(data stored in ACNUC21429 zone)

EMBL: AL136643

ID   AL136643; SV 1; linear; mRNA; HTC; HUM; 2978 BP.
XX
AC   AL136643;
XX
DT   05-JAN-2001 (Rel. 66, Created)
DT   15-OCT-2008 (Rel. 97, Last updated, Version 6)
XX
DE   Homo sapiens mRNA; cDNA DKFZp564L023 (from clone DKFZp564L023)
XX
KW   HTC.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-2978
RG   The German cDNA Consortium
RA   Wambutt R., Heubner D., Mewes H.W., Weil B., Amid C., Osanger A., Fobo G.,
RA   Han M., Wiemann S.;
RT   ;
RL   Submitted (22-SEP-2004) to the INSDC.
RL   MIPS, Ingolstaedter Landstr.1, D-85764 Neuherberg, GERMANY
XX
DR   MD5; 5af8422968f4a8ef84bb96b74cc24780.
DR   Ensembl-Gn; ENSG00000135018; homo_sapiens.
DR   Ensembl-Tr; ENST00000257468; homo_sapiens.
DR   Ensembl-Tr; ENST00000376395; homo_sapiens.
XX
CC   Clone from S. Wiemann, Molecular Genome Analysis, German Cancer Research
CC   Center (DKFZ); Email s.wiemann@dkfz-heidelberg.de;
CC   sequenced by Agowa (Berlin/Germany) within the cDNA sequencing consortium
CC   of the German Genome Project.
CC   This clone (DKFZp564L023) is available at the RZPD Deutsches
CC   Ressourcenzentrum fuer Genomforschung GmbH in Berlin, Germany.
CC   Please contact RZPD for ordering:
CC   http://www.rzpd.de/cgi-bin/products/cl.cgi?CloneID=DKFZp564L023
CC   Further information about the clone and the sequencing project is
CC   available at http://mips.gsf.de/projects/cdna/
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2978
FT                   /organism="Homo sapiens"
FT                   /mol_type="mRNA"
FT                   /dev_stage="fetal"
FT                   /clone_lib="564 (synonym: hfbr2). Vector pAMP1; host
FT                   Xl-2blue; sites NotI + SalI"
FT                   /clone="DKFZp564L023"
FT                   /tissue_type="brain"
FT                   /note="ubiquilin 1 isoform 1"
FT                   /db_xref="taxon:9606"
FT   CDS_pept        279..2048
FT                   /codon_start=1
FT                   /gene="DKFZp564L023"
FT                   /product="hypothetical protein"
FT                   /db_xref="GOA:Q9UMX0"
FT                   /db_xref="H-InvDB:HIT000025239.18"
FT                   /db_xref="HGNC:HGNC:12508"
FT                   /db_xref="InterPro:IPR000626"
FT                   /db_xref="InterPro:IPR006636"
FT                   /db_xref="InterPro:IPR009060"
FT                   /db_xref="InterPro:IPR015496"
FT                   /db_xref="InterPro:IPR015940"
FT                   /db_xref="InterPro:IPR028799"
FT                   /db_xref="InterPro:IPR029071"
FT                   /db_xref="PDB:2JY5"
FT                   /db_xref="PDB:2JY6"
FT                   /db_xref="PDB:2KLC"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9UMX0"
FT                   /protein_id="CAB66578.1"
FT                   /translation="MAESGESGGPPGSQDSAAGAEGAGAPAAAASAEPKIMKVTVKTPK
FT                   EKEEFAVPENSSVQQFKEEISKRFKSHTDQLVLIFAGKILKDQDTLSQHGIHDGLTVHL
FT                   VIKTQNRPQDHSAQQTNTAGGNVTTSSTPNSNSTSGSATSNPFGLGGLGGLAGLSSLGL
FT                   NTTNFSELQSQMQRQLLSNPEMMVQIMENPFVQSMLSNPDLMRQLIMANPQMQQLIQRN
FT                   PEISHMLNNPDIMRQTLELARNPAMMQEMMRNQDRALSNLESIPGGYNALRRMYTDIQE
FT                   PMLSAAQEQFGGNPFASLVSNTSSGEGSQPSRTENRDPLPNPWAPQTSQSSSASSGTAS
FT                   TVGGTTGSTASGTSGQSTTAPNLVPGVGASMFNTPGMQSLLQQITENPQLMQNMLSAPY
FT                   MRSMMQSLSQNPDLAAQMMLNNPLFAGNPQLQEQMRQQLPTFLQQMQNPDTLSAMSNPR
FT                   AMQALLQIQQGLQTLATEAPGLIPGFTPGLGALGSTGGSSGTNGSNATPSENTSPTAGT
FT                   TEPGHQQFIQQMLQALAGVNPQLQNPEVRFQQQLEQLSAMGFLNREANLQALIATGGDI
FT                   NAAIERLLGSQPS"
XX
SQ   Sequence 2978 BP; 857 A; 685 C; 656 G; 780 T; 0 other;
     ggggggagga agcggtggct gctgcggatg tcggtgtgag cgagcggcgc ctgaacacac        60
     ggcggctgcc gagcgcctga cccgggcctg cgccagagcc tgcaccgagc tccggggccc       120
     cacacccgct acggtggccc tgcgcccgtt gctactgagg cggcgtgctc tgcattcttc       180
     gctgtccagg cctgccggct ctggtgtctg ctggctcctc cttgctcgcc tgctccctcc       240
     tgcttgcctg agtcaccgcc gccgccgccg ccacagccat ggccgagagt ggtgaaagcg       300
     gcggtcctcc gggctcccag gatagcgccg ccggagccga aggtgctggc gcccccgcgg       360
     ccgctgcctc cgcggagccc aaaatcatga aagtcaccgt gaagaccccg aaggaaaagg       420
     aggaattcgc cgtgcccgag aatagctccg tccagcagtt taaggaagaa atctctaaac       480
     gttttaaatc acatactgac caacttgtgt tgatatttgc tggaaaaatt ttgaaagatc       540
     aagatacctt gagtcagcat ggaattcatg atggacttac tgttcacctt gtcattaaaa       600
     cacaaaacag gcctcaggat cattcagctc agcaaacaaa tacagctgga ggcaatgtta       660
     ctacatcatc aactcctaat agtaactcta catctggttc tgctactagc aacccttttg       720
     gtttaggtgg ccttggggga cttgcaggtc tgagtagctt gggtttgaat actaccaact       780
     tctctgaact acagagtcag atgcagcgac aacttttgtc taaccctgaa atgatggtcc       840
     agatcatgga aaatcccttt gttcagagca tgctctcaaa tcctgacctg atgagacagt       900
     taattatggc caatccacaa atgcagcagt tgatacagag aaatccagaa attagtcata       960
     tgttgaataa tccagatata atgagacaaa cgttggaact tgccaggaat ccagcaatga      1020
     tgcaggagat gatgaggaac caggaccgag ctttgagcaa cctagaaagc atcccagggg      1080
     gatataatgc tttaaggcgc atgtacacag atattcagga accaatgctg agtgctgcac      1140
     aagagcagtt tggtggtaat ccatttgctt ccttggtgag caatacatcc tctggtgaag      1200
     gtagtcaacc ttcccgtaca gaaaatagag atccactacc caatccatgg gctccacaga      1260
     cttcccagag ttcatcagct tccagcggca ctgccagcac tgtgggtggc actactggta      1320
     gtactgccag tggcacttct gggcagagta ctactgcgcc aaatttggtg cctggagtag      1380
     gagctagtat gttcaacaca ccaggaatgc agagcttgtt gcaacaaata actgaaaacc      1440
     cacaactgat gcaaaacatg ttgtctgccc cctacatgag aagcatgatg cagtcactaa      1500
     gccagaatcc tgaccttgct gcacagatga tgctgaataa tcccctattt gctggaaatc      1560
     ctcagcttca agaacaaatg agacaacagc tcccaacttt cctccaacaa atgcagaatc      1620
     ctgatacact atcagcaatg tcaaacccta gagcaatgca ggccttgtta cagattcagc      1680
     agggtttaca gacattagca acggaagccc cgggcctcat cccagggttt actcctggct      1740
     tgggggcatt aggaagcact ggaggctctt cgggaactaa tggatctaac gccacaccta      1800
     gtgaaaacac aagtcccaca gcaggaacca ctgaacctgg acatcagcag tttattcagc      1860
     agatgctgca ggctcttgct ggagtaaatc ctcagctaca gaatccagaa gtcagatttc      1920
     agcaacaact ggaacaactc agtgcaatgg gatttttgaa ccgtgaagca aacttgcaag      1980
     ctctaatagc aacaggaggt gatatcaatg cagctattga aaggttactg ggctcccagc      2040
     catcatagca gcatttctgt atcttgaaaa aatgtaattt atttttgata acggctctta      2100
     aactttaaaa tacctgcttt atttcatttt gactcttgga attctgtgct gttataaaca      2160
     aacccaatat gatgcatttt aaggtggagt acagtaagat gtgtgggttt ttctgtattt      2220
     ttcttttctg gaacagtggg aattaaggct actgcatgca tcacttctgc atttattgta      2280
     attttttaaa aacatcacct tttatagttg ggtgaccaga ttttgtcctg catctgtcca      2340
     gtttatttgc tttttaaaca ttagcctatg gtagtaattt atgtagaata aaagcattaa      2400
     aaagaagcaa atcatttgca ctctataatt tgtggtacag tattgcttat tgtgactttg      2460
     gcatgcattt ttgcaaacaa tgctgtaaga tttatactac tgataatttt gttttatttg      2520
     tatacaatat agagtatgca catttgggac tgcatttctg gaaacatact gcaataggct      2580
     ctctgagcaa aacacctgta actaaaaaag tgaagataag aaaatactct taaagctgag      2640
     tatttcctaa ttgtatagaa tcttacagca tctttgacaa acatctccca gcaaaagtgc      2700
     cggttagtca ggtttgttga aaatacagta gaaaagctga ttctggttat ctctttaagg      2760
     acaattaatt gtacagacac ataatgtaac attgtctcaa cattcattca cagattgact      2820
     gtaaattacc ttaatctttg tgcagactga aggaacactg tagtataccc caaagtgcat      2880
     ttgcctagga cttctcagct tctcccatag gtagtttaac aggcattaaa atttgtaatt      2940
     gaaatgttgc tttcactcaa aaaaaaaaaa aaaaaaaa                              2978
//

If you have problems or comments...

PBIL Back to PBIL home page