
     gttttagtga gtattccttt gcattgagat aattgtgcaa agataaagtg aaagtatatg     85380
     acctgtaaaa tctgtctgtt ataaacactg caaagattgg tatcgaatag aaacggaatt     85440
     ttaacttttt aagagtcaaa tctctttttg catcacattt ctccttgttc tgtaaaatgt     85500
     atacacatgg aatgtgtgtt taatcttcta aaacttttag aaaatcatcg ctctctctct     85560
     ctctatgacg ttttagtttg atcaaaatga aagccaaaaa agtggcctat acagggatcg     85620
     aacctgtgac cttcgcgtta ttagcacgac gctctaacca actgagctaa taggccactg     85680
     cggttataaa cggtacatta aatatttctc gcggaattgc ctagattgtg attctgtgac     85740
     agttttcttt caagacaagt aagtatcaag tgctacaaat tggcaagtat aatttattca     85800
     agagttgaaa atatcaagtg ttcagaaaat tttcagattt tttttttggg tttattcgat     85860
     ttatattttg ttttcttttt attctacaaa atcttagaaa atactagatt gatattttcc     85920
     ttcttccaca aataataaaa acgaaaataa ttgttgttca tagtataaaa gtatttattt     85980
     tcctaataaa atcttaatga tttactctac atttattttt gtatgttaag tgtatttatt     86040
     ttcattattg gttatctcaa ctcacagaat taattaatta cttaacacaa ttcttcattt     86100
     tagtccccaa gtaatttgtt gcagcaacct gcgtttaggt tttgcatctg caccaccacc     86160
     accaaccaaa ggccttgcat ttccacatca aacgttacga agagatttgt ctctgccttg     86220
     tcctcttaac cagatctctc tgacgcagta tctgatcaca ctccgtgatc gtcttttgtt     86280
     atcattttgt gtatcgagat ctgttagtct actgcgatgg ctatggaaca gaggcctaag     86340
     acgaagatcg tgtgcacact cgggccggcg tccagatctg tcccaatggt cgagaagctt     86400
     cttatggcgg ggatgagcgt ggctcgcttc aacttttctc atggatctta cgaatatcac     86460
     caggagactc tcgacaatct tcgtcaggcc atgcttaaca ctggcatgct atgtgctgtc     86520
     atgctcgaca ccaaggtcaa tcttataaaa cttgtcatat gtgcattttt atgtctgtat     86580
     aacaatgcca tcgaggcgtt ttcttttgat ttgggctctg ttcacgcatg attctgatcg     86640
     tttctctatc attttacaag tgattcatgt cttatctgat tggttattcc cctgctgatc     86700
     tgaggacact cgttttggct atgtttaagt cctgtgaact ttggtataat ttgtggcatg     86760
     gtacgttgtt tccagttcga gcatgaatta gacaatatct gtggtacatg tttgctggtt     86820
     acagaaacca aatggagaac tgatgttgtt tgttagacca gaatattaat acaaagttga     86880
     tgcatcatgg atgattagac tcttaccttt gtcgtcttga aaatgaagat tacaatctca     86940
     ttaaagtatt tgcttcaaat tctcactctc tggtctgtta cttggctttc tggtaatgaa     87000
     agttaataaa aatgtggaat gtataatgtg gcttaaagtt agctgagaca ctcttcttag     87060
     tggtcttatt gctaataatc tcatgaacgt gatagattta tatgttttgg gggacccttt     87120
     tggtttctga ataattatgg gaatgatttt tgtatttgtc tggcagggac cagagattcg     87180
     aaccgggttc ttaaaggatg ggaaacctat ccagctcaaa caaggccaag aaatcaccat     87240
     ttcaactgac tatgacttga agggtgatga gaaaactatt tgcatgagct acaagaagtt     87300
     ggcgcaagat gtgaatccag gcatggtcat actctgtgcc gatggtacca tctcgttaaa     87360
     ggtcctttct tgtgacaaag aaaagggcac tgtccgttgt cgttgtgaga acacttcaat     87420
     gcttggtgaa agaaagaacg ttaatctccc tggtgttgtg gttgatctcc caactctaac     87480
     tgaaaaagac aagcaagaca ttcttgaatg gggagttccc aatcaaatcg acatgattgc     87540
     tctgtctttt gtcagaaaag gttcggactt ggtacaagtt aggaagctac ttggaaaaca     87600
     tgctaaaacc atacttctca tgtcaaaggt acatatatac atacatcact caaactaata     87660
     taaatcacat atccatactc agattcttat gatatgttac ttttgatatt gtcaggttga     87720
     aaaccaagaa ggtgtagcga attttgatga tatcttgata aactcggatg cgtttatgat     87780
     cgcaagaggt gaccttggaa tggagattcc aattgagaag atattcttag ctcagaaagt     87840
     gatgatctac aagtgcaatt tcatggggaa gccagtggtt acagcgactc agatgcttga     87900
     gtctatgatc aaatccccac gaccaacaag agcagaagct actgatgttg caaatgctgt     87960
     cctcgatggc acagactgtg tcatgcttag tggtgaaacc gcagctggag catacccaga     88020
     gcttgctgtt cgtacaatgg ccaagatatg tgtggaagca gagagcacac ttgactatgg     88080
     agacatcttc aagaggataa tgcttcacgc tgcggtccct atgagcccga tggagtcact     88140
     tgcttcatct gcggtcagaa ccgctacttc ctcaagagcc actcttatga tggtcttgac     88200
     cagaggaggc agcacggcga ggctggtggc taagtataga ccagggatac ccattttgtc     88260
     cgtggtggtt cctgaaatca cgtctgactc ttttgattgg gcgtgtagca acgaggcacc     88320
     ggcaagacac agtctcatct accgtggttt agtcccggtg ctgtatgctg gatcggctag     88380
     agcctcgatc gacgagtcaa cagaagaaac tctcgagttc gcgtcagagt atggtaaaaa     88440
     gaagcaactc tgcaagaccg gagactctgt tgtggctctc ttccgtacag gtaacgctat     88500
     tgttatcaag atcttgaccg tcaagtgatc ccatttgcgt ttgagttttg ccggtgtttc     88560
     ttagcgtttt ggatgtttat tcatcatggt gactaatctt gagatgaaac tcaaagtctc     88620
     ttttgtttct ttttttgtgt gtggctccca cacactacat aatgttcttg gatcatactc     88680
     tggttacaag tacattagtt tggtacgagt gcaattgcat aaacaaagac tattttttga     88740
     atatatttta caaaaatgtg tgatcacatt tggctcgtga tcacacaact ttgggattcg     88800
     tatttggaga taatgcgatt catgcagtca acaaccatac tcacagtcac atgcctctcc     88860
     ctctcaacat aaatacctgt gttcatcttt ttatatttta ctaaattaaa agggatactt     88920
     ttaacggaaa cccaaatgat catcagatat tataatacaa ataaagaaaa gattccattc     88980
     ctcgaaagtg tttatttgtt atgcagtatt caacaatctg agtgaacaag attttatgta     89040
     ctataagctg aggaatagca gtttacgagt tctcaccgag atgagatgac cccgaggccg     89100
     atgcggatga cgaagaggat gaagagaata atccgctgaa cggccatgga aaagagaacc     89160
     ttctctcgct cacattactg ttccttgcat catcttccac attctcatta cttacgttga     89220
     tctctagagt tcttgttctc ggtcttacag gattaacctt ggtctcatca tcaggaggga     89280
     gttcatatcg gcacacggga catgaactgt gaagctcgag ccacggtact atacaccgga     89340
     tgtgaaactt gtgcttacac ggcatctctt tagcttcact tcctttgtca aaatcatcca     89400
     aacaaatcga gcactgcaat gattcactta tcttaaccgt tgggagatta tccacaactt     89460
     ctttacgtgc tggaagactc ccgtgcctga ttgaatcatt atcagctaga tgttcaagca     89520
     aatggtctaa actggatcca acaaagtaat ctccaattgc agaaagagaa gtattgttcc     89580
     ggttttgatt caaactcgtt gaaccctgaa caacagctga ttgatttaac aggtctcgat     89640
     ccgagctctc atactcagaa gcaatccctg cacgaatacc ctgaagcaac tgcaatatag     89700
     tagctgagct tctccgtctc ctcctaagga tagactcaaa ctctctgtct aaatcaatct     89760
     ctctaccttg ttgcctgtgg cgatgacgac gatgatgatg tcgatcaata tcgacgctgt     89820
     catttccatc aacatcatca gatacattga cctcatcatt atccacacca aactctgtcc     89880
     tcctaaacct tctacgtcta cgag                                            89904
//

If you have problems or comments...

PBIL Back to PBIL home page