(data stored in SCRATCH zone)

EMBL: AL137189

ID   AL137189; SV 2; linear; genomic DNA; STD; PLN; 118507 BP.
XX
AC   AL137189;
XX
DT   25-JAN-2000 (Rel. 62, Created)
DT   14-NOV-2006 (Rel. 89, Last updated, Version 4)
XX
DE   Arabidopsis thaliana DNA chromosome 5, BAC clone F7J8 (ESSA project)
XX
KW   .
XX
OS   Arabidopsis thaliana (thale cress)
OC   Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
OC   Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae; Pentapetalae;
OC   rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis.
XX
RN   [1]
RP   1-3766
RA   Bevan M., Rose M., Hempel S., Entian K.-D., Bancroft I., Mewes H.W.,
RA   Rudd S., Lemcke K., Mayer K.F.X.;
RT   ;
RL   Unpublished.
XX
RN   [2]
RP   3758-118507
RA   Bevan M., Zimmermann W., Grueneisen A., Wambutt R., Kalicki J.,
RA   Wohldmann P., Smith A., Bancroft I., Mewes H.W., Rudd S., Lemcke K.,
RA   Mayer K.F.X.;
RT   ;
RL   Unpublished.
XX
RN   [3]
RP   1-118507
RA   EU Arabidopsis sequencing project;
RT   ;
RL   Submitted (26-JUL-2000) to the INSDC.
RL   MIPS, at the Max-Planck-Institut fuer Biochemie, Am Klopferspitz 18a,
RL   D-82152 Martinsried, FRG, E-mail:
RL   lemcke@mips.biochem.mpg.de,mayer@mips.biochem.mpg.de Project Coordinator:
RL   Mike Bevan, Molecular Genetics Department, Cambridge Laboratory, John Innes
RL   Centre, Colney Lane, NR4 7UJ Norwich, UK, E-mail: michael.bevan@bbsrc.ac.uk
XX
DR   MD5; 88f18cf660cb96f3864b4ae17b9caf0b.
DR   ENA-CON; BA000015.
DR   EuropePMC; PMC122840; 11960029.
DR   EuropePMC; PMC311223; 11731491.
DR   EuropePMC; PMC37533; 11438686.
XX
CC   Information on performance of analysis and a more detailed annotation
CC   of this entry and other sequences of chromosomes 3, 4 and 5 can be
CC   viewed at: http://www.mips.biochem.mpg.de/proj/thal/
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..118507
FT                   /organism="Arabidopsis thaliana"
FT                   /chromosome="5"
FT                   /variety="Columbia"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:3702"
FT   gene            1726..3687
FT                   /gene="F7J8_5"
FT   CDS_pept        complement(join(1726..2207,2629..2752,2857..2962,
FT                   3091..3556,3633..3687))
FT                   /gene="F7J8_5"
FT                   /product="protein kinase-like protein"
FT                   /note="strong similarity to serine/threonine-specific
FT                   protein kinase NAK, Arabidopsis thaliana, EMBL:AL162874"
FT                   /db_xref="GOA:Q8GXZ3"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR001245"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8GXZ3"
FT                   /protein_id="CAB99493.1"
FT                   /translation="MGNCGTRDEAAVFTPQAQAQQLQKKHSRSVSDLSDPSTPRFRDDS
FT                   RTPISYAQVIPFTLFELETITKSFRPDYILGEGGFGTVYKGYIDDNLRVGLKSLPVAVK
FT                   VLNKEGLQGHREWLTEVNFLGQLRHPNLVKLIGYCCEDDHRLLVYEFMLRGSLENHLFR
FT                   SNPRTLLHFLKMMIALGAAKGLAFLHNAERPVIYRDFKTSNILLDSDYTAKLSDFGLAK
FT                   AGPQGDETHVSTRVMGTYGYAAPEYVMTGHLTARSDVYSFGVVLLEMLTGRKSVDKTRP
FT                   SKEQNLVDWARPKLNDKRKLLQIIDPRLENQYSVRAAQKACSLAYYCLSQNPKARPLMS
FT                   DVVETLEPLQCTGDALIPCATTTAGAAFAMGGVPDYRMHRRFAKNVGPGAICRSPNPNY
FT                   SPGGPAACRVR"
FT   exon            complement(1726..2207)
FT                   /number=1
FT   intron          complement(2208..2628)
FT                   /number=1
FT   exon            complement(2629..2752)
FT                   /number=2
FT   intron          complement(2753..2856)
FT                   /number=2
FT   exon            complement(2857..2962)
FT                   /number=3
FT   intron          complement(2963..3090)
FT                   /number=3
FT   exon            complement(3091..3556)
FT                   /number=4
FT   intron          complement(3557..3632)
FT                   /number=4
FT   exon            complement(3633..3687)
FT                   /number=5
FT   gene            6055..8420
FT                   /gene="F7J8_10"
FT   CDS_pept        join(6055..8082,8214..8420)
FT                   /gene="F7J8_10"
FT                   /product="putative protein"
FT                   /note="EST F14175 marks 5' end of this gene; 5' UTR
FT                   contains an intron"
FT                   /note="similarity to predicted proteins, Arabidopsis
FT                   thaliana"
FT                   /db_xref="GOA:Q9LFD3"
FT                   /db_xref="InterPro:IPR021916"
FT                   /db_xref="UniProtKB/TrEMBL:Q9LFD3"
FT                   /protein_id="CAB69831.1"
FT                   /translation="MAEKEGKASGTDNDNRVKTKRSSHSRRKECVNKSLEHNDELVKYM
FT                   SKLPGYLQRIERGEESVHQSNVLNVGVLDWESLQRWKHGRAKGGEISGRSERKVSTIAT
FT                   TSTSGVVVPNDSANRCKIDDQVHTCSNLGKVKASRDLQYSLEPQLASRDSLNKQEIATC
FT                   SYKSSGRDHKGVEPRKSRRTHSNRESTTGLSSEMGNSAGSLFRDKETQKRAGEIHAKEA
FT                   RERAKECVEKLDGDEKIIGDSEAGLTSEKQEFSNIFLLRSRKQSRSTLSGEPQISREVN
FT                   RSLDFSDGINSSFGLRSQIPSSCPLSFDLERDSEDMMLPLGTDLSGKRGGKRHSKTTSR
FT                   IFDREFPEDESRKERHPSPSKRFSFSFGRLSRNFSLKDISAGQPLSSSEDTIMSGSMRF
FT                   DGSVCPSQSSNPENQNTHCRSRVSPLRRFLDPLLKPKASESVLPSKARSSSSNPKPITN
FT                   SNVPLQDEKKQDASRTLAIFQLTIRNGIPLFQFVVDDNSSSSRSILGATMKSSDSSFKD
FT                   DSVQYCTFYSVNEVKKKKSGSWLIHGHREKHCGFVYNIIGQMQLGNSMSVDISEQKSLI
FT                   TESVLFDESEQVKGRKEVAAVVIKKKPVEGSYTSFEETSVIIPGGVHSFPEKGAPSPLI
FT                   SRWRSGGLCDCGGWDVGCKLHVLSNKTVLHKFNQSFTLFDQEVSEQDSSPALAMTELKT
FT                   GIYRVEFGSFVSPLQAFFVCVTVLTCASKAKTTGKSSSPMAPPLSPVGRV"
FT   exon            6055..8082
FT                   /number=1
FT   intron          8083..8213
FT                   /number=1
FT   exon            8214..8420
FT                   /number=2
FT   gene            8811..11559
FT                   /gene="F7J8_20"
FT   CDS_pept        complement(join(8811..8995,9120..10082,10181..10291,
FT                   10608..10852,10996..11147,11461..11559))
FT                   /gene="F7J8_20"
FT                   /product="laccase-like protein"
FT                   /note="strong similarity to lac110 laccase, Populus
FT                   trichocarpa, EMBL:PTY13773"
FT                   /db_xref="GOA:Q9LFD2"
FT                   /db_xref="InterPro:IPR001117"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR011706"
FT                   /db_xref="InterPro:IPR011707"
FT                   /db_xref="InterPro:IPR017761"
FT                   /db_xref="InterPro:IPR034285"
FT                   /db_xref="InterPro:IPR034288"
FT                   /db_xref="InterPro:IPR034289"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9LFD2"
FT                   /protein_id="CAB69832.1"
FT                   /translation="MPRLHHYLSNQAFLVLLLFSSIASAAVVEHVLHIQDVVVKPLCKE
FT                   QIIPAANGSLPGPTINVREGDTLVVNVINNSTYNVTIHWHGVFQLKSVWMDGANMITQC
FT                   PIQPGYNFTYQFDITGQEGTLLWHAHVVNLRATLHGALVIRPRSGRPYPFPKPYKEVPI
FT                   VFQQWWDTDVRLLQLRPAPVSDAYLINGLAGDSYPCSENRMFNLKVVQGKTYLLRIVNA
FT                   ALNTHLFFKIANHNVTVVAVDAVYSTPYLTDVMILTPGQTVDALLTADQAIGKYYMATL
FT                   PYISAIGIPTPDIKPTRGLIVYQGATSSSSPAEPLMPVPNDMSTAHRFTSNITSLVGGP
FT                   HWTPVPRHVDEKMFITMGLGLDPCPAGTKCIGPLGQRYAGSLNNRTFMIPERISMQEAY
FT                   FYNISGIYTDDFPNQPPLKFDYTKFEQRTNNDMKMMFPERKTSVKKIRFNSTVEIVLQN
FT                   TAIISPESHPMHLHGFNFYVLGYGFGNYDPIRDARKLNLFNPQMHNTVGVPPGGWVVLR
FT                   FIANNPGVWLFHCHMDAHLPYGIMSAFIVQNGPTPETSLPSPPSNLPQCTRDPTIYDSR
FT                   TTNIDLSY"
FT   exon            complement(8811..8995)
FT                   /number=1
FT   intron          complement(8996..9119)
FT                   /number=1
FT   exon            complement(9120..10082)
FT                   /number=2
FT   intron          complement(10083..10180)
FT                   /number=2
FT   exon            complement(10181..10291)
FT                   /number=3
FT   intron          complement(10292..10607)
FT                   /number=3
FT   exon            complement(10608..10852)
FT                   /number=4
FT   intron          complement(10853..10995)
FT                   /number=4
FT   exon            complement(10996..11147)
FT                   /number=5
FT   intron          complement(11148..11460)
FT                   /number=5
FT   exon            complement(11461..11559)
FT                   /number=6
FT   gene            13626..16229
FT                   /gene="F7J8_30"
FT   CDS_pept        complement(join(13626..13810,13898..14866,14987..15097,
FT                   15387..15631,15775..15926,16131..16229))
FT                   /gene="F7J8_30"
FT                   /product="laccase-like protein"
FT                   /note="strong similarity to lac110 laccase, Populus
FT                   trichocarpa, EMBL:PTY13773"
FT                   /note="Contains Short-chain dehydrogenases/reductases
FT                   family signature AA184-212"
FT                   /db_xref="GOA:Q9LFD1"
FT                   /db_xref="InterPro:IPR001117"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR011706"
FT                   /db_xref="InterPro:IPR011707"
FT                   /db_xref="InterPro:IPR017761"
FT                   /db_xref="InterPro:IPR034285"
FT                   /db_xref="InterPro:IPR034288"
FT                   /db_xref="InterPro:IPR034289"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9LFD1"
FT                   /protein_id="CAB69833.1"
FT                   /translation="MPRVHHSLSNQAFLVLLLFSSIASAAIVEHVLHVKDVVVTPLCKE
FT                   QMIPIVNGSLPGPTINVREGDTLVVHVINKSTYNVTIHWHGVFQLKSVWMDGANMITQC
FT                   PIQPSNNFTYQFDITGQEGTLLWHAHVVNLRATIHGALIIRPRSGRPYPFPKPYKEVPL
FT                   IFQQWWDTDVRLLELRPAPVSDAYLINGLAGDSYPCSKNRMFNLKVVQGKTYLLRIINA
FT                   ALNTHLFFKIANHNVTVVAVDAVYTTPYLTDVMILTPGQTIDAILTADQPIGTYYMAII
FT                   PYFSAIGVPASPDTKPTRGLIVYEGATSSSSPTKPWMPPANDIPTAHRFSSNITSLVGG
FT                   PHWTPVPRHVDEKMFITMGLGLDPCPSNAKCVGPLDQRLAGSLNNRTFMIPERISMQEA
FT                   YFYNITGVYTDDFPDQPPLKFDFTKFEQHPTNSDMEMMFPERKTSVKTIRFNSTVEIVL
FT                   QNTGILTPESHPMHLHGFNFYVLGYGFGNYDPIRDARKLNLFNPQMHNTVGVPPGGWVV
FT                   LRFIANNPGIWLFHCHMDAHLPLGIMMAFIVQNGPTRETSLPSPPSNLPQCTRDPTIYD
FT                   SRTTNVDMSY"
FT   exon            complement(13626..13810)
FT                   /number=1
FT   intron          complement(13811..13897)
FT                   /number=1
FT   exon            complement(13898..14866)
FT                   /number=2
FT   intron          complement(14867..14986)
FT                   /number=2
FT   exon            complement(14987..15097)
FT                   /number=3
FT   intron          complement(15098..15386)
FT                   /number=3
FT   exon            complement(15387..15631)
FT                   /number=4
FT   intron          complement(15632..15774)
FT                   /number=4
FT   exon            complement(15775..15926)
FT                   /number=5
FT   intron          complement(15927..16130)
FT                   /number=5
FT   exon            complement(16131..16229)
FT                   /number=6
FT   gene            18157..20264
FT                   /gene="F7J8_40"
FT   CDS_pept        join(18157..18471,18553..18688,18776..18909,18997..19188,
FT                   19275..19496,19598..19753,19829..19942,20034..20264)
FT                   /gene="F7J8_40"
FT                   /product="putative protein-kinase"
FT                   /note="similarity to protein kinase TMK1 (EC 2.7.1.-),
FT                   receptor type precursor, Arabidopsis thaliana, PIR:JQ1674"
FT                   /db_xref="GOA:Q9LFD0"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR001245"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:Q9LFD0"
FT                   /protein_id="CAB69834.1"
FT                   /translation="MGCICFKSWRRSSSSPSITSTVIDDLENVREYDADDDGGHYPLIF
FT                   REFSLEQLRIATDGFSAGNIVSEHNDSVPNIVYKGKLGDGRRIAVKRFQRLSWPDPFEF
FT                   INEAQAVGRLRSEHMANLIGCCCDDNERLLVAEYMPNGTLAKHLFHWEKRPMKWEMRLK
FT                   VALHTARALEYCNDKGIDLYHDLNPYRIMFDKTGIPKLSCFGLMKNSHEGKIYSTNLAF
FT                   APPEYLRLGTVIAESVTFSFGTLLLDLMSGRHIPPNHALDLFRGKNYLVLMDSALDGQF
FT                   SDEDRTELIHVASRCFKTEPEERPSIKFLKATLSRLQKRAKLCPINVKRPMSPPSKNLP
FT                   EKTKPATESLKLTPFGDACSRADLSSIHELLEKLGYEEDNGVGNEFSFQMWTGEMQENM
FT                   DYKKHGDAAFLAKDFDTAIEFYTEFMTGAPTVSPTVLARRCLCYLMTEMFSEALSDAMQ
FT                   AQVASPEWPIPLYLQAACLFKLEMEAEAKEALRHGSALEAY"
FT   exon            18157..18471
FT                   /number=1
FT   intron          18472..18552
FT                   /number=1
FT   exon            18553..18688
FT                   /number=2
FT   intron          18689..18775
FT                   /number=2
FT   exon            18776..18909
FT                   /number=3
FT   intron          18910..18996
FT                   /number=3
FT   exon            18997..19188
FT                   /number=4
FT   intron          19189..19274
FT                   /number=4
FT   exon            19275..19496
FT                   /number=5
FT   intron          19497..19597
FT                   /number=5
FT   exon            19598..19753
FT                   /number=6
FT   intron          19754..19828
FT                   /number=6
FT   exon            19829..19942
FT                   /number=7
FT   intron          19943..20033
FT                   /number=7
FT   exon            20034..20264
FT                   /number=8
FT   gene            20842..21216
FT                   /gene="F7J8_50"
FT   CDS_pept        complement(20842..21216)
FT                   /gene="F7J8_50"
FT                   /product="putative protein"
FT                   /note="similarity to various predicted proteins,
FT                   Arabidopsis thaliana"
FT                   /note="Contains Cytochrome c family heme-binding site
FT                   signature AA78-83"
FT                   /db_xref="GOA:Q9LFC9"
FT                   /db_xref="InterPro:IPR011016"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="UniProtKB/TrEMBL:Q9LFC9"
FT                   /protein_id="CAB69835.1"
FT                   /translation="MSSYEISHIDLENGSGERQYRPSDVSGEDSSSCDYDYDFHSAVRS
FT                   FCGEFEIADDLDDETDTESVASGSIRGSPEKDCRICHLGLESSRHECGDPMVLGCSCKD
FT                   DLGYVHKQCADTWFKIKGNK"
FT   exon            complement(20842..21216)
FT                   /number=1
FT   gene            22512..24503
FT                   /gene="F7J8_60"
FT   CDS_pept        complement(join(22512..22664,24042..24503))
FT                   /gene="F7J8_60"
FT                   /product="putative protein"
FT                   /note="similarity to predicted protein, Arabidopsis
FT                   thaliana"
FT                   /db_xref="UniProtKB/TrEMBL:Q9LFC8"
FT                   /protein_id="CAB69836.1"
FT                   /translation="MLLCWYNYISRTLPFEAPREIFHKTKRVKKNGTMIPSPQSGDYRS
FT                   FFNSSSPLPLIIELVHVQIIKFKDSSQIFKSLKKNGIITAFPWKSGYRSILNLFYPTAS
FT                   SLEFVSKSLYALFARAVYDHPLVEDFAKLVFMVESAIVSTDFSTIANFLKDYNFPVDPT
FT                   PTTKASIKPGPIEHGTPLNPYIPKPPSPSSSPPPQQSQDGG"
FT   exon            complement(22512..22664)
FT                   /number=1
FT   intron          complement(22665..24041)
FT                   /number=1
FT   misc_feature    23929..25369
FT                   /note="basepairs 20181-21621 are nearly identical to
FT                   stretch on BAC T17H7 (EMBL:AC004135)"
FT   exon            complement(24042..24503)
FT                   /number=2
FT   gene            28472..29533
FT                   /gene="F7J8_70"
FT   CDS_pept        28472..29533
FT                   /gene="F7J8_70"
FT                   /product="lectin-like protein"
FT                   /note="similarity to lectin precursor LECSJAbmII, Sophora
FT                   japonica, EMBL:SJU63012"
FT                   /db_xref="GOA:Q9LFC7"
FT                   /db_xref="InterPro:IPR001220"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="UniProtKB/TrEMBL:Q9LFC7"
FT                   /protein_id="CAB69837.1"
FT                   /translation="MAVFKTLAFLFVLSIVIYQSVAVTDVNSSFSFNGFVKAPSFDNNV
FT                   ALFGDSKLVHGGPSIQLTDSVSRSEGRVIYKKPIRLFQGKERNFSGSFSTSFSFSMSDE
FT                   IGSVLAFIMVPRGLDLRLFGRKGNNSSSGLGFLLKHKVVAVEFGISKRGNHVGILVGRP
FT                   ESGKVRKLSSFGHHFNEEKRLNCWIDYEASSKRIEVRLSLSAALKPVDPFVSYSVDLAK
FT                   LWKDGKFMVGLTSANGNTSKPVYLHSWSFKLRHPSMRIHSQPLDPNDVSKTVKEGEKTV
FT                   EVKGKGKCIWRILGALVLGAVCGTLGAMFALYLWTICGNRQSMAIVPEECADEKADILV
FT                   TKADVVVEEEVKK"
FT   exon            28472..29533
FT                   /number=1
FT   gene            30289..33173
FT                   /gene="F7J8_80"
FT   CDS_pept        complement(join(30289..30550,30636..31112,31204..31436,
FT                   31539..31671,31744..31832,31914..31984,32073..32142,
FT                   32613..33173))
FT                   /gene="F7J8_80"
FT                   /product="putative protein"
FT                   /note="similarity to auxin-independent growth promoter,
FT                   Nicotiana tabacum, PIR:A44226"
FT                   /note="Contains Prokaryotic membrane lipoprotein lipid
FT                   attachment site AA61-71"
FT                   /db_xref="GOA:Q9LFC6"
FT                   /db_xref="InterPro:IPR019378"
FT                   /db_xref="InterPro:IPR024709"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9LFC6"
FT                   /protein_id="CAB69838.1"
FT                   /translation="MSVGVPVNPSSSSQLPAAPTTTTRRRVADSQEDHSHVNTVGGGNA
FT                   VVYVPDEEETATSCCGGGGGGGSLSCCPSGSHHNYLVGFLSLRKFRLVWMLMVENKSKW
FT                   TAGIARNMRSTTNLGRFILTLLSILVVTFFLIVALSGGVGRRRKHVEKHEFVVSIHPRP
FT                   TIEKIIREDESSNSFQVLVPKTTSIPEIWNQPEVGNYQKCVARPKNQRPIKQTNGYLLV
FT                   HANGGLNQMRTGICDMVAIAKIMNATLVLPFLDHSSFWSDPSSFKDIFDWKHFIKVLAE
FT                   DVNIVEYLPQEFASIKPLEKNPVSWSKSSYYRNSISKLLKKHKVIVFNHTDSRLANNSP
FT                   PPSIQRLRCRANYEALRYSEDIENLSNVLSSRLRENNEPYLALHLRYEKDMLAFTGCNH
FT                   SLSNEESIDLEKMRFSIPHWKEKVINGTERRLEGNCPMTPREAAVFLKAMGFPSTTNIY
FT                   IVAGKIYGQNSMTAFHEEFPNVFFHNTLATEEELSTIKPYQNRLAALDYNLALESDIFA
FT                   YTYDGNMAKAVQGHRRFEGFRKTINPDRQRFVRLIDRLDAGLISWEDFSSKVKKMHQHR
FT                   IGAPYLRQPGKAGMSPKLEENFYANPLPGCVCDTSEEQTGLNRFERPSLRAQSLR"
FT   exon            complement(30289..30550)
FT                   /number=1
FT   intron          complement(30551..30635)
FT                   /number=1
FT   exon            complement(30636..31112)
FT                   /number=2
FT   intron          complement(31113..31203)
FT                   /number=2
FT   exon            complement(31204..31436)
FT                   /number=3
FT   intron          complement(31437..31538)
FT                   /number=3
FT   exon            complement(31539..31671)
FT                   /number=4
FT   intron          complement(31672..31743)
FT                   /number=4
FT   exon            complement(31744..31832)
FT                   /number=5
FT   intron          complement(31833..31913)
FT                   /number=5
FT   exon            complement(31914..31984)
FT                   /number=6
FT   intron          complement(31985..32072)
FT                   /number=6
FT   exon            complement(32073..32142)
FT                   /number=7
FT   intron          complement(32143..32612)
FT                   /number=7
FT   exon            complement(32613..33173)
FT                   /number=8
FT   gene            37531..39720
FT                   /gene="F7J8_90"
FT   CDS_pept        complement(37531..39720)
FT                   /gene="F7J8_90"
FT                   /product="putative protein"
FT                   /note="similarity to crp1 protein, Zea mays, PIR:T01685"
FT                   /db_xref="InterPro:IPR002885"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9LFC5"
FT                   /protein_id="CAB69839.1"
FT                   /translation="MIVHRIIPSRVKDPLTRFKPLKNLTTSSSPVFEPSSSSSSSSSSA
FT                   SFSVSDSFLVEKICFSLKQGNNNVRNHLIRLNPLAVVEVLYRCRNDLTLGQRFVDQLGF
FT                   HFPNFKHTSLSLSAMIHILVRSGRLSDAQSCLLRMIRRSGVSRLEIVNSLDSTFSNCGS
FT                   NDSVFDLLIRTYVQARKLREAHEAFTLLRSKGFTVSIDACNALIGSLVRIGWVELAWGV
FT                   YQEISRSGVGINVYTLNIMVNALCKDGKMEKVGTFLSQVQEKGVYPDIVTYNTLISAYS
FT                   SKGLMEEAFELMNAMPGKGFSPGVYTYNTVINGLCKHGKYERAKEVFAEMLRSGLSPDS
FT                   TTYRSLLMEACKKGDVVETEKVFSDMRSRDVVPDLVCFSSMMSLFTRSGNLDKALMYFN
FT                   SVKEAGLIPDNVIYTILIQGYCRKGMISVAMNLRNEMLQQGCAMDVVTYNTILHGLCKR
FT                   KMLGEADKLFNEMTERALFPDSYTLTILIDGHCKLGNLQNAMELFQKMKEKRIRLDVVT
FT                   YNTLLDGFGKVGDIDTAKEIWADMVSKEILPTPISYSILVNALCSKGHLAEAFRVWDEM
FT                   ISKNIKPTVMICNSMIKGYCRSGNASDGESFLEKMISEGFVPDCISYNTLIYGFVREEN
FT                   MSKAFGLVKKMEEEQGGLVPDVFTYNSILHGFCRQNQMKEAEVVLRKMIERGVNPDRST
FT                   YTCMINGFVSQDNLTEAFRIHDEMLQRGFSPDDKF"
FT   exon            complement(37531..39720)
FT                   /number=1
FT   gene            40698..42403
FT                   /gene="F7J8_100"
FT   CDS_pept        join(40698..41345,41429..42178,42269..42403)
FT                   /gene="F7J8_100"
FT                   /product="putative protein"
FT                   /note="similarity to predicted protein, Arabidopsis
FT                   thaliana"
FT                   /note="Contains Type-1 copper (blue) proteins signature
FT                   AA336-350"
FT                   /db_xref="InterPro:IPR007750"
FT                   /db_xref="UniProtKB/TrEMBL:Q9LFC4"
FT                   /protein_id="CAB69840.1"
FT                   /translation="MSDDFENSVINLKLLIDEEKNKVVFAEAGTDFVDILFSFSTLPMG
FT                   TIVRLLEMHHKSRSIAIGCFNNIYASVVSMGMKHFSTQACKQMLLFPGSLNQDKCQNMK
FT                   LKIDDSEATKCFMCPMFVRSGQCSKGYSNFKTSRCSCGNFMDEVIQFQGEGGRGNGSQA
FT                   EVFVRGAHTSFIITDDLKVQVNSVGSTLNVLKDLAYADCDKLVEMILEVNLQEVATLLV
FT                   CLFTSDTPLTDTFLKKKSSHGMNRIHKRPSPSLSEDREETKADQTIMLNAYVRKEEGNI
FT                   LYVECGDDFVDLLFSFLAMPLESVWDISGRGIILGCIGNLCKSFKDLSSASATEASAFK
FT                   CVLPHYYKCQKQLLNDVVTTHQPPTYYRFVSFSADHFREYRLSENSGKRLVYDWDKLVP
FT                   VTSIDPKTEGNNTAETSGFVKRGTKFMVTDDLIINPSNSTSTIGFLKEKQTRLDEVEIR
FT                   VINMTKEEAIRLLGASMVTSSALSTGLLAMESASTSDPKCRFFKKPKIETET"
FT   exon            40698..41345
FT                   /number=1
FT   intron          41346..41428
FT                   /number=1
FT   exon            41429..42178
FT                   /number=2
FT   intron          42179..42268
FT                   /number=2
FT   exon            42269..42403
FT                   /number=3
FT   gene            43059..44795
FT                   /gene="F7J8_110"
FT   CDS_pept        join(43059..43670,43772..44405,44496..44616,44708..44795)
FT                   /gene="F7J8_110"
FT                   /product="putative protein"
FT                   /note="similarity to predicted protein, Arabidopsis
FT                   thaliana"
FT                   /db_xref="InterPro:IPR007750"
FT                   /db_xref="UniProtKB/TrEMBL:Q9LFC3"
FT                   /protein_id="CAB69841.1"
FT                   /translation="MAESSEEPKVSLRLFIDEEKNKVVLAEASKAFVDVLFSLLTLPMG
FT                   TIIRLLEEHRESQPITVGCFSNLYRSVAEMGIDNFKTDVCKHILLHPRSVRDLQYKRLM
FT                   LNINPTEVKLFKCPISCNFYSHFSTSRCQCGSSMNKEFQEPRVVPVASSIQNDVNGVFI
FT                   ITDDLKVAVRSTDVVLNELKSLGSGDISKLREMLVYIGFEEVLTLLECMFSSKAPLTNT
FT                   FLNKQTFQGQGVTKVYETLSPCMETNGDTFLTLDVIVRKQDMEILYVECGEDFVDLLFT
FT                   FLAVPLEYVVGISGNSCSFVCIRNLIRSFKDLNAAEVSTSKSAIHHFYTCQKQLLNIIT
FT                   DQPPLYHRYNYYSLKECSGSTPLILIDPEGSGFVKRETKFTVSDDLIVTAMNSSSPICL
FT                   LQKFQIHADDLEVQQISYEFAESFLGNILCIENFFKELDFEEPRGRDLKKQREILASLM
FT                   RASLLTSSALNSALWNLIAKKIKDET"
FT   exon            43059..43670
FT                   /number=1
FT   intron          43671..43771
FT                   /number=1
FT   exon            43772..44405
FT                   /number=2
FT   intron          44406..44495
FT                   /number=2
FT   exon            44496..44616
FT                   /number=3
FT   intron          44617..44707
FT                   /number=3
FT   exon            44708..44795
FT                   /number=4
FT   gene            45308..46854
FT                   /gene="F7J8_120"
FT   CDS_pept        join(45308..45392,45441..46639,46717..46854)
FT                   /gene="F7J8_120"
FT                   /product="putative protein"
FT                   /note="similarity to predicted protein, Arabidopsis
FT                   thaliana"
FT                   /db_xref="InterPro:IPR007750"
FT                   /db_xref="UniProtKB/TrEMBL:Q9LFC2"
FT                   /protein_id="CAB69842.1"
FT                   /translation="MAQSSTEPKFSLRLIIDEEKNKVVLAEAGTIVRLLAKHRKSDPVT
FT                   IGCLRNLYTSVVDMELDDFETDACKQMLLYPKNIREAQYRNFKLNIDTNESLKCFGCRF
FT                   FSICRMCSNFNTSLCKCGKLMNEEISFLEYEENDVEGVFMRDKSSFIITDDLRLTDDST
FT                   SSLLQTLKDLGCADVSKLREQVLDIGLKEVMTLMQCVFTSNTPLTDAFLKNQSSNTVRK
FT                   IYRKLSDDKGDEAEPDKVITIDAIVRKQDMKILYVECGEDFVDLLFTFLAIPLESIWEI
FT                   SGNSITIGRIGNLFRSFKDLSDNEVLSASKCMIPYYYRCQKQLLKIRTPTPRVYLGHCY
FT                   SKTLSYSQSFYLTTKRTTKRMTFVDPKSDCCGRSKDGKGFVKRGTKFIVSDDLIVTPKI
FT                   SSSTFSVLKKFQILTDDLEVQAITISNADALNLLGASLVTSSALSSAFGNLIVKKPKEE
FT                   NVSWNPVSKKPKVET"
FT   exon            45308..45392
FT                   /number=1
FT   intron          45393..45440
FT                   /number=1
FT   exon            45441..46639
FT                   /number=2
FT   intron          46640..46716
FT                   /number=2
FT   exon            46717..46854
FT                   /number=3
FT   gene            47405..49066
FT                   /gene="F7J8_130"
FT   CDS_pept        join(47405..48040,48125..48856,48929..49066)
FT                   /gene="F7J8_130"
FT                   /product="putative protein"
FT                   /note="similarity to predicted protein, Arabidopsis
FT                   thaliana"
FT                   /note="Contains Crystallins beta and gamma 'Greek key'
FT                   motif signature AA113-128"
FT                   /db_xref="GOA:Q9LFC1"
FT                   /db_xref="InterPro:IPR007750"
FT                   /db_xref="UniProtKB/TrEMBL:Q9LFC1"
FT                   /protein_id="CAB69843.1"
FT                   /translation="MAKSSEEPKFSLRLIVDEEKNKVVLAEACRDFVDVLFSLLTLPMG
FT                   TIVRLLENHRKSEPVTLGCFNNLYRSVVDMGSDCFETEACKQMLVYPKSVKDLQCKRLK
FT                   LNINPTEDIKCFKCSSYCGLYSNFSTSKCRCGKFMNEEIQLENEEQDLGRFQDDDNGVF
FT                   VSGRCSFVLTDDLEVSVKSTELVLNKLKSLGCADVGKLGERLLDIGVKEVLTLLGCIFS
FT                   SNAPLKDIFLNKKITQGATKFYKSQSPCLEKKEDEAEPEKVVTLKAFVRKQDMKILFVE
FT                   CGEEFVELLFSFIAVPLESAWEISGSSISLGCIGNMCRTFRDLNEETQMSTSTCALPSF
FT                   YNFQMQLPGIITQQPPVYYRYRLYDYRQMNYGLTTNGNRTTYYRKDRIVRVDLKDPKSR
FT                   GSDKSAQGFLKKATKCTVLDDLTITSMNSCSTVCLLKKLQSHADDLEVQVISISNAEAL
FT                   DLLRASLVTSSALSTTLWNLIAKKLKEETDLWDTVSKKVKEET"
FT   exon            47405..48040
FT                   /number=1
FT   intron          48041..48124
FT                   /number=1
FT   exon            48125..48856
FT                   /number=2
FT   intron          48857..48928
FT                   /number=2
FT   exon            48929..49066
FT                   /number=3
FT   gene            49697..51144
FT                   /gene="F7J8_140"
FT   CDS_pept        join(49697..49951,50074..50132,50376..51144)
FT                   /gene="F7J8_140"
FT                   /product="putative protein"
FT                   /note="similarity to various predicted proteins"
FT                   /note="Contains Immunoglobulins and major
FT                   histocompatibility complex proteins signature
FT                   AA123-129;Zinc finger, C2H2 type, domain AA125-148;Zinc
FT                   finger, C3HC4 type (RING finger), signature AA88-97"
FT                   /db_xref="GOA:Q9LFC0"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR017907"
FT                   /db_xref="InterPro:IPR040380"
FT                   /db_xref="InterPro:IPR040383"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9LFC0"
FT                   /protein_id="CAB69844.1"
FT                   /translation="MLQIRLRRDSPTETGNGARPSPTETVTVACPDHLVLADLPVAKGI
FT                   GSVTPTTVIKPVGRRSRRQLGERVHFCVRCDFPIAIYGRLIPCDHAFCLECARSDSICY
FT                   LCDERIQKIQTIKMMEGIFICAAPHCLRSFLKKLDFEAHVHDLHGSLLQADAEKEDGNQ
FT                   SDVQSTMQQSSASESTLRAPLRSQLQQSRELNRSASFAKSQSGFSQVQNYPPDSDNSRP
FT                   PGFETASPKPGIRFPDYPQPMNLMQPPSLPVPMNQNPGLPQQFGFPSYPTTESGSSQQF
FT                   FNGAQYEMTRTESGGSEQSSLLGYPPPSPMTNLNFQGSYPPPSWNPGMAPPHTTQQVNR
FT                   GRDGQSFGWPQENRDGFGQE"
FT   exon            49697..49951
FT                   /number=1
FT   intron          49952..50073
FT                   /number=1
FT   exon            50074..50132
FT                   /number=2
FT   intron          50133..50375
FT                   /number=2
FT   exon            50376..51144
FT                   /number=3
FT   gene            53732..55438
FT                   /gene="F7J8_150"
FT   CDS_pept        53732..55438
FT                   /gene="F7J8_150"
FT                   /product="putative protein"
FT                   /note="similarity to predicted proteins, Arabidopsis
FT                   thaliana"
FT                   /db_xref="GOA:Q9LFB9"
FT                   /db_xref="InterPro:IPR008004"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9LFB9"
FT                   /protein_id="CAB69845.1"
FT                   /translation="MNLSADQAPVTAVDELAPPSQPHRLSTSCDLHPEERFSGFCPSCL
FT                   CDRLSVLDHNAAPPPSSSSRKPPSISAVSLKALFKPSSSGTNNSNGNGRVRPGFFPELR
FT                   RTKSFSAKNNEGFSGGFEPQRRSCDVRLRDDERNLPINEAASVDKIEEEARESSVSEIV
FT                   LEVTEEAEIEEDEENGEKDPGEIVEEKSSEIGEEEEELKPMKDYMDLYSQTKKPSVKDF
FT                   AGSFFSAASVFSKKLQKWKQKQKVKKPRNGVGGGRPQSEIGVGRRSSDTDPRFSLDAGR
FT                   FSVDIGRISMDDSRYSLDEPRASWDGHLIGRTTAARVPLPPSMLSVVENAPLNRSDMQI
FT                   PSSPSIKPISGDSDPIIIIPGGSNQTRDYYTGPPSSRRRKSLDRSNSIRKIVTELEDVK
FT                   SVSNSTTTIDSNSMETAENKGNQNGDKKSRRWGKWSILGFIYRKGKDDEEEDRYSRSNS
FT                   AGMVERSLSESWPEMRNGEGGGPKMRRSNSNVSWRSSGGGSARNKSSRYSSKDGENGML
FT                   RFYLTPMRRSWKTSGGSGGGGGGGGGGGWEKTAAKANSHGHSIARRVMRLY"
FT   exon            53732..55438
FT                   /number=1
FT   gene            56674..58657
FT                   /gene="F7J8_160"
FT   CDS_pept        complement(join(56674..57508,57583..58133,58235..58452,
FT                   58549..58657))
FT                   /gene="F7J8_160"
FT                   /product="oligopeptide transporter-like protein"
FT                   /note="strong similarity to peptide transport protein ptr1,
FT                   Hordeum vulgare, PIR:T04378"
FT                   /note="Contains Prokaryotic membrane lipoprotein lipid
FT                   attachment site AA456-466;PTR2 family proton/oligopeptide
FT                   symporters signatures AA86-110;PTR2 family
FT                   proton/oligopeptide symporters signatures AA183-195"
FT                   /db_xref="GOA:Q9LFB8"
FT                   /db_xref="InterPro:IPR000109"
FT                   /db_xref="InterPro:IPR018456"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9LFB8"
FT                   /protein_id="CAB69846.1"
FT                   /translation="MEDDKDIYTKDGTLDIHKKPANKNKTGTWKACRFILGTECCERLA
FT                   YYGMSTNLINYLEKQMNMENVSASKSVSNWSGTCYATPLIGAFIADAYLGRYWTIASFV
FT                   VIYIAGMTLLTISASVPGLTPTCSGETCHATAGQTAITFIALYLIALGTGGIKPCVSSF
FT                   GADQFDDTDEKEKESKSSFFNWFYFVINVGAMIASSVLVWIQMNVGWGWGLGVPTVAMA
FT                   IAVVFFFAGSNFYRLQKPGGSPLTRMLQVIVASCRKSKVKIPEDESLLYENQDAESSII
FT                   GSRKLEHTKILTFFDKAAVETESDNKGAAKSSSWKLCTVTQVEELKALIRLLPIWATGI
FT                   VFASVYSQMGTVFVLQGNTLDQHMGPNFKIPSASLSLFDTLSVLFWAPVYDKLIVPFAR
FT                   KYTGHERGFTQLQRIGIGLVISIFSMVSAGILEVARLNYVQTHNLYNEETIPMTIFWQV
FT                   PQYFLVGCAEVFTFIGQLEFFYDQAPDAMRSLCSALSLTAIAFGNYLSTFLVTLVTKVT
FT                   RSGGRPGWIAKNLNNGHLDYFFWLLAGLSFLNFLVYLWIAKWYTYKKTTGHAL"
FT   exon            complement(56674..57508)
FT                   /number=1
FT   intron          complement(57509..57582)
FT                   /number=1
FT   exon            complement(57583..58133)
FT                   /number=2
FT   intron          complement(58134..58234)
FT                   /number=2
FT   exon            complement(58235..58452)
FT                   /number=3
FT   intron          complement(58453..58548)
FT                   /number=3
FT   exon            complement(58549..58657)
FT                   /number=4
FT   repeat_region   60189..60530
FT                   /rpt_type=LONG_TERMINAL_REPEAT
FT                   /note="341 bp LTR"
FT   misc_feature    60531..66279
FT                   /note="LTR retrotransposon"
FT   repeat_region   66280..66621
FT                   /rpt_type=LONG_TERMINAL_REPEAT
FT                   /note="341 bp LTR"
FT   gene            67809..70029
FT                   /gene="F7J8_170"
FT   CDS_pept        join(67809..67898,68034..68185,68276..68520,68611..68739,
FT                   68866..69780,69899..70029)
FT                   /gene="F7J8_170"
FT                   /product="laccase-like protein"
FT                   /note="strong similarity to laccase precursor, Nicotiana
FT                   tabacum, PIR:JC5229"
FT                   /note="Contains Multicopper oxidases signatures
FT                   AA511-531;Multicopper oxidases signatures AA516-527"
FT                   /db_xref="GOA:Q6ID18"
FT                   /db_xref="InterPro:IPR001117"
FT                   /db_xref="InterPro:IPR002355"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR011706"
FT                   /db_xref="InterPro:IPR011707"
FT                   /db_xref="InterPro:IPR017761"
FT                   /db_xref="InterPro:IPR033138"
FT                   /db_xref="InterPro:IPR034285"
FT                   /db_xref="InterPro:IPR034288"
FT                   /db_xref="InterPro:IPR034289"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6ID18"
FT                   /protein_id="CAB69847.1"
FT                   /translation="MVFPIRILVLFALLAFPACVHGAIRKYTFNVVTKQVTRICSTKQI
FT                   VTVNGKFPGPTIYANEDDTILVNVVNNVKYNVSIHWHGIRQLRTGWADGPAYITQCPIK
FT                   PGHSYVYNFTVTGQRGTLWWHAHVLWLRATVHGAIVILPKLGLPYPFPKPHREEVIILG
FT                   EWWKSDTETVVNEALKSGLAPNVSDAHVINGHPGFVPNCPSQAVESGKTYMLRLINAAL
FT                   NEELFFKIAGHRFTVVEVDAVYVKPFNTDTILIAPGQTTTALVSAARPSGQYLIAAAPF
FT                   QDSAVVAVDNRTATATVHYSGTLSATPTKTTSPPPQNATSVANTFVNSLRSLNSKTYPA
FT                   NVPITVDHDLLFTVGLGINRCHSCKAGNFSRVVAAINNITFKMPKTALLQAHYFNLTGI
FT                   YTTDFPAKPRRVFDFTGKPPSNLATMKATKLYKLPYNSTVQVVLQDTGNVAPENHPIHL
FT                   HGFNFFVVGLGTGNYNSKKDSNKFNLVDPVERNTVGVPSGGWAAIRFRADNPGVWFMHC
FT                   HLEVHTTWGLKMAFLVENGKGPNQSIRPPPSDLPKC"
FT   exon            67809..67898
FT                   /number=1
FT   intron          67899..68033
FT                   /number=1
FT   exon            68034..68185
FT                   /number=2
FT   intron          68186..68275
FT                   /number=2
FT   exon            68276..68520
FT                   /number=3
FT   intron          68521..68610
FT                   /number=3
FT   exon            68611..68739
FT                   /number=4
FT   intron          68740..68865
FT                   /number=4
FT   exon            68866..69780
FT                   /number=5
FT   intron          69781..69898
FT                   /number=5
FT   exon            69899..70029
FT                   /number=6
FT   gene            72533..73711
FT                   /gene="F7J8_180"
FT   CDS_pept        join(72533..72993,73369..73711)
FT                   /gene="F7J8_180"
FT                   /product="putative protein"
FT                   /note="similarity to Myb-related transcriptional activator
FT                   mybSt1, Solanum tuberosum, EMBL:S74753"
FT                   /note="Contains ATP/GTP-binding site motif A (P-loop)
FT                   AA58-65"
FT                   /db_xref="GOA:Q9LFB6"
FT                   /db_xref="InterPro:IPR001005"
FT                   /db_xref="InterPro:IPR006447"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR017884"
FT                   /db_xref="InterPro:IPR017930"
FT                   /db_xref="UniProtKB/TrEMBL:Q9LFB6"
FT                   /protein_id="CAB69848.1"
FT                   /translation="MSSSTMYRGVNMFSPANTNWIFQEVREATWTAEENKRFEKALAYL
FT                   DDKDNLESWSKIADLIPGKTVADVIKRYKELEDDVSDIEAGLIPIPGYGGDASSAANSD
FT                   YFFGLENSSYGYDYVVGGKRSSPAMTDCFRSPMPEKERKKGVPWTEDEHLRFLMGLKKY
FT                   GKGDWRNIAKSFVTTRTPTQVASHAQKYFLRQLTDGKDKRRSSIHDITTVNIPDADASA
FT                   TATTADVALSPTPANSFDVFLQPNPHYSFASASASSYYNAFPQWS"
FT   exon            72533..72993
FT                   /number=1
FT   intron          72994..73368
FT                   /number=1
FT   exon            73369..73711
FT                   /number=2
FT   gene            79971..81398
FT                   /gene="F7J8_190"
FT   CDS_pept        79971..81398
FT                   /gene="F7J8_190"
FT                   /product="anthranilate N-benzoyltransferase-like protein"
FT                   /note="similarity to anthranilate N-benzoyltransferase,
FT                   clove pink, PIR:T10717"
FT                   /db_xref="GOA:Q9LFB5"
FT                   /db_xref="InterPro:IPR003480"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="UniProtKB/TrEMBL:Q9LFB5"
FT                   /protein_id="CAB69849.1"
FT                   /translation="MPSCSVTEISKCIVYPEKKSTVSDLRLSVSDLPMLSCHYIQKGVL
FT                   LTSPPPSFSFDDLVSSLRRSLSSTLSLFPALAGRFSTTPAGHISIVCNDAGVDFVAASA
FT                   KHVKLSDVLLPGEDVPLLFREFFVFERLVSYNGHHKPLAAVQVTELHDGVFIGCTVNHS
FT                   VTDGTSFWHFFNTFADVTSGACKIKHLPDFSRHTVFDSPVVLPVPPGGPRVTFDADQPL
FT                   RERIFHFSREAITKLKQRTNNRVNGIETAVNDGRKCNGEINGKITTVLDSFLNNKKSYD
FT                   RTAEISSFQSLSAQLWRSVTRARNLDPSKTTTFRMAVNCRHRLEPKMDPYYFGNAIQSI
FT                   PTLASAGDLLSKDLRWSAEQLHRNVVAHDDATVRRGIAAWESDPRLFPLGNPDGASITM
FT                   GSSPRFPMYDNDFGWGKPLAVRSGGANKFDGKISAFPGREGNGSVDLEVVLAPETMTGI
FT                   ENDAEFMQYVSEVTYDC"
FT   exon            79971..81398
FT                   /number=1
FT   gene            82324..85302
FT                   /gene="F7J8_200"
FT   CDS_pept        complement(join(82324..82599,82831..83047,83141..83197,
FT                   83275..83314,83457..83531,83621..83691,83942..84015,
FT                   84118..84235,84309..84379,84520..84586,84956..85302))
FT                   /gene="F7J8_200"
FT                   /product="putative protein"
FT                   /note="similarity to SqdX protein, Synechococcus PCC7942,
FT                   EMBL:SP45308"
FT                   /note="Contains Prokaryotic membrane lipoprotein lipid
FT                   attachment site AA21-31"
FT                   /db_xref="GOA:Q8S4F6"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8S4F6"
FT                   /protein_id="CAB69850.1"
FT                   /translation="MTTLSSINLSIPPHLLPSTTNTCSSSSATSCSPPRSSSFVLHSPL
FT                   SFGHRRLPISKKSKLRFCGVITKEAVSGSNDMTITQVREDDESEIDAPLLDPESLSKPR
FT                   RIALFVEPSPFAYVSGYKNRFQNFIRYLREMGDEVIVVTTHEGVPEEFYGARVIGSRSF
FT                   PCPYYQKVPLSLALSPRIISEIARFKPDIIHASSPGVMVFGALAIAKMLSVPIVMSYHT
FT                   HVPVAADLTLVPSAAIGKDLIAAGATAANQLRLWNKGVDSESFNPRFRSQEMRRIGVEK
FT                   SLELLKSVMDKLPEARIAFIGDGPYKEDLEKLFTGMPAVFTGTLQGDELSQAYASGDVF
FT                   VMPSESETLGLVVLEAMSSGLPVVAARAGGIPDIIPEDQEGKTGFLFNPGDVEDCVTKL
FT                   RTLLHDRETREIIGKAAREETEKYDWRAATTKIRNEQYSAAIWFWRKKKVHVLGPINWL
FT                   IKRLFPVPEGNV"
FT   exon            complement(82324..82599)
FT                   /number=1
FT   intron          complement(82600..82830)
FT                   /number=1
FT   exon            complement(82831..83047)
FT                   /number=2
FT   intron          complement(83048..83140)
FT                   /number=2
FT   exon            complement(83141..83197)
FT                   /number=3
FT   intron          complement(83198..83274)
FT                   /number=3
FT   exon            complement(83275..83314)
FT                   /number=4
FT   intron          complement(83315..83456)
FT                   /number=4
FT   exon            complement(83457..83531)
FT                   /number=5
FT   intron          complement(83532..83620)
FT                   /number=5
FT   exon            complement(83621..83691)
FT                   /number=6
FT   intron          complement(83692..83941)
FT                   /number=6
FT   exon            complement(83942..84015)
FT                   /number=7
FT   intron          complement(84016..84117)
FT                   /number=7
FT   exon            complement(84118..84235)
FT                   /number=8
FT   intron          complement(84236..84308)
FT                   /number=8
FT   exon            complement(84309..84379)
FT                   /number=9
FT   intron          complement(84380..84519)
FT                   /number=9
FT   exon            complement(84520..84586)
FT                   /number=10
FT   intron          complement(84587..84955)
FT                   /number=10
FT   exon            complement(84956..85302)
FT                   /number=11
FT   gene            88206..90797
FT                   /gene="F7J8_210"
FT   CDS_pept        complement(join(88206..88426,88706..88811,89151..89243,
FT                   89366..89418,89503..89563,89681..89789,89899..89948,
FT                   90365..90414,90572..90665,90771..90797))
FT                   /gene="F7J8_210"
FT                   /product="cell division-like protein"
FT                   /note="strong similarity to JM23 protein, Homo sapiens,
FT                   EMBL:AF063015"
FT                   /db_xref="GOA:Q9LFB3"
FT                   /db_xref="InterPro:IPR002877"
FT                   /db_xref="InterPro:IPR015507"
FT                   /db_xref="InterPro:IPR028590"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q9LFB3"
FT                   /protein_id="CAB69851.1"
FT                   /translation="MGKASRDKRDIYYRKAKEEGWRARSAFKLLQIDEEFNIFEGVKRV
FT                   VDLCAAPGSWSQVLSRQLYLPAKSSAESKDGDLPLIVAIDLQPMAPIEGVIQVQGDITN
FT                   ARTAEVVIRHFDGCKADLVVCDGAPDVTGLHDMDEFVQSQLILAGLTIVTHILKEGGKF
FT                   IAKIFRGKDTSLLYCQAFAVCENYSPPEGFNPRDLHRLLEKVGSPSGGSDLDCSSGWLE
FT                   GPNKVYIPFLACGDLTGYDSDRSYPLPREADGSSYQSLDPIQPPIAPPYKRALELKKAS
FT                   AQSFNS"
FT   exon            complement(88206..88426)
FT                   /number=1
FT   intron          complement(88427..88705)
FT                   /number=1
FT   exon            complement(88706..88811)
FT                   /number=2
FT   intron          complement(88812..89150)
FT                   /number=2
FT   exon            complement(89151..89243)
FT                   /number=3
FT   intron          complement(89244..89365)
FT                   /number=3
FT   exon            complement(89366..89418)
FT                   /number=4
FT   intron          complement(89419..89502)
FT                   /number=4
FT   exon            complement(89503..89563)
FT                   /number=5
FT   intron          complement(89564..89680)
FT                   /number=5
FT   exon            complement(89681..89789)
FT                   /number=6
FT   intron          complement(89790..89898)
FT                   /number=6
FT   exon            complement(89899..89948)
FT                   /number=7
FT   intron          complement(89949..90364)
FT                   /number=7
FT   exon            complement(90365..90414)
FT                   /number=8
FT   intron          complement(90415..90571)
FT                   /number=8
FT   exon            complement(90572..90665)
FT                   /number=9
FT   intron          complement(90666..90770)
FT                   /number=9
FT   exon            complement(90771..90797)
FT                   /number=10
FT   gene            93645..96910
FT                   /gene="F7J8_220"
FT   CDS_pept        join(93645..93836,94032..94220,94348..94460,94593..94776,
FT                   94858..94955,95535..95742,96051..96308,96686..96910)
FT                   /gene="F7J8_220"
FT                   /product="LAX1 / AUX1-like permease"
FT                   /note="Contains Prokaryotic membrane lipoprotein lipid
FT                   attachment site AA326-336"
FT                   /db_xref="GOA:Q9LFB2"
FT                   /db_xref="InterPro:IPR013057"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9LFB2"
FT                   /protein_id="CAB69852.1"
FT                   /translation="MSGEKQAEESIVVSGEDEVAGRKVEDSAAEEDIDGNGGNGFSMKS
FT                   FLWHGGSAWDAWFSCASNQVAQVLLTLPYSFSQLGMLSGILLQIFYGLMGSWTAYLISV
FT                   LYVEYRARMEKQEAKSFKNHVIQWFEVLDGLLGPYWKAAGLAFNCTFLLFGSVIQLIAC
FT                   ASNIYYINDRLDKRTWTYIFGACCATTVFIPSFHNYRIWSFLGLGMTTYTAWYLTIASF
FT                   LHGQAEGVTHSGPTKLVLYFTGATNILYTFGGHAVTVEIMHAMWKPRKFKSIYLMATLY
FT                   VFTLTLPSASAVYWAFGDQLLNHSNAFSLLPKTRFRDTAVILMLIHQFITFGFACTPLY
FT                   FVWEKAIGMHHTKSLCLRALVRLPVVVPIWFLAIIFPFFGPINSAVGALLVTFTVYIIP
FT                   ALAHMLTYRTASARRNAAEKPPFFIPSWAGVYVINAFIVVWVLVLGFGFGGWASMTNFI
FT                   RQIDTFGLFAKCYQCKPPPAPIAAGAHHRR"
FT   exon            93645..93836
FT                   /number=1
FT   intron          93837..94031
FT                   /number=1
FT   exon            94032..94220
FT                   /number=2
FT   intron          94221..94347
FT                   /number=2
FT   exon            94348..94460
FT                   /number=3
FT   intron          94461..94592
FT                   /number=3
FT   exon            94593..94776
FT                   /number=4
FT   intron          94777..94857
FT                   /number=4
FT   exon            94858..94955
FT                   /number=5
FT   intron          94956..95534
FT                   /number=5
FT   exon            95535..95742
FT                   /number=6
FT   intron          95743..96050
FT                   /number=6
FT   exon            96051..96308
FT                   /number=7
FT   intron          96309..96685
FT                   /number=7
FT   exon            96686..96910
FT                   /number=8
FT   gene            97787..99010
FT                   /gene="F7J8_230"
FT   CDS_pept        complement(97787..99010)
FT                   /gene="F7J8_230"
FT                   /product="putative protein"
FT                   /note="similarity to alpha-1,
FT                   4-N-acetylglucosaminyltransferase, Homo sapiens,
FT                   EMBL:AF141315"
FT                   /db_xref="GOA:Q9LFB1"
FT                   /db_xref="InterPro:IPR007577"
FT                   /db_xref="InterPro:IPR007652"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q9LFB1"
FT                   /protein_id="CAB69853.1"
FT                   /translation="MDRHDIEKRFTVVIDNRRLNQSGSSSLFTAFAISFVTLIVVTTFT
FT                   LISNFSMQPHRDFSGVKIEIKRVIPHLPLSSEREGERSDLLKQQTQVNEKLQVIEVFSG
FT                   DNLSDKFQKRVNEFVGDGCEVNFVMTWISPADFFGNREVLAIESVFKSHPYGCLMILSA
FT                   TMDSPQGYATLKPFIDRGYKVLAVTPDLPFLLKGTAGELWLDEIKSGKRDPGKISLAQN
FT                   LSNLMRLAYLYKYGGVYLDTDMIVLKSFKGLRNVIGAQTLDPSSTNWTRLNNAVLIFDK
FT                   NHPLLLKFMEEFAKTFNGNIWGYNGPYLVSRVARAVEGSSGYNFTVMRPSVFYSVNWLE
FT                   IKKLFKVPKTEKDSKWVKTKLLHMQRNGYGLHLWNKFSRKYEIEQGSAMWKLVSEHCII
FT                   CEISSVSS"
FT   exon            complement(97787..99010)
FT                   /number=1
FT   gene            100784..102462
FT                   /gene="F7J8_240"
FT   CDS_pept        join(100784..100999,101114..101305,101393..101893,
FT                   102214..102462)
FT                   /gene="F7J8_240"
FT                   /product="putative protein"
FT                   /note="similarity to various alpha amylases from diverse
FT                   species"
FT                   /db_xref="GOA:Q9LFB0"
FT                   /db_xref="InterPro:IPR002044"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR013784"
FT                   /db_xref="UniProtKB/TrEMBL:Q9LFB0"
FT                   /protein_id="CAB69854.1"
FT                   /translation="MIGIGRTLTSSSPSKIILEDLPPGIYRYGTEIFTSVPRKTFHHIK
FT                   FLRLDSAQSSRILKPVPLRSSSIKDSQVNVEDEEIEASNKTVRVRFQLRKECVFGEHFF
FT                   IVGDDPVFGGLWDPETALPLNWSDGNVWTVDLDLPVGRLVEFKLLLKAQTGEILWQPGP
FT                   NRALETWETNKTIRICEDWDNADLQMMIEEDFVPYTNISSIGSEDEDEVLGSVQQNSSV
FT                   VAVENAGYVSDESAQNSSFSIQSEKTMEPSNGALTAREVIKEAMFTEEESPVLVPGLIP
FT                   LSDLDNEQVEVINEGKAETFPEVDKKQEPKAERNKKAKVKAISLFEKSEQEAVKSVEQR
FT                   QYNAVEEEQQRLETEPLGTPDVLFENDIQWGRRTLYKLLSNFRLF"
FT   exon            100784..100999
FT                   /number=1
FT   intron          101000..101113
FT                   /number=1
FT   exon            101114..101305
FT                   /number=2
FT   intron          101306..101392
FT                   /number=2
FT   exon            101393..101893
FT                   /number=3
FT   intron          101894..102213
FT                   /number=3
FT   exon            102214..102462
FT                   /number=4
FT   gene            103580..107560
FT                   /gene="F7J8_250"
FT   CDS_pept        complement(join(103580..103728,103868..103964,
FT                   104053..104106,104185..104318,104576..104627,
FT                   104702..105012,105122..105254,105371..105463,
FT                   105550..105655,105747..105813,105907..106071,
FT                   106349..106559,106725..107195,107288..107560))
FT                   /gene="F7J8_250"
FT                   /product="hypothetical protein"
FT                   /note="similarity to RNA polymerase II CTD phosphatase
FT                   (CTDP1), Homo sapiens, EMBL:AF154115"
FT                   /db_xref="GOA:Q5YDB5"
FT                   /db_xref="InterPro:IPR004274"
FT                   /db_xref="InterPro:IPR014720"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR039189"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5YDB5"
FT                   /protein_id="CAB69855.1"
FT                   /translation="MNRLGHKSVVYHGDLRLGELDVNHVSSSHEFRFPNDEIRIHHLSP
FT                   AGERCPPLAILQTIASFAVRCKLESSAPVKSQELMHLHAVCFHELKTAVVMLGDEEIHL
FT                   VAMPSKEKKFPCFWCFSVPSGLYDSCLRMLNTRCLSIVFDLDETLIVANTMKSFEDRIE
FT                   ALKSWISREMDPVRINGMSAELKRYMDDRMLLKQYIDNDYAFDNGVLLKAQPEEVRPTS
FT                   DGQEKVCRPVIRLPEKNTVLTRIKPEIRDTSVLVKLRPAWEELRSYLTAKTRKRFEVYV
FT                   CTMAERDYALEMWRLLDPEAHLISLKELRDRIVCVKPDAKKSLLSVFNGGICHPKMAMV
FT                   IDDRMKVWEDKDQPRVHVVSAYLPYYAPQAEACALVVPHLCVARNVACNVRGYFFKEFD
FT                   ESLMSSISLVYYEDDVENLPPSPDVSNYVVIEDPGFASNGNINAPPINEGMCGGEVERR
FT                   LNQAAAADHSTLPATSNAEQKPETPKPQIAVIPNNASTATAAALLPSHKPSLLGAPRRD
FT                   GFTFSDGGRPLMMRPGVDIRNQNFNQPPILAKIPMQPPSSSMHSPGGWLVDDENRPSFP
FT                   GRPSGLYPSQFPHGTPGSAPVGPFAHPSHLRSEEVAMDDDLKRQNPSRQTTEGGISQNH
FT                   LVSNGREHHTDGGKSNGGQSHLFVSALQEIGRRCGSKVEFRTVISTNKELQFSVEVLFT
FT                   GEKIGIGMAKTKKDAHQQAAENALRSLAEKYVAHVAPLARETEKGPENDNGFLWESSED
FT                   VSNKGLEEEAPKENISEL"
FT   exon            complement(103580..103728)
FT                   /number=1
FT   intron          complement(103729..103867)
FT                   /number=1
FT   exon            complement(103868..103964)
FT                   /number=2
FT   intron          complement(103965..104052)
FT                   /number=2
FT   exon            complement(104053..104106)
FT                   /number=3
FT   intron          complement(104107..104184)
FT                   /number=3
FT   exon            complement(104185..104318)
FT                   /number=4
FT   intron          complement(104319..104575)
FT                   /number=4
FT   exon            complement(104576..104627)
FT                   /number=5
FT   intron          complement(104628..104701)
FT                   /number=5
FT   exon            complement(104702..105012)
FT                   /number=6
FT   intron          complement(105013..105121)
FT                   /number=6
FT   exon            complement(105122..105254)
FT                   /number=7
FT   intron          complement(105255..105370)
FT                   /number=7
FT   exon            complement(105371..105463)
FT                   /number=8
FT   intron          complement(105464..105549)
FT                   /number=8
FT   exon            complement(105550..105655)
FT                   /number=9
FT   intron          complement(105656..105746)
FT                   /number=9
FT   exon            complement(105747..105813)
FT                   /number=10
FT   intron          complement(105814..105906)
FT                   /number=10
FT   exon            complement(105907..106071)
FT                   /number=11
FT   intron          complement(106072..106348)
FT                   /number=11
FT   exon            complement(106349..106559)
FT                   /number=12
FT   intron          complement(106560..106724)
FT                   /number=12
FT   exon            complement(106725..107195)
FT                   /number=13
FT   intron          complement(107196..107287)
FT                   /number=13
FT   exon            complement(107288..107560)
FT                   /number=14
FT   misc_feature    107359..118507
FT                   /note="basepairs 103611-114759 overlap to BAC T10O8"
FT   gene            109602..111654
FT                   /gene="F7J8_260"
FT   CDS_pept        complement(join(109602..109790,109882..110904,
FT                   111021..111108,111572..111654))
FT                   /gene="F7J8_260"
FT                   /product="putative protein"
FT                   /note="similarity to proteophosphoglycan ppg1, Leishmania
FT                   major, EMBL:LMA243459"
FT                   /note="Contains ATP/GTP-binding site motif A (P-loop)
FT                   AA366-373"
FT                   /db_xref="GOA:Q9LFA8"
FT                   /db_xref="UniProtKB/TrEMBL:Q9LFA8"
FT                   /protein_id="CAB69856.1"
FT                   /translation="MSSQQYPVRRTAGENLLYSDGEKSDYEWLVTPPGSPSRNVTNHLN
FT                   APDDNLMTLISRLENYSKEESEHQTTSLHSSSSVSGIRRPSSSSSSRSTSRPPTPTRKS
FT                   KTPAKRPSTPTSRATSTTTRATLTSSSTTSSTRSWSRPSSSSGTGTSRVTLTAARATRP
FT                   TTSTDQQTTGSATSTRSNNRPMSAPNSKPGSRSSTPTRRPSTPNGSSTVLRSKPTKPLS
FT                   KPALSLEASPIVRSRPWEPYEMPGFSVEAPSNLRTTLPDRPQTASSSRTRAFDASSSSR
FT                   SASTERDVAKRQSCSPSRSRAPNGNVNGAVPSLRGQRAKTNNDDGRLISHAAKGNQKVE
FT                   KVVNMRKLATPRLTESGSRRLGGGGGDSSAGKSSSGSGGFGFGRNLSKSSIDMALRHMD
FT                   VRKGSMAGNFRHSVTKAPATSVYSVRSCRNRPVSSSRSSESSVNILCLDGSDDNLSDMS
FT                   CS"
FT   exon            complement(109602..109790)
FT                   /number=1
FT   intron          complement(109791..109881)
FT                   /number=1
FT   exon            complement(109882..110904)
FT                   /number=2
FT   intron          complement(110905..111020)
FT                   /number=2
FT   exon            complement(111021..111108)
FT                   /number=3
FT   intron          complement(111109..111571)
FT                   /number=3
FT   exon            complement(111572..111654)
FT                   /number=4
FT   gene            112937..116809
FT                   /gene="F7J8_270"
FT   CDS_pept        join(112937..113035,113159..113276,113350..113468,
FT                   113559..113660,113747..113809,113939..114073,
FT                   114166..114372,114772..114891,115294..115383,
FT                   115537..115677,115843..115950,116044..116130,
FT                   116281..116589,116684..116809)
FT                   /gene="F7J8_270"
FT                   /product="mRNA capping enzyme-like protein"
FT                   /note="similarity to mRNA capping enzyme (HCE), Homo
FT                   sapiens, EMBL:AF025654"
FT                   /note="Contains Tyrosine specific protein phosphatases
FT                   signature and profiles AA184-196"
FT                   /db_xref="GOA:Q9LFA7"
FT                   /db_xref="InterPro:IPR000340"
FT                   /db_xref="InterPro:IPR000387"
FT                   /db_xref="InterPro:IPR001339"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013846"
FT                   /db_xref="InterPro:IPR016130"
FT                   /db_xref="InterPro:IPR017074"
FT                   /db_xref="InterPro:IPR029021"
FT                   /db_xref="UniProtKB/TrEMBL:Q9LFA7"
FT                   /protein_id="CAB69857.1"
FT                   /translation="MDLNASPQPEEDDEPFKRRHEDRMESAVEIARREREERKKRMRFD
FT                   RPTRVSQPAFRDQYRDTRVYDQSKLPQGWLDCPGFGLEIGCIIPSKVPLSESYNEHVPP
FT                   GKRYSFKQVMGLLQLGLVIDLTNTTRYYPTLDLKKDGIKHVKIACRGRDAVPDNVSVNT
FT                   FVNEVLQFVLNQKHAKKYVLVHCTHGHNRTGFMIVHYLMRSMPTMNVTQALKLFSDARP
FT                   PGIYKPDYIDALYTFYHEIKPESVTCPPTPEWKRSAELDLNGEAVQDDDDDDSPPDPVQ
FT                   EINQENVKMSNDDTLGDEIPHYQEEAYRQFCYKMLMMNVGGEFATFEAAILLCDMEGRW
FT                   NTLYDALNYRWGISDKVHHYTLLDGEMVIDTPTGEQGEARRRYLVYDMVAINGESVVER
FT                   TFCERWNMFVREVIGPRAAEKLRSHCYRYDLEPFAGFWLLSTVEKLLKNTIPSLSHEAD
FT                   GLIFQGWDDPYVPRTHKGLLKWKYAEMNSVDFLYEMGEEEGRGFLFLHERGKKKLMEGY
FT                   SVEFRDDSDPSSYNGKIVECAWDKDKKVWFSMRIRVDKTTPNDINTARKVIKSINDNIT
FT                   EEVLLQEIREIIRLPMYADRIRNDSQAARRR"
FT   exon            112937..113035
FT                   /number=1
FT   intron          113036..113158
FT                   /number=1
FT   exon            113159..113276
FT                   /number=2
FT   intron          113277..113349
FT                   /number=2
FT   exon            113350..113468
FT                   /number=3
FT   intron          113469..113558
FT                   /number=3
FT   exon            113559..113660
FT                   /number=4
FT   intron          113661..113746
FT                   /number=4
FT   exon            113747..113809
FT                   /number=5
FT   intron          113810..113938
FT                   /number=5
FT   exon            113939..114073
FT                   /number=6
FT   intron          114074..114165
FT                   /number=6
FT   exon            114166..114372
FT                   /number=7
FT   intron          114373..114771
FT                   /number=7
FT   exon            114772..114891
FT                   /number=8
FT   intron          114892..115293
FT                   /number=8
FT   exon            115294..115383
FT                   /number=9
FT   intron          115384..115536
FT                   /number=9
FT   exon            115537..115677
FT                   /number=10
FT   intron          115678..115842
FT                   /number=10
FT   exon            115843..115950
FT                   /number=11
FT   intron          115951..116043
FT                   /number=11
FT   exon            116044..116130
FT                   /number=12
FT   intron          116131..116280
FT                   /number=12
FT   exon            116281..116589
FT                   /number=13
FT   intron          116590..116683
FT                   /number=13
FT   exon            116684..116809
FT                   /number=14
XX
SQ   Sequence 118507 BP; 37368 A; 21815 C; 22171 G; 37153 T; 0 other;
     acagtatctc ctccatctgc tccctatttt tccacatatt ctcatcaatt ttgtgagggg        60
     gctgacggtt tgcttcgtca atcagggaag tttcccctat aaaacgacga accataaaca       120
     catttttatt agtgaatgaa ttcaaaagca gaagctataa ataaataggt ggatcggaaa       180
     ccttgtgaag ggggagattg gacggtcaat agcttaatca gagatgccat gtcagaggaa       240
     agccgagaaa cgtcgtcgga aagaggagag aaaggatatt tgtcgtagta agaagcgaga       300
     aaagcccggg tgataggcat aaggccttcc gttgacgcca ttttcagatt ctttgcgcga       360
     tctactcact cacacacaaa tccagagctc catgccaccg ccaagccaag caaattctct       420
     ctctgccggc gaagaagaag acttattgat tatgatcgac gaaaaatgtt ggacgacgac       480
     taggccgcat attcgctctt cccaaaaggc ttatacaata cccactgggc ctttattcaa       540
     gcccactggt cctttattca agcccactga gcctttattt actatcgtcg tctttgttta       600
     atgttttgtg aaattatgat gatgaatcga agagtgcaca gaaaatctgt gaatctagtt       660
     tttttttttt ttttttttgg tacaaggtta aattttatac cattttctga atctagttta       720
     tagcatcatg ttggtagaag caaaaataca gtcaaatgga gcaagaatta caatggcatg       780
     acttgggaac aaaggcacaa acgccaaatg gcttgttggg aagctggcaa ttgatgccga       840
     aacagcaagg catggtggca caagtggtgg aggagcagca tttgcactcc aagcacagct       900
     ccaatggcgt catcagcttt ctcctccata ctctatactc catccccacc tccactggcc       960
     acatttcttc tgcatttagc cccgtcccgt ctcctacaca taacacatga tcccagatga      1020
     tatcccatat tcactactat ttttaactac tgtcaaaaga aacaattttt ggtgaggact      1080
     gtcaaaagaa acaatgtgca tacacatatt caccttggcc attggtcgta accagaatcg      1140
     tcgcaagcaa acctaagaaa atcacactat gcaagctaga ctccatactt ctcccagtcg      1200
     ctctagaaag attaggcgat accaagatct gtgtggtgga taaaaagaga catggtttag      1260
     tgggtcactc caccagattc tacaagtcca atcatacaca gctaaggcaa caactatttc      1320
     caatcacatg tgtattaata gcatcatatg tctactgttc attgatatgt tatcttctct      1380
     tcgcccagta agtacaatgt gcaaccctac caaaccatta tggctggaga atgtccactt      1440
     gttagaaaac catatctgct tacacaaaaa aaattcacct tggagtgaat aagtgtcgac      1500
     tactacaagc atactgcatc agagtgcgga ttaaacaaga accacactca ttcataatca      1560
     tacaagactc tagacagatc aacacagtaa agtggcaata aacagcagca tcaacaacaa      1620
     caaaaacaac gtgcatccac gatttttagc aaccagatgt ttggctctga gagaaattac      1680
     ggaaaaggag acacagcgaa acggattata tacacttgac actaatcacc gaactctgca      1740
     tgctgcaggt ccacccggtg aataatttgg attgggtgac cggcaaattg cacctggccc      1800
     aacgttcttt gcaaacctcc ggtgcattct gtaatcaggc acccctccca ttgcaaatgc      1860
     agctccagct gtagtagttg cacaagggat cagggcatca ccagtacact gcaaaggttc      1920
     caaagtctca accacatcgc tcatcaatgg cctagctttc gggttctggc taagacaata      1980
     atacgccaag ctgcatgcct tctgagctgc cctgacagag tattggttct ccagtcttgg      2040
     gtcaattatc tgcagcagtt ttcttttatc attcagcttt ggccgagccc aatcaaccaa      2100
     gttctgctct ttgctaggtc ttgtcttatc cactgatttt cttcctgtca acatctctag      2160
     aagaacaact ccaaagctgt atacatcact tctggccgtc aagtgtccta gtgcattagt      2220
     attagagtca agttagtgtt tatttgtgta atggtctaag cacttattgt catgcaaaaa      2280
     gagagactat gtagctcgaa atgatgttgt gaaaacaagt gcatatatgt gcacggctca      2340
     acattctcaa cagccacagt cctatatgtt aactaatagc aaactactaa agcagagaga      2400
     tagaattagc tcctgcaata tcttattttc tgtatgtggc actgaattgc aggagaaata      2460
     gagacccaca ttcagttaac taaagtgatt taaacggtag gacctaaatc aataattgat      2520
     catcgctccc gtgaaaaaag acattgcagg atagctcgtc aagattgtgt atgcatctaa      2580
     gaaaataagt tgaatgggat acatctcgct atattatgca ggtcatacca gtcatcacat      2640
     attctggggc agcatagcca taagtaccca taactcgagt tgatacatgg gtttcatcac      2700
     cctggggtcc agctttagct aagccaaaat ctgaaagctt ggcggtgtag tcctgaaggt      2760
     tcatcagccc aatcaaggat atattagttg tggaaaggta ttcccaatat cttggagcaa      2820
     ctttggcaaa gcagaaagaa aagaataact gcttacggag tcaagcagta tattggaagt      2880
     cttgaaatcc ctataaataa ccggtctttc agcattgtgg aggaaagcaa ggcctttcgc      2940
     agctccaaga gcaatcatca tccttctaga ccaagatagc ggagctgtgg tttctgaaga      3000
     gagagcccat ggtgacttgg ttaaataaga gacgagtatg acaagactaa aaggcagaat      3060
     aagcttgtat atgtaggaat gaacagagac ttcaaaaaat ggagaagggt gcggggatta      3120
     cttcgaaata ggtgattctc aagactgcct cgcagcatga actcataaac aagtaatcgg      3180
     tgatcgtcct cgcagcagta accaataagc ttgacgaggt tgggatgacg gagttggccg      3240
     aggaagttga cctctgtaag ccattcacgg tgaccctgga gtccctcctt gttaaggacc      3300
     ttgacggcaa cagggagaga cttgaggccg acgcggagat tgtcatcaat gtaacccttg      3360
     tagacggtac cgaaaccacc ttctccgagt atataatctg ggcggaagct cttggtgatg      3420
     gtctcaagct caaacaaagt aaaggggatg acttgggcat acgaaatagg agtgcgagag      3480
     tcgtctcgga agcgaggagt ggatggatcg ctcagatctg agacggatcg ggagtgcttc      3540
     ttctggagct gttgggctgc gaggtgaacc aaagaggaga gagatcagga aaaaagaaac      3600
     ggcgagagac agagatagag agaaagagaa accttgagct tgaggagtga agacggcagc      3660
     ctcgtctcta gtaccgcagt tgcccattgt cagcaggtag aaggaagtgg aaaggatctc      3720
     atcctcaatt tcaaagccga gcaccaccga attcgattac ccgttttgaa aaccctaatt      3780
     gcaatgggga agacaacgaa gctctcctca ccgcaccact gagactgggg agtgctcttc      3840
     tctctgtctt tacagtttta caggcaggaa attcacagtc cactccatgt tgccggaacc      3900
     aattgggcca ttttataata tgggcctttt tagtggatac taggcccatt atatccataa      3960
     agtttataac ccaatggaac gcagcttgaa gaataaatac catcatgtgg ggatcatggc      4020
     gacaagaaga aagagtagcc gaaagagaga tgaaagggtt tgtttagggt ccctacggga      4080
     tcttggtgag atgatataga aaaggaacgg taggtaggta cttcttgcta tgttgtttgg      4140
     taagctcgtc tacttgatct ctctttcgac agcaactcaa acacgcatca taaagaatat      4200
     atagcatcaa ggaaatggcc aaggttcatc ccaagtcact agaaacgggc ggggacgcgt      4260
     ctgtgttacc agtttggaag aagttattta tagcgatggt gagattgaag atcgagagag      4320
     aaaagtttgt tagacaattt ctcatcttat ttgataaaac aatctgtaca cagtatagta      4380
     tatatacaat tggtataatg ttaaccggtc tgttgaaata aataatattc tgcataacca      4440
     attaaactgg tgaatactca aataaagttt acgtgtgata tcataatagt aagagaaaag      4500
     aaaacaaaag tagagtcctt ttgctttatt gagattattg acaatatcta attggatcac      4560
     agctcaaagt gctctttttt ttttttttgc taaaaggtta atatcatata aatgaaagat      4620
     agttttggat ttacattttg attaccataa gaaatagacc cttgccaaaa aaaggtaaaa      4680
     aacaaggaaa tataaagatg gaaaagcaga ggagtgaagc ttcaaacaag ccaaagtccc      4740
     atgagatttc tgaacttttt ccggtgccgc ctcgccgtga tgctgtttag tcaaacaaat      4800
     tacaagctcc tcgtgcagaa aaaaaaaaca tgatttgttt atccatcaac aattagacat      4860
     gtaaaattgt ggtggcatac atgtgcaaat agcaacagaa agttatatat atacttcata      4920
     atcaagtaaa gattagcatc tatgatctaa cacagattat ttttttctcg tcgtcgacat      4980
     agaaaaaaac ttaaatacag attaatattg tgtttatttt tgtcatcaca tattaccgaa      5040
     aaaattattg aagtttctaa agccgtaacg gacaaaataa caaaagtaga aaaagtgagg      5100
     aaaagataag aaacttatta ctgctgatgt cagcactaat ttgtgtatgg ggattcgtaa      5160
     cgaagagaga aacaaaacgg aagtctccta ataggcccca cctctttcaa caaataaata      5220
     tcaaccacac gattaatctt acgtcctcaa caactattaa cgtagaccgt acgattctca      5280
     cacgaaggcc tctctttctc tttctttctt cctctaataa gcggcgaaag agattctctg      5340
     caacttgttc gattccttac taaggctttc tcgatttacg ttaatctgag aagagattgg      5400
     gtttagtgaa tcttgatttc cgtggttgtg tttttcgatt ttgcttctac tccacgttct      5460
     tgttgttgtt cccttttagc tccagattat gcttttcttt ttgttttctt ctcttcgacg      5520
     atatctgcca ccaactcgag tctcagttta atgaaatgtt tgtggatttt tggtaaatag      5580
     tactaatggg tatgtttctt ttctcctcta tattcgtttt cttttccgag aacacaagta      5640
     gtgtctagtg aggcttgctt tgatttggtg aataagaaag gttaggatta gagcagctta      5700
     aatttagggt ttttcgagct tgaatgctgt ttcctctatt actttatcgg ttgtgaaact      5760
     gtacgacatt tgtttcgaaa tctttgctaa taaaggtttc atttttcatt ttttttgtca      5820
     agagttggaa ttgaattagt cttttctaca ttgtggtcaa taatatccga gtctctcgtg      5880
     atttagttta tgcataaatc tgagagtgtg tacgtaatca tagtgaaagt ttctttattt      5940
     attgctatat ttgtttaatg gagataagtt tcattgcttc ttctttgtag atcaataatg      6000
     gctacaagaa ttgagtttag agatattctg tagcagggct aaagaacatc agagatggca      6060
     gaaaaggagg gtaaagcaag tggcacagac aatgacaatc gggtgaaaac gaaacgttca      6120
     agtcatagtc gtcgaaagga atgtgtcaat aagagtttgg aacataatga tgagcttgtg      6180
     aaatatatgt ccaagttgcc aggttatctc caacgtatag agagaggtga agaaagcgtt      6240
     catcaaagta atgttttgaa tgttggagtc ttggattggg aaagtctaca gagatggaag      6300
     catggtcgag caaaaggcgg tgaaatatca ggaagaagtg agagaaaagt gtctactatt      6360
     gctactactt ctacttcagg agtagtagtt cccaatgact cggctaatag gtgtaagatt      6420
     gatgaccaag tgcatacttg ttcgaatctc ggtaaagtta aagcttcccg ggatcttcaa      6480
     tattctctag aacctcagct ggcttctagg gattcattaa ataagcagga aatagcaact      6540
     tgtagctata agtcctctgg tagagatcac aaaggagtag aaccgaggaa gagcagaaga      6600
     acgcattcaa accgggaatc cactacaggt ttatcgtcag aaatgggaaa ctctgcgggg      6660
     tcacttttcc gggataaaga gactcagaag agagcagggg agatacatgc aaaggaagca      6720
     agagaaagag ctaaagaatg tgttgagaag ttagatgggg atgagaagat cattggcgat      6780
     tcggaagctg gtcttacttc tgaaaagcag gagttcagca acatttttct ccttcgatca      6840
     agaaaacagt cccgaagcac tctttccggt gagcctcaaa tctcaaggga ggttaaccgc      6900
     tctctagact tttccgacgg aatcaatagc tctttcggat tgagatctca aattcctagt      6960
     tcctgtccac tctctttcga cttagagaga gattctgaag atatgatgtt gcctcttggt      7020
     actgatcttt ctggtaaaag aggtgggaaa aggcattcaa agacaacttc aaggatattt      7080
     gatcgagaat ttcctgaaga tgaatccaga aaggagagac acccttcacc aagcaagcga      7140
     tttagtttta gttttggtcg tctcagccga aatttcagcc tgaaagatat ttcagccggc      7200
     caacctttga gttcttctga ggataccatt atgtctggtt ctatgagatt tgatggttca      7260
     gtttgtccat ctcagtcaag taacccggag aaccagaaca ctcattgcag atctcgagtt      7320
     agccctctaa ggcggtttct tgacccttta ctgaaaccaa aagcctctga aagtgttctt      7380
     ccatcaaaag caagatcaag ttcttccaat ccaaagccaa taaccaacag caacgtacca      7440
     cttcaagatg aaaagaagca ggatgcatcg agaaccctag ctatttttca gctcacaatc      7500
     agaaatggca tccctttgtt tcaatttgtg gtcgatgata acagcagcag cagcaggagc      7560
     attctcgggg ctacaatgaa aagctcagat tcatcgttca aagatgattc tgttcagtac      7620
     tgcacattct actctgttaa tgaagtcaaa aagaaaaaaa gtggaagctg gctaatccat      7680
     ggacacagag agaaacattg cgggttcgtc tacaacataa tcggtcaaat gcagttggga      7740
     aactcaatga gcgtagatat atcagagcag aaatctttga tcacagagtc agttctgttt      7800
     gacgaatcag agcaagtaaa agggaggaag gaggttgcag ctgtagtgat caagaagaag      7860
     cctgtcgaag gaagctatac cagcttcgag gaaactagtg tgataattcc aggcggcgtt      7920
     cacagcttcc ccgagaaagg agcaccgtcg ccattgatta gccggtggag gtctggaggg      7980
     ttatgcgact gcggtggctg ggatgttgga tgtaaactac atgtcctctc caacaaaaca      8040
     gtcctccata aattcaacca aagcttcaca cttttcgatc aggtaatata aacataactt      8100
     aaccaaaacc tttttctaag attttcctgc aaacccattt catataaaaa atatgtgttt      8160
     gcttttctat tttttatgcc gtgttcttga gagtagtcgt tttacatttg caggaagtga      8220
     gtgaacaaga ctcgagtcca gctttggcga tgacagagct gaagacaggg atctataggg      8280
     tggagtttgg ttcgtttgtt tcaccgttac aagcgttttt tgtgtgtgtg acggtactaa      8340
     catgtgcttc caaggcaaag accaccggaa aatcttcttc tcctatggct ccgccgctat      8400
     ctcccgttgg tagagtctaa actcaggaca cagatagaga gtatctaatg atcgttatct      8460
     ttcttataaa ttcctaacgt tgtatgctct tgtgttgtgt ccaaaaagac ttaaatcata      8520
     agagtataca ctactattaa agttacacta tcaactctac acatatattg atttgcttag      8580
     agttgaagaa atacataaac aaaaatgttc aaaaataaca tttttatata gataaaataa      8640
     ttgtctctcg tacaaatcag ttcaagcatt gtagtgcact ggtgaccaga atttttcata      8700
     aatcaactca agaaaaatac tgaaatttta agaaacaatg atttccaaaa atgtgaaaat      8760
     tgtaaatgta ttttttttat ttaaaaatgg aaaacgaacc taaattactt ttagtaagac      8820
     aaatcaatgt tagtcgtccg agagtcatag atcgtaggat cccgagtgca ttgcggaaga      8880
     ttcgacggtg gagatggcaa gctcgtttcc ggagttggcc cgttttgaac tatgaaagca      8940
     ctcataatcc cgtatggtaa atgtgcatcc atgtgacaat ggaacagcca tacacctgca      9000
     aatatacaat ttcatattca tattaaccca tcgattaaca tatatttggc gttgatacta      9060
     gatattaaat atatatatat atatatatat atactttata aaaaaaacat gttactaacc      9120
     aggattatta gcgataaatc tgaggacaac ccatccgcct ggtggtacac caacggtatt      9180
     atgcatttgc gggttaaata gattaagctt tcttgcatca cgaataggat catagttacc      9240
     aaatccataa cctaacacat agaagttgaa accgtggagg tgcatggggt ggctctccgg      9300
     ggagattata gccgtgttct gcaaaacgat ctcgactgta gaattaaatc taattttctt      9360
     gacgctagtc tttctttccg gaaacatcat cttcatgtca ttattggtac gttgttcgaa      9420
     ttttgtgtaa tcaaatttaa gcggtggttg gttgggaaaa tcgtcggtgt agatgccact      9480
     aatgttgtaa aaataagcct cttgcataga gattctctcc gggatcataa aagtgcggtt      9540
     gttgagagaa ccagcatacc tttgacctaa cggtccaata cacttggtgc ccgctggaca      9600
     tgggtctaag ccaagcccca tggttatgaa catcttctcg tccacgtgac gagggactgg      9660
     tgtccagtgt ggtccaccaa cgaggctagt gatgtttgag gtgaacctat gagcggtgga      9720
     catgtcattc ggcacaggca tcaacggctc cgctggcgat gatgatgacg tggcaccctg      9780
     gtagacgatt aagcctctgg tgggtttgat gtcgggggtt ggtatcccaa tggcactaat      9840
     gtaagggagg gtggccatgt agtactttcc aatggcctgg tcggcggtga gaagtgcgtc      9900
     aacggtctgt cccggcgtta agatcatcac atcggtgagg tacggcgtcg agtagacagc      9960
     atctacagcg acaactgtga cgttgtgatt ggctattttg aagaagaggt gagtgttgag     10020
     tgctgcgttt acgatcctta gcaagtatgt ttttccttgt acaactttga ggttaaacat     10080
     tcctaccaaa gccaaaaata aaaataaaag ttaattctgt tttttgtaaa caatttacaa     10140
     taaaaagtaa cttttgattc aagtaaagag tgagtattac tattctcaga gcaaggatat     10200
     gaatctccgg cgaggccatt gatgaggtaa gcatcagaaa ccggagctgg ccgtaattgg     10260
     agaagtctaa catctgtgtc ccaccattgt tcttgcataa taaaaaaatt caaacaaagt     10320
     taattgataa ttatgaatcc tatatatcat aatttcttta tattgtatat atatataatt     10380
     atatttagtg gatatttatt aaaaccgaac caacttggtc ataatactcg tcagaatgtg     10440
     gcgtagatcg agaaagttgt atcaacttgt aaaagacagc tgtttgaaaa aactatattt     10500
     tttttgagat atgttgcttt tactattata ttgaatcact ataatcgaga attgtcgctg     10560
     tcacaaaatt gatttcgact ttgcaaaaaa aagagggaaa tacttacgaa aaacgatagg     10620
     aacttccttg tagggtttag gaaaagggta aggacggccg gatcggggac ggatgactag     10680
     agccccgtga agagtggcac gtagattaac gacgtgtgcg tgccataaca atgtaccttc     10740
     ttgtccagtg atatcaaatt gatatgtgaa gttgtaacct ggttgaatcg gacattgagt     10800
     tatcatattc gcaccgtcca tccatacgct cttcaactgg aaaactccat gcctatacat     10860
     atatgtgtga aattaagaaa taacttttat taacatctaa aaagtcagta attagttgat     10920
     gaaatgatat tgaaatcgac ttccattata aagaaaaaaa acaatagtaa tgagatcaat     10980
     aagttatcta attaccagtg gatggttaca ttgtaagttg agttgttaat gacattaacc     11040
     acaagagtgt cgccttctct aacgtttatc gttgggccgg gaagacttcc attagctgcc     11100
     ggtattattt gctccttgca taacggtttc accacgacgt cttggatctg ttggttagac     11160
     gtcgttatta gtattgtgtt actattaaat gttttttacc ggcaaagtta aaaactaaaa     11220
     atcggggctc atagattaga gatccatcaa atacggtatt aatttctgaa atcgaggaaa     11280
     agaaaacaca aacacacgca attcaacaac tttccgattt taagaaataa atgactagta     11340
     tataaaatgg aaattggtaa tataatatag ttcccacagt aataaaatta atagttaata     11400
     tttcgaaaat tttggttagg ttattaaaaa agggagagaa agtggtataa gagtaaatac     11460
     gtggagaaca tgttcgacaa cagctgctga ggcaatggaa gagaagagaa gaaggacgag     11520
     gaacgcttga tttgagagat aatgatgaag tcgaggcatt gttaatgtaa ggataatttg     11580
     ccccacttgt gattttgtga gagactcgta cgcgtattta tagaacgaac taatagagag     11640
     agatggcaaa actaaaatac tatattatta ttcaattatt aatttgccag aaatggcaat     11700
     ctagacacga ttgaacacgt cgttgaccaa ccaaaaaaaa aaaatagcaa acttccctca     11760
     gggattagtc attatatact gtaattttct ttagggttat gtcacatgtt aaaactagta     11820
     ttaatactac ctcaaattta tttagttttg ttttataaaa tttgcttttg tatttttaat     11880
     gcagaatttt caacaaaatt tgtaattctc tctttcaact tataaattgg aggttatcaa     11940
     aaaagaaaac tagttaattg gacaaaactt atgaattgaa caattaaact catcataagt     12000
     gtttaaatag atgatataat ataaagttaa acaccttttt tatgaaacac cccaaaaata     12060
     aggtaattcg ttgcaaaaga agctgttaga tttataatta tattgtaaca actatgtttt     12120
     tagtttatat acaaatttga ttgcactttc agtgttgtaa aaaatatact ccatctgaaa     12180
     agaggttata tatgaaaaag tactttgatc atcccttttt tgataaagga tcatcccttt     12240
     ttatataaca aaagtgtaat catttatgcc cgaacggaac caaataatca aatgtccacc     12300
     cctaatgatt gcttctaaaa tctaatttat tgtttttctg atcacgaaca aatatataac     12360
     tacaaattta atccaaattt ctttgttttc gaactaattc aaccttatat tcccgttctt     12420
     acatgaaaac atttgaagct tacatttagt aattaacatt accatattct atattttttt     12480
     aaaaaaaaat cttctcgagt cagcggcaca cataaacatt atacagctaa gtaactctgc     12540
     catgtgaatc acgagatcga tttaatttaa aaggcgaaat tgtcatgtgt accgttgtgc     12600
     gtgcttagta agactcagga cttaagagat caatataaat caggaaaact aatatactta     12660
     atgccagttg catttgatta ctgactccaa cacatcttta cccacccctt acatattaat     12720
     ttataaataa atgtaaagaa taaaaacttg attttttcat gtaaatattg atggacttgt     12780
     cattactcat tagctttatt aatcaaaaga atcagtcaat tatattgtat gacttgccag     12840
     gcgaaaacaa tggattagct aatgataaga aaataattac ttttcttttc tataacgaca     12900
     tttttcgcca cagttgcttc gattgaagat tattgggcta gatgataaag tttaacccat     12960
     taggtctaaa gcgtatttgt agcccattta tccttttttt ttattgttat gaaaaaaaaa     13020
     accttataca taaatctctg aaccgatcgt tccattaatg cattaaccac tatagaatat     13080
     aatgaaaaaa acttccatac attgaatcgc gaacaaacaa aaaaaggggt taactattac     13140
     ctacgatttt ttttttgtga acaattatta ttattattat tttttgtgaa caattattac     13200
     tacgatatat ttcgaaaata gtgttaaatt aacaataaaa ttatagcaag tatgattcat     13260
     gacctaacga cacaagtaac caacagatat tatatccgtt tgacattttt ttttttgcca     13320
     ttgttaaata tataaataat aatcttatta attttcgtat catagccagt gaaatatatg     13380
     tccaagttgg caggttatct ccgtatggat agaggtgaag agagcgttca gagtaatgtt     13440
     ttgaatgtcg gagactcgga gtcttggatt gggaacgtgt agagaaatgg aagcatggtc     13500
     gtaaataaac acaagaaata tactgaattt taagaaacaa tgatttcgaa aaatgtggat     13560
     acaatgacta cgattgatag tcaacagtaa atgtaattta ttttcttaaa cgaactttgc     13620
     tacttttagt aagacatatc aacattagtc gtccgagagt catagatcgt aggatcccga     13680
     gtgcattgcg gaagattcga cggtggagat ggcaaactcg tttcccgggt tggcccattt     13740
     tgaactatga aagccatcat aattcctaat ggtaaatgtg catccatgtg acaatggaac     13800
     agccatatac ctgcaaaaaa acaatttcat attcttatta atccatcgat taatatctaa     13860
     ttggtgtaaa tactaaacat atagaaatgt tactaaccag gattattagc gataaatctg     13920
     aggacaaccc atccacctgg tggtacacca acggtattgt gcatttgcgg gttaaataga     13980
     ttaagctttc ttgcatcacg aataggatca tagttaccaa atccataacc taacacatag     14040
     aagttgaaac cgtgaaggtg catggggtgg ctctccgggg ttagtattcc cgtgttctgc     14100
     aaaacgatct ccactgtaga attaaatcta attgtcttga cgctagtctt tctttccgga     14160
     aacatcatct ccatgtcaga attggtggga tgctgttcaa attttgtgaa atcaaattta     14220
     agcggtggtt ggtcgggaaa atcgtcagtg tagactccag taatgttgta aaaataagcc     14280
     tcttgcatag agattctctc cggaatcata aaagtgcggt tgtttagaga tccagctaac     14340
     ctttgatcta acggtccaac acacttggcg ttcgaaggac atgggtctaa gccaagcccc     14400
     atcgttatga acatcttctc gtccacgtga cgaggcaccg gcgtccagtg aggtccaccc     14460
     acgaggctag tgatgttcga ggagaaccta tgagcggtgg gtatgtcatt cgccggaggc     14520
     atccacggct ttgttggcga tgatgatgac gtagcaccct cgtagacgat taagcctctg     14580
     gtgggtttgg tgtcggggga tgccggtacc ccgatggcac taaagtaagg gatgatggcc     14640
     atgtagtacg ttccaatggg ctggtcagcg gtgagaattg cgtcaattgt ttgtcccggt     14700
     gttaagatca tcacatcggt gaggtacggc gtcgtgtaga cagcatctac agcaacaact     14760
     gtaacgttgt gattggctat tttgaagaag aggtgagtgt tgagtgctgc gtttataatc     14820
     cttagcaagt atgtttttcc ttgtacaact ttgaggttaa acattcctat cgaagcggaa     14880
     aaaaaacgaa agaaattatg tttttttttg taaacaattg tgttgtgtca attaatatgg     14940
     aagtcgatca tttacaaaaa taatttaagt gaagagtgcg ttttactatt cttagagcaa     15000
     ggatatgaat ctccggcgag gccattgatg aggtaagcat cagaaaccgg agctggccgt     15060
     agttcgagaa gtctaacatc tgtgtcccac cattgttctt gcatgatcaa tatttaagaa     15120
     aacaaattaa ttaacaattt gaatactatc ataatatata catatttggt ggatgtttat     15180
     atattaaaac caagccaact tgtaatactc gtcacaatgt ggcgtagaat cgagaaagtc     15240
     gtatcaactt gtaaaagaca gcttttgaaa aaacaatata tttgaacaaa tattgaataa     15300
     ctataatatt tagaatttaa actatagtcg agaatcgtcg ctgtcccaaa actgatttcg     15360
     tcttaaaaga gaagagaaat gcttacgaaa aatgagagga acttccttgt atggtttagg     15420
     gaaagggtaa ggacggccgg atcggggacg gataattaga gccccgtgaa tagtggcacg     15480
     tagattaacg acgtgtgcat gccacaacaa tgtaccttct tgtccggtga tatcaaattg     15540
     atacgtgaaa ttgttacttg gttgaatcgg acattgagtt atcatattcg caccgtccat     15600
     ccatacgctc ttcagctgaa aaactccatg cctaaaatat atatgtgtga aatcaagaaa     15660
     taacttttat taacaccaaa aaaaaaaaat tccctaagaa gttaattact tgatgaaata     15720
     atattgatat atataaaatg atttctagat gatcaataag ttacttttaa ttaccagtgg     15780
     atggttacat tgtaagttga cttgttaatg acatgaacga caagggtgtc gccttctcta     15840
     acgtttatcg ttggaccggg aagacttcca ttaactatcg gtatcatttg ctccttgcac     15900
     aacggtgtca ccacgacgtc tttaacctgt ttcttagacg tcgttattag tattatataa     15960
     aatagttttt tggcaattaa ttttttagtg gtaataaaag ttaaaaatta aaaaaaatag     16020
     tattttgttt aatataggtt ccactgtaag aaaagtaatc ggtaactttt taaaatttta     16080
     tttatagttt atagagcaaa gaaaagaaaa ggagaaataa gagtaaatac gtggagaaca     16140
     tgttcgacaa tagctgctga ggcaatggaa gagaagagaa gaaggacgag gaaggcttga     16200
     tttgacagag aatgatgaac tcgaggcatt gttgatgtca ggatatgata atttcctcta     16260
     cttgttgatt tcgtcagaga ctcgtacgcg tatttgtaga gatgtggcaa agttttgatg     16320
     aagtttgcaa aacttttata ttataataaa aatattaaat tattaatcag ccagatatgg     16380
     caatctcaaa cgcgtttgca cacgttgaca aaaaaaatat cttttttctg tcaattgaaa     16440
     tattaaatga attgtgttga gatgtcgtta acctctacaa cacctcaagt tttatgcttt     16500
     gtgattaaca ccaactcttt ttaataaaac agagaaaaga acagagactt taagataaga     16560
     gagaaatgtg agaagggaag agagaacaca taacatttgt taccccagtt cacatcaata     16620
     gatactatgt ctgggccaag tcacagctgg ggatccatta gaataagtaa gttacaagac     16680
     ataatccctc agagaaagag tctcacactt gagatctctt ctccgtatcc cctctgttac     16740
     actctcaaga gaaacataaa agtttacact ttttagtggc tatttctttc tctagcttac     16800
     tttctacatt gtatctctct cttttttact cccctcttag ctgcgctcac aacatagctc     16860
     tagggcttct ccaaaacgct ccagttttaa tttgaattca catcgagaca aattgtcttt     16920
     ctttggccag tttcttgtgc ttccaaaaga tgtttaactt aacaagagat gaattacatt     16980
     taactctagt taacatctct tgtttacttg aacataaggt tctcatcttt acaaattgga     17040
     tcgtaaagaa aagttattta caaatgcaac cataatttca agcaagaacc ttgaaccata     17100
     tcgttggagg agagctgcaa gtttcggtat agtaaaaata acccgattac gtacggactg     17160
     tcttggtgtc aatggtacag actagatgac tagaatcatt ttggtgtctc ggtctcctat     17220
     tgttgttttg aatataatgc taatctagtg agtataaagg taataatgtc gaatttgctg     17280
     aagccccaag taaatcgcca ctaacctcca accagaccgt gtatacatac ataagagcat     17340
     gtaaagaaca tataatcacg atcgagtttc gtcaggttca ccatataata aacaaggttg     17400
     aaattgaata caaccccaac cacgtattct agcaaacttt cctattggat tataaaatat     17460
     ctgatgttcc tcttttagtc tcctatttta gattctattt atgttgcttg gcaaagtcgt     17520
     aaagtcgaga tctcgtatta caatgtcaat atatattttt ctttattatg tcacatgtta     17580
     aaactagtat tagtactact acctccattt tatgcattgt atgactttat tttttgtttt     17640
     gtgaaaaaca tactttttgt aatttaatac ggaattttca aaaattataa tactctttca     17700
     attataaata ggaaaatatt aaacaagaat aaaattattt tatattccag ctgtttagcc     17760
     catttaggtc caaaaacgta cttctaggct tatagcccat ttactctctt tttttaagaa     17820
     agaaaaaatc atatatattc ccgaaacgag cgtcccatta actaattaac cacactaaat     17880
     caataataat actagaaagt agaaactata gcatttggtt aaagctttta cgaaagcatg     17940
     attcatgacc aaacgacaca agtaactaaa atttctccgg tttgacatct tttgccattg     18000
     ttaaaatata gtatagcatt aaattatttt attaaattta cataccatta taaaagatgc     18060
     taataaatat ttgataattt gaattttgtt tcataaaaaa aaaaaaaaag gaaattttga     18120
     aggcgcgggg gactgagcat tatatcgccg gcgataatgg gatgcatttg cttcaagtct     18180
     tggcgccgat catcttcttc accgtcgatt acgtcaacgg tcatagatga tctcgaaaac     18240
     gtcagagagt acgatgccga cgacgacgga ggacattatc cgttgatttt ccgtgagttc     18300
     agtttagaac agctgagaat cgccaccgac ggtttctccg ccggaaacat cgtatcggag     18360
     cacaacgatt cggtaccaaa catcgtctac aaaggaaaac tcggcgatgg tcgtcgcatc     18420
     gccgtcaaac ggtttcaaag actttcttgg cctgatcctt tcgaattcat cgttagtctt     18480
     ttttgatctt tataatgttt ttggttttgc taacaagttt ttgatatcta tcaatggtgg     18540
     accttttttc agaatgaagc acaagctgtt gggagattga ggagtgaaca tatggcgaat     18600
     ttgatcggtt gttgttgtga tgacaacgag agattacttg ttgctgagta tatgcctaat     18660
     ggaacattag caaaacatct ttttcactgt aaaatatctc tttgtccttt tttctcttat     18720
     tgatgattga tgatatcttt tggtttgatg attaagagtt taatgtgtgt ttcaggggag     18780
     aaaagaccca tgaaatggga aatgaggttg aaagttgctc tgcatactgc aagagctttg     18840
     gagtattgta atgataaagg aattgattta taccatgatc ttaatcctta caggattatg     18900
     tttgataagg taatgaaagc taaactctgt tttgatttgt gtgtttctct taatttttag     18960
     caaatcttta ttaatcttca agttgttgaa tgatagacag ggattcctaa gctttcttgc     19020
     tttggtctca tgaagaatag ccatgaaggg aagatttata gcaccaactt agcttttgct     19080
     cctcccgagt atttgcgcct tggtactgtg atagcggaga gcgtcacatt tagctttgga     19140
     accttgttat tggatcttat gagcggcaga catattcctc caaaccatgt aacaatagtg     19200
     gcaaattttt agttgcattt tggactgatt cttagctttt ttatatgtac atgttaatga     19260
     gatattttgt gcaggcactt gatttgttcc gtggcaaaaa ctatttggtg ctaatggatt     19320
     cagctcttga tggtcagttc tctgatgaag acaggacaga actaatacac gtagcttctc     19380
     gatgtttcaa gactgaacca gaagagaggc caagtataaa gtttcttaag gcgactcttt     19440
     ctagacttca gaaacgggcc aagttgtgcc ctattaatgt caaaagacct atgtctgtac     19500
     gtgtcactct ctccatatat tcaagaatca agaatagtct ctcttgaaac tacacaaatt     19560
     tgaattaatg gtaccaataa atcatattat ttgacagcct ccatcaaaaa atctgcctga     19620
     aaagactaaa cctgcaacag agtcattgaa gttgactcct ttcggagatg catgttctag     19680
     agcggatcta agtagtatac atgaactact agagaaacta gggtatgaag aagataatgg     19740
     ggttggtaac gaggtatatt gatgatgttt atttacttgt tatctgaatt tgagagttgg     19800
     atgttgctga ttctgataaa tgtgacagtt ttcattccaa atgtggaccg gcgaaatgca     19860
     agagaatatg gactacaaga agcatggaga tgccgcgttt cttgcgaaag attttgatac     19920
     tgccattgaa ttctacacag aggtaaagaa tgtcattgac acactctgca actctacatc     19980
     atcgagaagt ataaataaaa ggacttgatt cattctttca ttattttttg cagttcatga     20040
     ctggagctcc tacggtatca ccaacagtat tggcaagaag gtgtctttgt tacctaatga     20100
     ctgaaatgtt cagcgaggct ctaagcgatg cgatgcaagc gcaagtagct tcaccggaat     20160
     ggccaattcc tctttactta caagcggctt gtctcttcaa gctagagatg gaagctgaag     20220
     ctaaagaagc acttagacat ggttctgctc ttgaggctta ttagtctttg taaaaaaact     20280
     tattttgaga aattgtgatt acacacaaca acatgtacta ctataagcca atgtgaataa     20340
     gtgtgtaccc attcagattt tttaattcaa ttatgaatgt tctttccaat tgtttgatat     20400
     gattgcactc gtgcaaaaag ctaaaacagg aatcaaattc cacacaaagc aaaagaaata     20460
     agtttttgag aaaagaaaaa acagaggatt ttaatcttct ttctcagttt tcatttgtgt     20520
     gaaggcaagt taaagtgaaa gaaccatgag attacaaatg cacagaccat acatgttaaa     20580
     aggaaattaa ggaatctatt tcctctacat aatctccgat catcggaatc gcttgtagcc     20640
     accatcgtgg gtgtatttcc ggcctctacg tcatctacat tggtttcaac cgttgtttga     20700
     ccaatctcat tgtcaacttt aaaaaagttt tgagctatcg aacgacaaat ctcgcaagtc     20760
     ctaaaataaa agttacgatt ctttgtaaaa tctaacaaat gtttataaga ttaatgaaaa     20820
     gaatgattgg ttttagtttg cttacttatt acccttgatc ttgaaccaag tatcggcaca     20880
     ttgcttatga acataaccca aatcatcttt acaagaacat ccaagaacca ttggatctcc     20940
     acattcatga cgactactct ctaaacccaa atggcaaatc cggcaatctt tctccggaga     21000
     ccctctgatt gatccagagg ctactgattc tgtatctgtt tcgtcgtcca aatcatcagc     21060
     aatctcaaac tcgccgcaaa agctacgaac agctgagtga aaatcgtagt cgtaatcaca     21120
     agaagaacta tcttctccgc tgacgtcact tggacggtat tgacgctcgc cggaaccatt     21180
     ttctaaatca atgtgagaga tttcgtaaga tgacattatt catttgagag agaaagagtg     21240
     aagaagagac ttttctatat gagagattac aagacttttg ttacaagtaa acgtgaactc     21300
     ttggatcaag agatttaaaa aagcaaatga aaattaagga tttttaaaaa aacatctgaa     21360
     gtactaatgt ttttgttctg tctgtggacc aaagcgatga aacattatta acatacaact     21420
     ttaatttata tttgtttata gagaagaagc aaaaaaaaag aaagaaaaca ttagtacagg     21480
     ctttaagctg ataaatactc gattgttcac taatccgcac gctaagtatc atcgtgttat     21540
     ttgtgttttt aaaagaacat gtgtttcgtg ttattagcta ctgttatcta tttctgatcg     21600
     ttgatttagg tcttcgtagt aacaaatgtc aacttgttgg acggtggaga ttataacatg     21660
     cgcgtgggag gcacgtgatg gaactaagtg tcgtagtgcg gccaccacct ttggctctcg     21720
     ctttctctct ctctctcttc tcatacttct ctttcacgcc accattcact tctttcatgc     21780
     ttcttttttt tttaattcac taggaaattt ttagtaaagt atttgatcaa ttaattattc     21840
     taagaattga cagaagaaaa aaaaactgaa aatattatga aaacgaaaat caaacaaata     21900
     aaaacatact gtcttgagac ttaagaatcc tttttttttc ctcgagactt gagaatcttt     21960
     gacagatgtt attacgcagt cgtggtggtt accgttaccg tgagtgttgg tttgggtggc     22020
     gtgagtatca cacgctttct caattagctt ttgaggccca ttaataacaa aacttggtct     22080
     tatctgaggt ccaattattt atattttttg ggccattcta acccatcatc atctttgcaa     22140
     atcaatgaga ctttggattt tatgccacct aattcataca ttaccacaat tttttagata     22200
     tcaatatgca tatgtttaga tttaactatt tgaaactttg atttggaatg tattttggta     22260
     tgcatatgta cagagctaag agattgaatc cacaaaataa aaatattaat agccgaaatt     22320
     cccatacctc aaaatggaca ttactaacac acgagctggc agataaagga aattaattaa     22380
     cgtagcgacg acaagacaat gttagtacaa aagagagata aagaaagaag aaaaaaaacg     22440
     tgggaattat aactacaaac agtgcgtaga tcacattcac ggggcaaata aatcagagaa     22500
     aagatttggt gttatccacc gtcttgggat tgctgtggag gaggagacga agaaggagaa     22560
     ggaggcttag gaatataagg attgagagga gttccatgct caataggacc tggttttatc     22620
     gaagcttttg tcgtcggagt tggatccact ggaaaattgt aatcctccaa ccccactttc     22680
     atttctgtgt gtgttttcaa tatgtaatca ttaatgtata caatgaaaaa catgaaagag     22740
     agtaacaagg aggattgatt tgattaccag aagaagaagc tagtagtgag aagcttagga     22800
     ttattacaac caaaaggaag acaaagcttg acgtcttcat cttcttctct agagattgag     22860
     gaagaggagg aaacaatgaa gaaaggtttc ttaaagacag agagacaaag agagagagag     22920
     agagagagag caaattgtaa aatgatgtgt gttaatattg ggaaataagg ccatgtgggg     22980
     ttttggatct ctgtcttgaa tgtgatgttg tgggttaaaa tcgagatcat agttattgct     23040
     ctctctctat ctctgataat ctctgtacaa gagaggaaag catctcaaac agctcaaagc     23100
     tcattcattg gttacacttt aatgctctcc actattattt ttcttgtaag ccacgtgtcc     23160
     tgaattctct attttccatt agcagtgtct tctcgtcgat gtatctattt gatcaccatt     23220
     gaatcattga tagaaacgag aatgagaaaa tggaagaaaa aataacaaaa gataatgtgg     23280
     atggagtgga gagacaaata tggtgaagaa gatacagagg ttgaagcggc gccttttcta     23340
     taaatactag atagtatgtg gttgttgact atttatttct tgggctttta atgttttttt     23400
     tttaattttt taccttatgt ttttgaatta cgcaataaat agtgtgtaag agaagagtag     23460
     taaattagta gtagtataat taaccgtcta attgagtttc atagcagtca cgtatgaact     23520
     ggtagtaaca gaaacgatat agtaaacaca caataatgta ttgatgttat tgcaaaaaca     23580
     aaagttagtt agttccaatt tttaattatt ttcccccatt taaataatta aatgccaacg     23640
     aaaaatatag catttattaa tgtgcttttt tgtctttaga tcgatctcta agcgatattg     23700
     ttgtcttcaa atactaaaca ccattaggct taatgtaagt tttgttgcct tagattttct     23760
     ttttttttat cagtttagta gtttttactt attcgtattt gttaagaatt gtcacatcca     23820
     tacttccaga tgattttgat cttcattttg ttttcgtgtt ttgtggactt aatttggggg     23880
     tttatgatga gtatgtgtag gtatcttttt tttttttttt ttttttgtca aaacacaact     23940
     ttcattcatt aaggcctcaa gagaggaaag ttgatacaag ctacgataat acaacagaaa     24000
     gaaagataca agttccatga gttttccaaa gggatgttca cttttaaaaa gtttgcaatg     24060
     gttgaaaaat ctgttgaaac tatagcggat tcgaccatga agacgagctt cgcgaaatcc     24120
     tcgaccaacg ggtggtcata gacggctcga gcaaacaatg catacaagct tttagaaaca     24180
     aactccaaag aggaggctgt tggataaaaa agattgagaa tactacggta accacttttc     24240
     catggaaatg cggttataat gccgttcttc ttcaagcttt taaaaatttg agaactatcc     24300
     ttgaacttga tgatttgcac atgaacgagc tcgataatca aaggaagcgg ggatgaagag     24360
     ttgaaaaagc tacggtaatc accgctctgt ggagacggga tcatagtgcc gttcttcttc     24420
     actcttttgg ttttatgaaa aatctctcta ggtgcttcga aaggcagggt tctcgagata     24480
     taattgtacc aacaaagcaa cattgaccga atatgttcca attgttgtcc atgaaaaact     24540
     ggtttcaaat atcgacacca acgttggcta ataatggaca aataagattt ttgatcaaac     24600
     ctggattttt gcagaaattg attaggatca cacctattgg agttgggctt caaacacctt     24660
     aaaggcccaa ataaatgaat ttgccaagac aaggaacttg atgggccgaa ctggaatagg     24720
     cccaaaatcg aaaaccctag ttttcttttg gcgtgggcga tgagactttg agtgtggcgg     24780
     ctagacgacg gcgagcagaa gatcggagtt gaaagagtta tcgccgaggg atgtggcact     24840
     ggaggagata aaggcgagag acaacggtac caattggttt gatggattag ggttgatcca     24900
     ttcgtcgaca acttcgtcac tgggaccaac gattctaaaa cccaatgaga acgttggtcg     24960
     atgagggtag cggagcagct aggcttcatg gatctaggcg caggtgacag gttaagctcg     25020
     agatcaacca ttttcgcaga tttagcttca agcatctcgc caatagcaca acgggatagg     25080
     tttcatcaag agtatccagc agattagagg accaaatggg agaagaggtt ctgggcagcc     25140
     tgaaaagtgg atctctgacc accaaaaccg aaagcaaaaa ggaagcgctg tggtggtcgg     25200
     gagagtgaca aaaggggaca aagagtttgc gagatgcgga actgagacaa gagaattgga     25260
     ggagcttaag tacatcccga cgccggcgag caaaagctcc accggcgtcg gaaaatagat     25320
     tcatgaggat gtcttcgatt ttcgtgcttg ggagagttca cgggttttta cgtttgagtt     25380
     attcgtttat atgtgtaggt atcttgttac ttgtttttgt tttgctgttt gcattagggg     25440
     gctatatcta ttttccaatt tgtcgctacg ttttgtaacc tacacataca tctaatacac     25500
     acacaatata accctataca tacatctaca cgtcattcat gatctcttcc ataccttata     25560
     catacatcta tacacacata ataaccttat acacacatga taaccctata catacatcta     25620
     cgcatcattc ataccctcta tctatatacg tagtaatcta gtctcttgca ccagtttagc     25680
     aagagatgga aattctagac taagacacgt acttactata cataaacgaa tcaacgttct     25740
     ctcgttccac cgccatcttc caaatggaac gaatttcaat ttccgtgaca atccattttc     25800
     ctcctttttt ctccagcctc tacaacacaa acaaaaaaca aaacatttca gatatcagtt     25860
     tgataaattt tttccaatta aaactaacaa ttgttctact atcataacat aaatgttttc     25920
     ttaggcataa atagaggaca ttatatatca aaccaatttg tttacttttc tactccatct     25980
     taacacatcg catacaacat ttatgaagac aacaacattt caagccctca tcttatgaac     26040
     actttttttt aacacactta tataagagca gtatctaaaa gactaaaaca tggtcatggt     26100
     tccaaaaact atactattaa ttaagccaaa caccatagct aaacagaaaa aaaaaatgat     26160
     ggaaccagag tcttaccttc tacgatgatg atgcctttat gtttgtctct gagaaagtga     26220
     gagaactaaa aagagttttg agttggatat tcaagtggaa taacatatta agaaacaaaa     26280
     agcagagttt tagacatgtg aaagaaaagg aaaaaatgaa tggaaagaat tttgaacttt     26340
     gaacgaagat gtaaggggtc atgatccaca ttttttaatt tagaaacaaa attcaaattc     26400
     atattcataa cggtaagaaa atcttaattg tttctaaaca cgttcatatt ttctttcggc     26460
     gcccaacgtt cggttgtcaa attggcagca ttatggactt acaatttcga tagatactca     26520
     ttaatatata gttatacttg atggacccga attggccgca gtatgggctt ttatcgtatc     26580
     tatcaaaatt gtaagcccgt agcatcattc ctgaacaatt cgaactgaag cccgtagctt     26640
     caaagtcaaa cttaaattca aaaattaatc ctacagaaca tcttaaaagt tcaaactata     26700
     ctatttcaat taaaaaaaat ctggtagaat tgaactgaaa tcaatcgaag tgttaaatta     26760
     agaatctttt gggagaacta aaagtttatg ttgttgtttt tgtgtggtcg gtatagattt     26820
     tatggattag attatttgtg gaagacataa tgtaacaaga gtcgggacag agcattaatg     26880
     gtccatggtt taaaaacatt aaattgaacg cacaaagtgt cagcgagtac ttttgtcagt     26940
     ctttgaaata aatgcacccc caaatttatt tctatttatc tttgagtatt gattgagtct     27000
     ctcgtttttt atccttatat attttcattt gcccaaacca agcatttaat tatattcgcc     27060
     ggtttgtttt gccacatttc acacgtaacc attaccaaga gtgagaaact acagtatttc     27120
     atttacacta catgcatctc tcgtaaacat cctttatatg aactctcata aagtttgtaa     27180
     cccaaacaaa aatgatctct cataaagtta aaatttaaaa tctcgttaaa attcataaca     27240
     atagattgtg cttatttaat tatgtttgga cgatactaaa actcttacca gtgatcatga     27300
     aacattgatt tccttccttc ctccactcac attattgggc ttatttaatt attaggctgc     27360
     atgtgacgat atatggatat acttttaaat aaaccatggt tcaatatttt taccattaaa     27420
     atatcgaaaa tctagaattg tttcctgagc caactcactg taaacttgat ttctaataag     27480
     ataaaataag atgctgccaa aggagaaggt tcttagagta gaggtcactc tctttcaacc     27540
     ttacaaaatt cgaatgtttt ttcaactatg agtcctatgg gttttgatca tttttactga     27600
     acaaaataaa tacataaagt tttactataa atacagaagc tctgcctaat gcgagcattt     27660
     tttaacttca ccggacatgc cacgagcatg ttatgggcat ttgcacttca ttttatcttt     27720
     gaactttttt ttagcatttt aagaatagct agtaaaaaca taatcaatgg tagtccacta     27780
     attaacccat taattagaga gatacgagag atccttttta gattccatct tcttccttcc     27840
     tcttcttttc gccaaacaat tccaccttta ttatcttaaa ccccacattt cctatttcct     27900
     ttttgtttat agacaataaa tatgatttct tcttgcacta tattaaaaaa caattatgac     27960
     ctaatctaat tatgaaaaat aatcaacaac accttaaaaa ctttccactt aaaaaacatt     28020
     catgcatgat ttttttctag ttatcaaaga ttagtaaaat tcttcatcat tacagtatta     28080
     acaattgaat agatttttag attatcgcaa atttatagta gaaaagagtg ggggcaaaat     28140
     gtcacaatcg agaacatggg ggatacaaag gagagaagat aaaagaagtg ggtataagaa     28200
     cagaaatagc attaattgaa tttttatttc ccttactcag caaccactga gattacaaga     28260
     gtgttgtttg agagcgaatc aaggttcctc caaagaagga agatgacttt aattcttatt     28320
     taatttccct ttctcctttt gcttcaccaa aatccacaca ttcatcaatt aaaaaacaaa     28380
     ccctagattc ttgaaaactg gaactcattc acgaatccta aaaagagagc tcctttggtt     28440
     ttcttgaaac ccagattctt caagctcagc tatggcggtc ttcaaaaccc tagctttcct     28500
     attcgtttta agcatcgtga tttaccaatc agtggctgtt acagatgtaa attcatcgtt     28560
     ttcctttaat gggtttgtga aagctccaag ctttgacaat aatgttgctc tgtttggaga     28620
     ttcgaagctc gttcatggcg gtccatcgat acaattgact gactcagtga gtcgcagtga     28680
     agggcgagtt atttacaaga aacccatcag actgttccaa ggtaaagaga gaaacttttc     28740
     cggatcattc tcaactagtt tctcgttttc gatgtctgat gagattggta gtgtcttggc     28800
     ttttataatg gttccaagag gtttggatct taggttgttt ggtagaaagg gtaataatag     28860
     ttcctctggt ttagggttct tattgaaaca caaagttgtt gctgttgagt ttggtatctc     28920
     caagagaggg aatcatgtag ggatcttagt tggtcgtcct gaatctggta aagttagaaa     28980
     gttatcatct tttggtcacc atttcaatga agagaagaga ttgaattgtt ggattgatta     29040
     tgaggcaagc tcaaagagaa tagaggttcg tttgagtcta tctgctgcct taaagccggt     29100
     ggatccattc gtgtcttact ctgtagactt ggctaagcta tggaaagatg ggaagtttat     29160
     ggtgggttta acctctgcaa atggaaacac ttcaaagccg gtttatctcc attcgtggag     29220
     ctttaaactg agacatcctt cgatgaggat tcactcgcag ccgcttgatc caaacgacgt     29280
     ttccaagact gttaaggaag gggagaagac ggtggaagtt aaggggaaag gaaaatgtat     29340
     atggagaatc cttggtgcat tggttttggg ggcggtttgt ggaacattgg gagccatgtt     29400
     cgcgttatac ctttggacaa tatgcggtaa taggcagtca atggcgatag ttcccgagga     29460
     atgtgctgac gaaaaagcgg atatccttgt aacgaaagct gatgttgttg ttgaagaaga     29520
     agtcaagaag tagtagaaaa agaaaagttt ggtgtgtgtg ttttagaatg ttgtatttgt     29580
     tgtttgtaat gtaaattctt gtgtccttct ttattcttct tctgtttgtt tttttgttag     29640
     ttgcagattt ggtgagatga gttttcacat gtagaagaat catacaatat gtattaagtt     29700
     aagatcctga aatcttgatc aatgcaattg tctttttttt tttttttttt tcatttgagg     29760
     acaagtcagt ggagagacgt gagtgaattg aagtaaagag tttgttccaa aaaagaaagc     29820
     aaaggggttc tcgtgatttc tacaaaaatg catttataat tagttgccac tttcagacat     29880
     ctttctctct gtgtcttttc tctgtcttga ccgataagaa agtgaaagga gagtaacagt     29940
     ggaatgtgta ttgtctccaa tggtcccctt cctcaatcta gagatttatt gctttaacca     30000
     gagttcgaat ttactagctt tcaaagtcac tgcttgtaaa ccagtgggtt caaattacac     30060
     agctaagact ttgagtgctg aatgtgaatt gactatatac acatatatgc ataagcaatg     30120
     gttggtattt gatagctgag ttgaaaaatc ttgcttgtat ttctctaatt tcctactata     30180
     attagaatac ttaaaacgaa accctaatct acaaatgaac agaaaagaaa aaccaaaaat     30240
     gatgtgtatg tgcgtataat taatgaataa atcgttgaat tgagcccttt atctcagaga     30300
     ttgtgctcgt agacttggtc tttcaaaccg gttaaggccg gtttgttcct cagacgtatc     30360
     gcacacgcaa ccaggaagag ggttagcata aaaattctcc tctaactttg gactcatgcc     30420
     tgcctttcct ggctgcctaa gatacggtgc tcctattcta tgctgatgca tcttcttaac     30480
     ctttgacgag aaatcttccc aagatatgag tcctgcatcg agccgatcaa tcaatctcac     30540
     gaatctttgc ctgaaaaaac caccgtaaaa tgtcagttta gagtgcattg atagtgaaaa     30600
     agggtttctt ttcacgcaag aaacataaac cgtacctatc gggattaatc gtttttctaa     30660
     acccttcgaa tctccggtga ccttgaaccg ctttcgccat gtttccatca taagtataag     30720
     cgaaaatatc gctttcgagt gctaaattgt aatcaagagc agctaatctg ttctgataag     30780
     gtttaatagt cgaaagctct tcctctgtgg ccaatgtgtt gtgaaagaaa acgtttggga     30840
     actcttcgtg gaacgcagtc atactgtttt gcccgtagat ttttcctgca acaatgtaga     30900
     tattggtggt cgaaggaaac cccatcgcct tgaggaagac ggcagcttca cgcggcgtca     30960
     tagggcaatt accttcaaga cgccgttctg taccattgat cactttttct ttccagtgtg     31020
     gaatactaaa cctcatcttc tcaagatcaa tggattcttc attggataga ctgtgattgc     31080
     atccggtaaa cgccaacata tctttctcgt acctataatg aaaatttctg ttaattgatg     31140
     attctctcag caatcagcat cattcattca ttagagagat ggagtaatag gggtagcttg     31200
     taccgcaagt gaagagcgag gtagggttcg ttgttttccc taagtcttga agagagaaca     31260
     ttgctcagat tctctatatc ttcagagtaa cgaagagctt catagtttgc gcgacatcga     31320
     agccgctgga tggaaggagg cggactgttg ttggctagcc gagaatcagt gtgattgaat     31380
     acaatcacct tatgcttctt aagtaacttg gagattgagt ttctgtaata actcgactgc     31440
     acgcaaacaa ataaaccaat acagagttag ataaaatcgt tgaataaccg aaagagaaaa     31500
     cagagaagta aacaaaaatt gcaaatggaa atgtttacct tagaccagga cacaggattc     31560
     ttttcaagag gcttaatcga agcaaattct tgcggtaaat actcgacaat attgacatct     31620
     tctgctagta cttttatgaa atgtttccag tcgaaaatgt ccttgaacga gctgaaaagg     31680
     gagcttaatt aaattatgat gatgatgatg gtgaattgat tgatgatgat ggttagtacg     31740
     taccttggat cactccagaa agatgaatgg tcaagaaacg gaagaacaag agttgcgttc     31800
     atgattttag cgattgccac catatcacat atctgtgaag aagaaatgaa gtgaggattc     31860
     gagaaaatct cttatactgg aagtggaaac atagagaaga agaagaggct tacaccagtt     31920
     ctcatctgat tcaaaccacc attggcgtga acaagaaggt aaccattggt ttgcttgatt     31980
     ggtcctgagc aaagaaggaa aaaaaaacaa ttaattaggt ctgaaatttc ttggtttctc     32040
     ggaaatgaag agaagaattg aggaaaactt actttggttc ttaggacgag ctacacattt     32100
     ctgatagttc ccaacctccg gttgattcca aatctctggg atctgttgga aacatgtgac     32160
     aaaagcaaaa ttagtccaca agaacaacaa tttgctaacg aataaaaaag cccaatgggc     32220
     caacaaacaa attagtgttt acaagctgtt ctgattgtgg ttaggctaag aataaatatt     32280
     ggattagttg taattaaata aatgaagtca accgctagaa aattcagtgg cgaatggagc     32340
     agagatccac tcatgacttt gtatttacaa atataaaatc aattatatat tttctaacga     32400
     acttgagaaa attcctttca cgaacactaa tccactaata tgaaaaatac gaaataaaaa     32460
     aatatatcac ttttttgtta cttttgataa gattcagctc cgaatttttt gtcgacatga     32520
     acagaatcta aacatggttc ttcggttttg tttgaaagaa gaagaaaaaa acaactcttg     32580
     ttgactctgt tcttgagaaa ttttttactt accgatgtag tttttggaac gaggacttga     32640
     aaggaattgg atgattcatc ttctctaatg attttctcaa tcgttggtct gggatgaatt     32700
     gaaacaacga attcatgttt ctcaacgtgt tttctccgtc ttccaacgcc gccggagaga     32760
     gcaacgatga ggaaaaaagt gacgacgagg atactcaata acgttagaat aaaacggcca     32820
     agattggtcg tggatctcat gttacgagca atcccagccg tccatttaga tttgttctca     32880
     accattagca tccacacgag cctgaatttt cggagagaga ggaacccgac gaggtaattg     32940
     tggtgggagc cacttggaca acacgataat gatcctcctc ctcctcctcc gccgcagcag     33000
     ctcgtagcgg tttcttcctc gtcggggacg taaacgactg cgtttcctcc tccgacggtg     33060
     ttgacgtggg aatgatcttc ttgagaatca gccacgcgcc gtcttgttgt tgttgttggc     33120
     gccgccggta gttggctgct gcttgacgga ttcactggaa cgccgactga catgtgaccg     33180
     ccggggaaaa cagaggattc tttttgaatg aaaaaatatg atcagaggag atatttagga     33240
     atcaacgaag aatctccatt gttgaaactt ggttttgttc ttcttctttt ctttatataa     33300
     ctcagcgtga tctcaggacg agcagacaaa aacaatctct cttataattc tttttttcct     33360
     ctctctttcc ttcgccaatt atatatttag gacgaatatt tactcttata tatgtggggg     33420
     ctatatataa agctaagaag tcggtttcat ttgatgttaa aaaataaaaa gtcgtttttg     33480
     ttttgtcgaa aatataagtc gttttattga cgaaaacaaa agtcgtgtta tgctactttg     33540
     ctttgtaatt tttttttttt ttgtatgcca ctttgttatt tgagtttttc ttaaattcac     33600
     atgtaaaata ttcgctgtta aacattggta ctgtacaaat acgaattttg cttctcagaa     33660
     attatcagtc tcgatttttt cccgaggttt ttttttaagt aataaaagtc ccgaaagtat     33720
     agtttttttt tggttgatag cgtctcaaga catagtcgat aattactgat ttcttatttt     33780
     aaataaatgt catatatatt ttaacggtat tggattggtt aatattcact gcatttgcct     33840
     aactagtaac tactagacac gtagaattta gaaagcaata gatttgcata ttaatgattt     33900
     tgttattttt aaattccata tttcgtataa ctgtttcaga tttggtttta ttatttgaaa     33960
     gaaattgtat gtattagtca attgtttgca cgtcacaaag ataagtgtcg ttagttttat     34020
     caaaatttat ctcttttttt tttttgtcga aatcaaaatt tatctcttta ctgaaccttt     34080
     taccaacatt tttttttttt tttacatttg atatttaact tattcaacta acaaacagtt     34140
     ttcatttaaa ctgacatctc tgttattgat acttgataga tatctaagat tcagtgaaat     34200
     ataattattg cgataaccta aataagatcc ttacataatt tacattaata ttctgtacta     34260
     taactatata aataaattac tatttccata tgaccaaatc ataacgacat aactattttt     34320
     attcttttgt tgggtttagt gatatattaa acctattgaa aattttatac agtatctaat     34380
     aattgaatag cagtagttgt gatgtggttt gctatttaaa aagaaatgta attctagcag     34440
     cgctcatcag tacgtagtta taaacagagg gttattctga agtattcaaa gtccttccaa     34500
     attaagtatg gattttaatg catcagattg agatatgtat gtcaactttc cttttttaga     34560
     tttaagtgtt ttaaccaacc aatacttact agactagttt acgtagagac tgaccaattc     34620
     cattaataat actagcttat acataaaaat agcaagtgtg tttatcatgc aatcaatttt     34680
     ccttatttct caatgttata gaatcctaaa aagaaggcag tttaaataaa ctcagtagct     34740
     actagcaatt taattctatt actttattca acaattagtt agcccgtcac attactgatc     34800
     acgcaattat cttttccttt ctaagaacaa agtataaaaa tgaaatcact atacgctaga     34860
     gattacgtgt agctaataca tatatttttt tcttagggtt tcctttcgtt tacaaatcat     34920
     acggttccat ttcatatata gtgacatttt gtgaaggatt gattaagctc tacatttata     34980
     aataataatt cgttgtcata taaacataat cgattgaact ggggcagaaa tatgggtaag     35040
     aagaaactta taataaagcc agaaaaataa aatagcaagg ataatttgaa acaatataac     35100
     aacaaaaagc tattcttggt ataaataaaa aaagtgaaac aatataacaa caatatttac     35160
     aataataaca atgatggcct ttatgtaagt ttggagtatt aaaagtggaa aggcctttat     35220
     gataaattcg aacgttgctc gatagttttg tcctattcct acgtcctttt catttagatc     35280
     ttgattaata cgataaccat accgaataaa attcaagtac tatacaaaaa ctaaatgcat     35340
     taatatacag ttacttgcgt ttcttaccaa gtgagtgaat gagtgttgtt gttgtttttt     35400
     aaagagatca taagatcctt tttttgtata cccacaacta tatatgtgcg aactaaatac     35460
     gggacgtggc agttccaaga ttctcgataa caaatagaca cgtctcaaga agacttgttt     35520
     acatgtttaa aaaatacttt aacccacttc ttagtttggt aaccgttaga gttccaccaa     35580
     agttaataaa aataattatt atgaaccttt tgagttggtc agtcacagtt tatttttgtt     35640
     ttattcctat tctttacttt tgagatcgaa ttttagttct attgttaaaa taaaataaaa     35700
     aataattgct taatccggta taatcattgt acataactta taagcttacc gataaataaa     35760
     ccacaaatta atgcgttctt atagctgaat tgtttttaga gctagaaata attgatatag     35820
     atagaatttc gaactcactg atttgatacc tgacctatag gctatagcca agtgatagta     35880
     atcaaagaaa aacgttgtgt ataggaaact aatttaaaga tacttatatt accgtgtgaa     35940
     acttatgaat ttaagatggt aacataccta agaaaatgga ctctaaatta agcgccaata     36000
     attttttttg ttagtaacta ttaaacatat atactgtagt tagtggaaga atccacagtc     36060
     taacattgtg ttctggtctt aagagtcaag accatataac actccgaacc gcgattttcc     36120
     acgttctctc aaccaattct attgtctcat aaaccaaacg aaattacgtt ttaacattta     36180
     aaacaacaga agaggaagtg gagctcgaac tccggtgacg tcaaaagctc aaaatggaca     36240
     agaatcacta gaaacctttg gacttttggt cgacattata acacgctttt aaaaatggac     36300
     tcggagactc aaaattgacg acccattctc tagaagcaat atcgggacac acgcaaaaat     36360
     ggagtatatg tcaacgtgta caataatatt atatattgcg aatcatagaa agaggttgcg     36420
     agtggggggc cacgcgccat taggtgaaag ttccaccgtg gaagtctcaa gtctctccac     36480
     tttgtttact ttgaagggga agtcaaaatc tctcacctac acctgaaaat gaaaactaaa     36540
     ggttcgtagt tgggatggtt gttgttagcc agggttgcca aattcaatat atcccataat     36600
     tccgattctt cattcgttat caatgtttcg tgtatctcat acgaggaaaa atgcatagta     36660
     acaatagata tatagatttg ttgatatttg tatatccgaa aaatcttatc gagtaaaaaa     36720
     ttaattcaaa agattaaatg aaatctaagt ttcatatacg gatgttggtc gttggaattg     36780
     gataaacctt ttttcttttc ttttttcttt ttgtcaagag gaattggata aacctataat     36840
     ataataactc tcatatacat ttgataatat tattgttata aaataaaatc cttgaaagaa     36900
     tagacgaaat atcaaaagta tttgttaaga aaatattata tatgattggt acgtagaata     36960
     ttgttttgtc tgctatataa tacacaactc gcgtatgata agaacaaacg cgtacggagg     37020
     ttttgttctc cgcccccacc gtcatcaccg acacgtcctt ttagcagcta cccttttttt     37080
     ttctccaatt tacttttcaa ttgatttaaa aaccattatt tcttggttat gttgtactaa     37140
     atggaaaata gcttgtgctt agaatttaca catacaaacc ataatatgta ctactgtttc     37200
     aactttcata tattttactt atgaatactg atacatataa tttgactaaa tacaacaaaa     37260
     tttggtaatt tcagaagaat taaaacgtat gcgtataaat gttgaaggac taaatggtag     37320
     attacaagaa actgaggtct aatatgaaat gttctcaagt acggggacca ttttgctatt     37380
     cgataaagtc aagttccttg agcttctgta gtgagtagtg acacacatct ttggtccttt     37440
     gaccaaaaaa caccaatatc aactcaatct aggatatcag cttgaagcta tcacaagtag     37500
     aatttgagca agaatccaaa atatactgat tcagaattta tcatcaggag agaatcctct     37560
     ttgcagcatc tcatcgtgaa tccgaaatgc ctcggttaag ttatcttgag aaacaaatcc     37620
     attgatcata caagtatacg ttgacctatc gggattgaca cctctctcga tcatcttcct     37680
     tagcacaacc tcggcttctt tcatctgatt ttgtctacaa aacccatgta agatcgaatt     37740
     atatgtaaat acatcaggta ctaatcctcc ttgctcctcc tccatcttct ttaccaaacc     37800
     aaaagctttg ctcatgtttt cttctctaac aaaaccatat attaatgtgt tgtaactgat     37860
     gcaatccggc acaaaacctt ccgagatcat cttctctaaa aagctttctc catctgaggc     37920
     attaccagaa cgacaatatc cctttatcat agagttacaa atcattaccg ttggctttat     37980
     atttttactg atcatttcat cccaaactcg aaatgcctca gccagatggc ctttactgca     38040
     caacgcgtta accaaaatgc tgtaagatat tggagtggga agtatctctt ttgataccat     38100
     atctgcccat atctcttttg ctgtatcgat atcgcctact ttaccaaacc catctaacag     38160
     agtgttgtat gtcacaacat cgagtctgat tctcttttcc ttcatctttt gaaagagctc     38220
     cattgcgttc tgcagattcc cgagcttaca atgtccatca atcagtatag ttaaagtata     38280
     agaatctgga aacaaagccc tttcagtcat ttcgttgaac aatttatccg cttcacccaa     38340
     cattttccgt ttgcataagc catgcaaaat ggtgttgtag gtaacaacat ccatagcaca     38400
     accctgctga agcatttcat ttctcaaatt catagctaca gagatcatac cttttctaca     38460
     atacccttgg ataagaatgg tatagatcac attgtcagga atcagaccag cctccttcac     38520
     actgttaaaa tacattaatg ccttatcgag atttccactc cgagtaaaaa gactcatcat     38580
     cgagctaaag caaaccaaat caggaacaac atctctagat ctcatatcac tgaaaacctt     38640
     ttccgtttca accacatctc ccttcttaca agcctccatc agcaacgatc tgtaggtagt     38700
     ggagtcagga ctcaacccgg atcttaacat ctccgcgaaa acttccttgg ctctctcata     38760
     tttcccatgc ttacacagtc catttatcac agtattataa gtataaacac caggactaaa     38820
     ccctttgccc ggcatagcat tcatcaactc aaatgcctct tccatgagac ctttactaga     38880
     gtaggcacta atcaatgtat tatatgttac aatatccgga taaacccctt tctcttgcac     38940
     ttgtgataaa aaggttccga ctttttccat tttaccatct ttgcacaaag cattaaccat     39000
     gatattgaga gtatagacat taataccaac accactccga gaaatctcct gataaacacc     39060
     ccaagccagt tcaacccacc cgatcctcac caagctcccg ataagagcgt tacacgcatc     39120
     gatagaaacc gtaaaacctt tgcttctcag caatgtaaaa gcctcatgtg cttctctaag     39180
     tttcctagcc tgaacataag tcctaatcaa caaatcaaaa accgaatcat tggaaccaca     39240
     attactaaac gtagaatcca aggaattcac aatctctagt ctagaaacac cactcctcct     39300
     aatcatccta agaagacaac tctgtgcatc tgataatctt ccactcctca cgagaatatg     39360
     aatcatagcg cttaaagaca aagacgtatg cttgaaattc ggaaaatgga aacctaattg     39420
     atccacgaat ctttgaccta aagttaaatc attgcggcag cggtataaaa cctcaacgac     39480
     ggctaaaggg tttaaccgaa tcaggtggtt tctcacatta ttgttacctt gcttcaaact     39540
     aaaacaaatc ttctccacca agaaagaatc tgaaacagaa aacgaagccg aagaagaaga     39600
     agaagaagaa gaagaagagg gttcgaatac gggagatgaa gaagttgtca agtttttgag     39660
     aggtttaaat cgagtgagag ggtcttttac gcgggaaggt attatacggt gaacaatcat     39720
     tttttgtggt tgagagagac tcaatttgat ttcgattgag aacaaaaatt gaaacttgaa     39780
     aacttttaca gtagtttggt tcatcctcca tgagtcggag ttgagagaag agctcagagc     39840
     tcagagctaa acgacgacgt tattgtgagt ctcaatgatc cggttttaat tgggctgaga     39900
     atcgaaccat gatggcccaa ttacatgttt tcagaaaaag ccttaataat aatatcgaat     39960
     agtgtaggga tgtttactgt tttgcaaaac atttatacaa aattaaatat tgcaatcata     40020
     atcctataaa atactatgtt tgatgcatgg aaaattctac aaaatctaca aatgtaagtt     40080
     atgaaaaaac cgaatctact aaagtagtgt taatggttta acggtttaaa gttaaatcat     40140
     ttctatattt aattatcgca tttaattaaa aaaagaagaa gaaaacgttg tatatagttt     40200
     cccgcttatc tcaactgttc ctcttcctcg acgttcactg tttacaaacc ctaagtcgta     40260
     tcgagattca attgcctaat tcactgtcaa gtttcaacga ctaagaagaa aaggtacaat     40320
     atttcgtagc gatttttctc gttttgttga atgttgttcg ttttcccttg tcggattttc     40380
     tccagaaatc gatcggtttt gtagtttcct ctgtctctaa cccaaaaacc cctatcttgt     40440
     tttgcgacat tagtctatct tcttctgaga tttctgttca ttgcgtattt tagcacatat     40500
     aaacagaacc cgcctttttc gttttctagg tattcatgat ctatcgattc aaagattgta     40560
     gatttatctg catgtaccct tttactctat cattgtctca aaaatggctc cttttacttt     40620
     gggtattgat ctgtatgtgt aaaacgttga cccttttact ttaactcttg tatgaaatgc     40680
     ggattttgaa tcgaaagatg tcagacgatt tcgagaattc ggtgataaac ttgaagctgc     40740
     tcatagatga agagaaaaac aaagttgtat tcgctgaggc gggtacagat tttgtcgata     40800
     tactctttag cttttcgact ttgcctatgg gaacaattgt tagattgctg gagatgcatc     40860
     acaagtcacg ctcaatagcc attggttgtt tcaacaacat ctatgcaagt gttgtgagta     40920
     tgggaatgaa gcatttcagt actcaagctt gcaagcaaat gcttttgttt cctgggagtt     40980
     tgaatcagga caaatgtcaa aatatgaagc tgaagataga tgattccgag gctaccaagt     41040
     gtttcatgtg tcctatgttt gtgcgaagcg gacaatgcag caaaggctat agcaatttta     41100
     agacctctag gtgtagctgt gggaatttca tggatgaggt gattcagttt caaggagaag     41160
     gtggccgagg aaatggttct caagctgaag tatttgtgag gggtgctcat acttcattca     41220
     taatcactga tgatttgaaa gtgcaagtta actctgttgg gtcaacgctt aatgttctta     41280
     aagatcttgc ctatgcagat tgcgataagt tggttgaaat gattcttgag gtgaatctcc     41340
     aagaggtatg tttcttcttc ttctactact gctactacta gacttttacc cttcatgttc     41400
     ttaatccagt ttcttctaaa cgttttaggt agcgactttg ctggtgtgtt tgttcacatc     41460
     ggatactcca ttgaccgata catttctgaa aaagaaaagc tcacatggta tgaacaggat     41520
     tcataaaagg ccgagtcctt ctctcagtga agatagagag gaaacaaaag ctgatcaaac     41580
     gataatgctc aatgcgtatg ttaggaagga ggaagggaac attctatatg ttgaatgtgg     41640
     tgacgacttt gttgatcttc ttttctcttt ccttgctatg cctctggaat ctgtatggga     41700
     catctcgggc agaggaatca tccttggatg cattggaaac ttgtgcaaaa gcttcaagga     41760
     tttgagtagt gcttccgcaa ctgaagcttc agcttttaaa tgtgttcttc ctcattacta     41820
     caagtgccag aagcagctgc taaatgatgt tgtcacaacc catcagccac caacttatta     41880
     ccgttttgta tcgttctctg cggatcattt tcgagagtac cgtttgtctg aaaactctgg     41940
     taagcgactt gtgtatgact gggataaact cgtgcctgtg acttcgatag atccgaaaac     42000
     cgaaggcaac aacactgctg aaacaagtgg atttgtgaag agagggacaa agttcatggt     42060
     gacagatgat ctgatcatta atccttcgaa ctcaacctca accattggat tcttaaagga     42120
     gaaacagact cgactagatg aagttgaaat tcgagtgatc aatatgacaa aagaagaggt     42180
     aatatgcttg tcaacgatcc ctgtttgata tttaaacata catattcttg ccaaactaca     42240
     tccattgatc ctatatatgc aatcgcaggc catcagatta ttgggagctt caatggtgac     42300
     atcctctgcc ttaagcactg gtctgctagc tatggaatca gcttcaacaa gtgatcctaa     42360
     atgccggttt tttaagaagc cgaagattga gacagagact tgagaagcaa tgttctaacc     42420
     gaaagttcat gttctttgct agatttgatc actagagaat cttttgctta gcatctgtag     42480
     aatctgtttc agttactgta ttagtttttt ttggacatcg actttgtcta atcttttgag     42540
     tagcaaaaaa ctgtttcagt tactatattt gttttttgaa catctactct ggctgattca     42600
     gttactagca tagctttcgg gacatggagt ttgtctaata ttttgattag catctgactg     42660
     tttcagttac tagtatgttt cttggacatc actttgtgta atcttttctt attttgaacg     42720
     atctcttttg ttcatcacat cgaaattagt caacttttgt gatcttggaa attgggttga     42780
     cccaattcat gtgaagctta atttttcgtg tatttttaaa gaaagttatt tgaataaatg     42840
     cagtgtaggg ggaagctaaa agggttgttt tttgtttatt ggctctaggg tgttgctgac     42900
     tcattttagt cagtgtcaag atttaaacca ttcttaattg gagccgctga gattaaatat     42960
     atatgactct aggtctctag cactttgcct ggttttatca gagtgtcctc accaggcttc     43020
     agttattttg ctcttttctt tagtctatct ggcctaatat ggctgaaagt tctgaagaac     43080
     caaaggtcag tctgagactc ttcattgatg aagagaaaaa caaagtcgta ttggctgagg     43140
     ctagtaaggc ttttgttgac gtgctcttca gccttctgac attgccaatg ggcaccatta     43200
     tcagattgct tgaggagcat cgagaatctc aaccaattac tgttggctgt tttagcaacc     43260
     tatatagaag tgttgccgag atgggcattg acaacttcaa aactgatgtt tgcaagcata     43320
     tattgcttca tccaaggagt gtgagggatc tacagtacaa aaggcttatg ctcaacataa     43380
     accctactga ggtcaagctc ttcaagtgtc caatttcatg caatttctac agtcatttta     43440
     gcacttctcg atgccaatgt ggaagttcga tgaacaagga gtttcaagaa ccaagagtag     43500
     tgccagttgc aagcagcata caaaatgatg ttaatggagt attcatcata actgatgact     43560
     tgaaagtggc agttaggtcc actgacgttg tcttgaatga gctcaaatcc ctaggctccg     43620
     gtgatattag taagctccgc gaaatgcttg tttatatcgg ttttgaagag gtaattcatg     43680
     ttttgtaatt ttgaagagct atatgtatgt cgtacttgaa aaacatgccc tgcttctaat     43740
     gtctaacggt taactcttaa ttttgttcta ggtactaact ttgctggaat gtatgttctc     43800
     ctcaaaagct cccttgacga acactttctt gaacaaacaa accttccaag gtcaaggtgt     43860
     gaccaaagtt tatgaaactt taagtccatg tatggagaca aatggagaca cgtttttaac     43920
     tttggatgtg atagtaagga agcaggacat ggagatttta tatgttgaat gcggagaaga     43980
     ctttgttgac ctccttttca cgtttcttgc tgttccgctg gaatatgtag tgggaatctc     44040
     tggtaacagc tgcagttttg tgtgcattag aaacttgatt agaagcttca aagatttgaa     44100
     tgctgcagaa gtctcaacct ccaaatccgc gatccaccat ttttatacat gtcagaagca     44160
     gttgctcaat atcatcactg accaacctcc gctctaccat cgctacaact attatagctt     44220
     gaaagagtgt tcgggctcga ctcctttgat tttgatagat ccagaaggta gtggctttgt     44280
     gaagagagag acgaagttta ctgtatcgga tgatttgatt gttactgcta tgaactcgag     44340
     ctcacctatt tgcttgcttc agaagtttca gattcacgca gatgacctcg aggtgcaaca     44400
     aataagtacc agcaaaacag aggtatgctt gtactaattt gtagctacac tttttttatc     44460
     aactagatat ttttaacctt tttttgtgta atcaggctac gagtttgctg agagcttcct     44520
     tggtaacatc ctctgcattg aaaacttctt taaggaactt gattttgaag aaccccgagg     44580
     aagagatttg aagaaacaga gagagattct tgcaaggtta catttttttt cctttctcaa     44640
     gtaatacact tttacttgtt ctcccttgct ttcttgaata acttttgtct ctaaatcagg     44700
     caatgagtct gatgagagct tctttgttga catcctctgc tttgaattct gctttatgga     44760
     acttgattgc gaagaagatc aaggatgaga cttaaagaaa cagagatcct taactattta     44820
     agttccacat tgttccatct tttctgtttt atctgatttt tctctggttt ctgtagacat     44880
     tgaactgaac acatgttttc cagacaaact tggaatcttt tttatttcta tgaagtgaac     44940
     ctgcattgat gaacattaac agtcctgtct tatcaaagca atggaggtgt tttgtgattg     45000
     ggattgcttg tgtgcgtgac ttttatttat tcttgatcgc tctcttgtga aaatttgatt     45060
     agattagatg aaaagtaaat ttacacgcca aaattattta gtaaagatga atagacccta     45120
     atgaaaatta gagaatccaa gataatatat ctaaagatac aataagatct ttttgtaata     45180
     ttaaccattt ccttatcttt atctctccga gatctttcac cagaatgtga atcttaaatg     45240
     taaatgcacg gtatgtgttt ttcagtttgt gagacaagga gaagctagct taaagggttg     45300
     atcgacaatg gctcagagtt ctacggaacc aaagtttagt ttgagactta tcattgatga     45360
     agagaaaaac aaggttgttt tggctgaggc tggtaaggat tttgttcaaa ttctattcag     45420
     ttttttgaca ttgccaatag gaacaatcgt cagattgctt gcaaagcatc gaaagtctga     45480
     tccagttact attggatgtc ttagaaacct ttatacaagt gttgtggaca tggaacttga     45540
     tgattttgag actgatgctt gtaagcagat gttgctttat cccaagaaca ttagggaggc     45600
     tcaatacaga aactttaagc tcaacattga cactaatgaa agcttaaagt gttttggttg     45660
     ccgatttttc tcaatctgca gaatgtgcag taatttcaac acgtccctat gtaaatgcgg     45720
     aaagctgatg aatgaggaga taagtttctt agaatatgag gaaaatgatg tcgaaggagt     45780
     atttatgaga gacaagtcgt catttatcat aaccgatgac ttgagactca cggatgattc     45840
     tactagttct ctcttgcaaa cactcaaaga tcttggttgt gctgatgtta gtaagctaag     45900
     agagcaggtt cttgatatcg gtctcaagga ggttatgact ttgatgcaat gtgttttcac     45960
     ctcaaataca cctttgacgg atgctttctt gaagaatcaa agttcaaaca cggtgaggaa     46020
     gatttataga aagctgagtg atgataaagg agatgaagca gaaccagaca aagttataac     46080
     tattgatgct atagtaagga aacaggacat gaagattttg tacgttgagt gcggtgaaga     46140
     ctttgttgat cttcttttca cttttctcgc cattccgttg gagtctatat gggaaatctc     46200
     tggtaacagt attacaatag gtcgcattgg gaacttgttc agaagcttca aagacttgag     46260
     tgataatgaa gtgttatcag catccaaatg tatgattccg tattattata ggtgccagaa     46320
     acagttgctc aaaataagaa ctcctacacc acgggtttac ttaggacact gttattccaa     46380
     gacactgtct tattctcaaa gcttttattt gactacaaaa cgtactacaa agcgcatgac     46440
     ttttgtggat ccaaaatctg attgttgtgg tcggtcaaaa gatggtaagg ggtttgtgaa     46500
     gagagggaca aagtttattg tgtcagatga tcttattgta acacctaaga tttctagctc     46560
     aacattttcc gtgttgaaga agtttcagat tctcacagat gatttggagg tgcaagcaat     46620
     taccatcagc aatgcagatg taaaaaactt gttgtataga ctaaaccctt ttcttttttt     46680
     ccaacaaaat tatgattctt tgtacttcaa tatcaggctt tgaatctgtt gggagcttca     46740
     ttggtgacat cctctgcttt gagctctgct tttgggaatt tgattgtgaa gaaaccgaag     46800
     gaagagaatg tttcatggaa cccggtttca aagaaaccaa aggttgagac ttgaagaaac     46860
     acaaagtgga gagaatcctg agctactatt gattggtcaa cccaaaattt caattgcttg     46920
     ctagaattgt taattttttt tatcatatgt tcttgacttg agttgcctac ttggtttatt     46980
     tgaaacttaa aacacatttc aagcaaaatc ataaactttt gtccccatct agttttcttc     47040
     ttgtcctctt tctcagtcaa cgtgaaaggg aagctctaag ggttgtcttt gtctgtgtct     47100
     attgggtttt gatgacccat caatattgtt cattcatggg gaagctcaaa aggtagtttt     47160
     gttgtttgtt tagagttaag taaaaagttt gtaaatttaa gtgcaggcta cagtcctggg     47220
     gaagctcaaa gggtagggtt tttgtttatg actcgttatt attgttcatt caatgtcaga     47280
     ctttagaccc tcttaaaatg agagttgatg cttcagtttc ttaacgtgtc gcttctgttt     47340
     ctgagtgttt tagaaaagtt ttctcatcta tcttgctttc gtctttcttt catctattac     47400
     gctaatggct aaaagtagtg aggagcctaa gttttctttg agacttattg ttgatgaaga     47460
     gaaaaacaag gttgttttgg ctgaagcttg tagggatttt gttgatgtac tcttcagcct     47520
     tctgacactt ccaatgggaa ccattgtcag attgcttgag aatcatcgaa aatctgagcc     47580
     agtaactctg ggctgtttta acaatctcta tagaagtgtt gtggacatgg gcagtgattg     47640
     ttttgagact gaagcttgta agcagatgct tgtgtatccg aagagtgtga aagacctcca     47700
     gtgcaaaagg cttaagctca acataaaccc tactgaggac atcaagtgtt ttaagtgctc     47760
     aagttactgc ggcttgtaca gtaatttcag cacctctaaa tgtcgttgcg gaaaatttat     47820
     gaacgaggag attcagttag aaaacgagga acaagattta ggccggtttc aagatgatga     47880
     taatggagta tttgtcagcg gtaggtgttc attcgtctta accgatgact tggaagtgtc     47940
     agtcaagtcc actgaacttg tcttgaataa gctcaaatcc ttaggttgtg ctgatgttgg     48000
     taagctcggt gaaaggcttc ttgatattgg tgtgaaagag gtatgttagt tagtttattc     48060
     ttcaagcgtt tgtgttatca ttactttatt agttctctct tactatatct gaatcttgga     48120
     ctaggtactg actctgctgg gatgtatatt ctcctcaaat gctcccttaa aggacatttt     48180
     cttgaacaag aagattacac aaggtgcgac gaagttttac aaatcgcaaa gtccatgttt     48240
     ggagaaaaaa gaagatgaag cagaacctga aaaggtagta actttgaaag catttgtgag     48300
     gaagcaggac atgaagattt tatttgttga atgcggagag gaatttgttg agcttctttt     48360
     ctcttttatt gctgtcccgc ttgaatctgc atgggaaatc tctggcagca gtatctcctt     48420
     aggttgcata ggaaacatgt gtagaacctt cagggactta aatgaggaga ctcaaatgtc     48480
     aacttccaca tgcgcacttc cgtctttcta taatttccag atgcaactgc ctggtattat     48540
     cactcaacaa cctccggtgt actaccgtta caggctctac gattacaggc aaatgaacta     48600
     tggtttgact acaaacggta atcgaactac ttattaccgc aaagacagaa tcgttcgggt     48660
     ggatttgaag gatcccaaat cccgtggcag cgataagtct gctcaggggt tcttgaagaa     48720
     agcgacaaag tgtactgtat tagatgatct gaccattaca tctatgaact cctgctccac     48780
     agtttgttta ctaaagaagt tgcagagtca cgcagacgat ctagaggtgc aagtaattag     48840
     tatcagcaat gcagaggtat gtttctgtat accctttttg atcctgtatt cttgaaagga     48900
     acttgactga cacttgattt tgaattaggc tttggatttg ttgagagctt ccttggtgac     48960
     atcctctgct ttgagcacga cattatggaa tttgattgct aagaaactga aggaggagac     49020
     tgatttatgg gacacggttt caaagaaagt gaaggaagag acttgaagaa atagaaagct     49080
     agtgagaatg aactctaagt cgattgttga ttatgttttt agaattccgc aaaatctaca     49140
     ttacattcct catgttttct tccaagcctt atctttcttt gtaagactaa tcaaattatt     49200
     gttttatgga aattcatctt aatagggttt tttaaatgca ggcaaaaact tgcacatctt     49260
     tttgagttta taaagcaaca agcctaaaat ctggaatttc ctagtacgat aagactgaaa     49320
     tatacaacca ttaccaaaaa aaatgcatcc atatacaaaa gtttataata agatccagtt     49380
     ggtatatagt aattgggaat gttgaagaca tatgaagtgt tgatcagaaa aaaataagac     49440
     ttgaagttaa ttaatggaaa ccctctttct cagccagaag acttgaaggc ttctattctc     49500
     ctccgttgcc cacaaaaaca aaatttgctt cgccgttttc ggctccggcg tgattcttga     49560
     gaagaactga agtagagaga gagatctgaa atctcaatct ccgatttaac ttggtaacta     49620
     gagaagcttt tgattcctat tctttctttt gatttgtatt tcttagggtt ccgttcatgt     49680
     aacttttaca gcgacaatgc ttcaaattcg tcttcggagg gattccccga cggaaactgg     49740
     aaatggtgcg aggccttctc cgacggagac ggttactgta gcctgtcccg accatctcgt     49800
     cctcgccgat cttcctgttg cgaaaggaat cggttccgtg actcccacca ccgtaatcaa     49860
     gcccgtcggt cgtcgttctc gccgtcagct aggcgagaga gttcacttct gcgttcgttg     49920
     cgattttccg attgcaatct atggtcgtct ggtaaaaaac ttcgcttcct tcattggttt     49980
     atggctatat tgatttgcct taaagagttt ttttaagggg gctcttcttc tatatgtgat     50040
     tgaaactttt tttgttttgt tttggttttg cagattcctt gtgatcatgc cttttgcctt     50100
     gaatgtgctc gcagtgattc catctgctat ctgtaaccat ctttaactct catcgaattt     50160
     cattagaagc tttgatagag atactttaga ttgtttggta atctacagag acgcaggatt     50220
     atcatagttt gaactaggct tcgaatttca ttagaagctt tgatagagat attctagatt     50280
     gtttagtaat ctacagagac attttaagat ttactaggcg tagcgattat cagactgaaa     50340
     tcttgttgtc tcttgtgtgt gtgattactg cacagatgtg atgagcggat tcagaagatt     50400
     caaacaatca agatgatgga agggatcttc atctgtgcag ctcctcattg tcttaggtct     50460
     ttcctgaaga aacttgactt tgaagcccat gtccatgacc tccatggaag cctattacaa     50520
     gccgatgcag agaaagaaga tggtaaccag tcagatgttc agagcacaat gcagcagtct     50580
     tcagcttcag aatccacctt gcgagctcct ttaagatccc agctgcaaca atcccgtgaa     50640
     ctaaacaggt cggcgtcatt tgcaaagtca cagtctggat ttagtcaagt ccagaattac     50700
     cctccagata gcgataactc tcgccctcct ggattcgaaa ccgctagtcc taaaccagga     50760
     atccggttcc cagactaccc ccagcctatg aatcttatgc aaccgcccag cttgcccgtt     50820
     ccaatgaatc aaaacccggg tttaccacag cagtttggtt ttccttcgta tccaacaaca     50880
     gagagtggat catctcaaca attctttaac ggtgctcagt acgagatgac aagaacagag     50940
     agcggcggat cagaacaaag ttcattgctc gggtatcccc cgccttcacc aatgacgaat     51000
     ctgaatttcc aaggatcgta tcctcctcca tcatggaatc ccggaatggc accgcctcac     51060
     acgacccagc aggttaaccg gggtagagac ggtcaaagtt ttgggtggcc acaagagaac     51120
     cgtgatggct ttgggcagga gtaagagtag tctagtttga atttgtgcaa tgttaaactc     51180
     gtcgtttgaa agtttcaagt acttttgttt ctaaaaactg tgtcgtttgt tgttggtcta     51240
     acatgtaatt cgagtaaacc caatttcaac cgagccaaaa ccgtgccaaa aattccatcg     51300
     gaaaaaccaa actgatttgg gttgaaccaa aggttttaca ccattttata ggaacaacca     51360
     tcgtagattg cacccactgt gtcactgtga taaagaaaga actaagattg atattttggt     51420
     ttttagctct ttttctttac tgttttggga ggatgatgat gatggttatt atatgagttg     51480
     agattttttc taaacaccgc cgatgatctc actaatctta ggcacagcta tgcttacaga     51540
     caatatttca cagtctcttt attgggattc cttcactcta catatgtatt cactattcag     51600
     caccaagttc aaatttctgt aagcatttat tctctagcat aaacacacac gaaaatatac     51660
     tattagctag ttaagtataa aattatcaaa taacttattc atatttgtta gttttaaact     51720
     agaaatcatg tgaattgaac tgaaccagtt attgataagt gtgtggctat gagaaatttc     51780
     gtttcaaatg gattctccaa ttatgaacca taatgataca taacaatatt tgcaagacac     51840
     cattatttca cattatgaga atagaagaaa actgagatct aagacacttt ttcccatgtt     51900
     ttctatgaat tattacgatc cccatataaa ttttcaaaat gtaaaagcta taatcattgt     51960
     cgtaattttc atgattaatc acaccaatca ttatgaccaa ccaaagagaa tgtaaatgta     52020
     ggatatagtt cattttcttt tctttttttt tttttacgac aaaataaggt cattcattta     52080
     agctaaaagc gggcggtttt cttctagaga aaaccagtcc ggagtagaaa agcttacatg     52140
     ggaaaaaata gaacctcgtg ctcttgcctt cttagcaaga caatcagcac aaacattgtt     52200
     taaacgtgga ataaaagata aaaaaaaacg aggaaagtta ggctttaaag aataaaaatt     52260
     ttttaactca gaagaaaaag cgggccactc atcaggagtg tccaaaagtt gcgtcaactc     52320
     cttgcaatta gttttttttt atcataatta gttttttttt tttgggtctg ctactttttc     52380
     tcaatataag tttatattct acacgtaatt taaagttccc ttttctaagt atatactcct     52440
     gtttaggaaa gactaaaaaa gcttatttga ttggtgaaaa tataagtaaa aagcccacat     52500
     taatggcatt gattgcgttg aggtcaattg atggaaataa tcacgtcacg taaaaagttc     52560
     tcgacataga tctttgataa ccaacaaaga caagaacgat aaataccagc gaatacaatt     52620
     atgaaaatac gcctaacacg tacgaaaatg tatgtatgca cacgcttcaa caaagatttc     52680
     atgctttgtt tggtaaaagt atacgaaaat atatatatat atatacaaag taaagatagt     52740
     gttcaagatt tttttaattt tgggtaaata ataagattga ttggaaatgt tataagaaaa     52800
     aggaaaacag gagagaatag tgaatagaga gaccaaacaa caaataagat ttgatggcgt     52860
     gaattgcttt ttctgctttt ctacttttgc ttggctctta gtttttaaat ttaaatacga     52920
     ctttagggta atggacaaag cctgaaaatt cactttttgc ttcataaaaa acaaaatttg     52980
     tcaagggtat tttatttctt tcagctgaaa ttaagacgta aatggtggtt tgcttgtttt     53040
     tgttgcaaaa cgaatagtat atcgtagcga caaccccatg caaattgcaa agtgatgcga     53100
     gtattgacaa caaaaagaag agaagcttag ccagtacaaa taaagttgtt cagaagaaaa     53160
     acaaattcgt ataagcacac gtgtagctgg atattctcag catttacatt aatcaatcaa     53220
     tatatacact tcaatctaat gtttatatta agaaattgat tgagatttga tagtttttgt     53280
     atgttttgat ggacaacaat gaaaaattgt tgtccctcta atcatttttt ttttttggct     53340
     gttcgttttt tttgtttttc tcaaagaaca gaaatatcag aatggcagag agatcgatca     53400
     acccattaac cataaaatca cagcactgtt tttattatat taaaattgtc agactcaata     53460
     tttaaccttc tttcttaaaa acaaaaaata gcgcagattt aatctgacac ctgcaaaata     53520
     tttcattaaa tattttaaat ttctttaaat aataaataac tgtttgttat ttctcttcat     53580
     ctcctttctc tttcaatgtc cgttggtaaa agacgaaagt ttcagacata acatctcttc     53640
     ccatctctct cccctctaag caattaagca gacaagacac tgatgatatg agacgaagag     53700
     aaagaagtct tatcactcat cctttcctct tatgaatctc tccgccgacc aagctcccgt     53760
     caccgccgtc gacgaactag ctccgccttc tcaaccgcat cgcttatcta catcatgtga     53820
     tctccaccca gaagagcgtt tctccggttt ctgtccttct tgtctttgcg accgcctctc     53880
     cgtcttagat cacaacgccg ctccgccacc gtcttcttct tcccggaaac ctccctctat     53940
     ctccgctgtt tcgttaaaag ctctcttcaa gccctcctct agtggtacca acaactccaa     54000
     cggaaacggt cgggtcagac ccggtttctt cccggagctc cgacgtacaa agtccttttc     54060
     cgcaaagaac aacgaaggat tttccggtgg gtttgagcca cagcgtcggt cttgtgacgt     54120
     cagacttcgt gacgacgaaa gaaaccttcc catcaatgaa gctgcctccg tcgataaaat     54180
     cgaggaggag gctagggagt ctagcgtgag tgagatagtt ttagaggtga ctgaagaagc     54240
     tgaaattgag gaggatgaag aaaacggtga gaaagatccc ggcgagatag ttgaggaaaa     54300
     aagcagcgaa attggtgagg aagaagagga attgaagcca atgaaggatt acatggatct     54360
     ctactcacaa acaaagaaac cgtcggtgaa agatttcgcc gggagtttct tttcggcggc     54420
     ctctgttttc agcaagaagc ttcagaaatg gaagcagaag cagaaggtga agaagccgag     54480
     aaacggtgtc ggcggaggac ggccacagtc tgaaatcgga gtaggccgga gatcaagcga     54540
     caccgacccg agattctctc ttgacgccgg gagattctcc gtcgatatag gtcggatttc     54600
     aatggacgat tctcgctact cattagatga gccaagagcg tcgtgggatg gacacttaat     54660
     cggcaggaca acggcggcta gggttcctct gccgccatcg atgttatcag ttgtggaaaa     54720
     tgctccgttg aatcgatcag acatgcagat tccatcgtct ccgtcaatta aaccgattag     54780
     cggtgactcc gacccgatta tcataatccc aggcggatcc aatcaaactc gagactacta     54840
     cactggacct ccgtcgtcac ggagacggaa gagcctcgac agatccaatt ctattagaaa     54900
     aattgtaacg gagctagagg atgtcaaatc ggtatcaaat tcgacaacaa caatagactc     54960
     aaattccatg gaaacagcgg agaacaaagg gaatcaaaac ggcgataaga aatcgagacg     55020
     gtggggaaaa tggagcattt tagggtttat atacagaaaa ggtaaggacg atgaagaaga     55080
     agataggtac agcagatcca acagcgccgg aatggttgag aggtctttat cggaatcatg     55140
     gccggagatg aggaatggag aaggaggagg accgaagatg aggaggagta acagcaatgt     55200
     gagctggcga agctccggtg gaggatcggc gaggaataag agttcgaggt attcgtccaa     55260
     agatggagag aacggaatgt tgaggtttta tttgactccg atgaggagaa gctggaagac     55320
     cagcggtggt agtggtggag gcggaggcgg tggtggtggt ggtgggtggg agaagacggc     55380
     ggctaaggcg aatagtcacg gccactctat agcgaggagg gttatgaggc tgtattgacc     55440
     aaagtgtccc tcttcatttt aattattggg agcaatgtga ggttttggtt tggggttctc     55500
     taattatctt tgtgaataaa ttggatatct acttaaccgg agttaatcgg accaaattgg     55560
     aaccgggtcg ttttcaaaaa cctaaactta taaacactcg gagttttgag ttatgctctc     55620
     tctcactcac tccgccgccg tccctgcttc caccacatcc tccgatttat gattggatgg     55680
     gatcatcgag ctgattcgat tgcaagaatg caagtaagaa caagagactg attgagaatt     55740
     gtaaaaaccg gaaatttggg tgatgctttg aaagtgtttg acgaaatgtc taagagagaa     55800
     gaacaacttg aggtatggaa caactgaatt agtcaaggct ggataatgac taaggtaaca     55860
     tctttatagt ctctggctag cttttgttct ctctgtttct cgtactttgc atcaaaaatc     55920
     aaaccgcatt agtatcatct tctcttaact tcaccaacta gctaagtctg agttccaggc     55980
     ctttctctgt gtctgcatta ccaagcttgc atagagattg aatctttaag tagcttaaac     56040
     aaacataaca aatggttttt gaagtgagca gcataagcac acacatcggt cttggtggtt     56100
     tgagtaaaca tcactgagat ttgttgtttt acgatgcaat agcaaatgta aaagtagctt     56160
     gacgtatcaa gcccaagtgt taagtttcaa acttgggtct attaatcaag ttatatgatc     56220
     tttgttgcta cctttttccc tttatttgct tttttcattc tctattcaaa atcagccaac     56280
     ctttgcttgt atttccattc tccactgtct ctctaatctg atcaatcctg caggttcttt     56340
     gaaagcttgc attcgagtct cagagcgttt gatcacggat tcatcactac tattctagtt     56400
     gcaatcaaag aaatggtttc actagcggaa tctcagcaca acgcttgtgt taaatacaaa     56460
     cccttgaact ctgcaaccac aaagcaataa ggatagtcga attcaaaagt agtatcttgt     56520
     aacctaaact caagcaaaga acttcaaact tgcttgttta tgaaaaataa aaataatatc     56580
     tgtaaatatg tttcagtaac gagattatca aacattgcga ctaatttcaa atcagaattc     56640
     gtgattgcag ccatcgttat gttttttgta tcatcaaagc gcatgcccgg tcgttttctt     56700
     gtaagtgtac catttagcaa tccaaaggta gaccaagaaa ttcaagaaac tcagaccagc     56760
     taatagccaa aagaagtaat caagatgacc attgttgagg ttcttagcga tccagcctgg     56820
     tcttccacct gatctcgtga ctttagtgac caatgtcacc agaaatgtgc tcagatagtt     56880
     cccaaatgca attgcggtga gcgacaaagc cgagcagaga ctcctcatag catcaggagc     56940
     ttggtcatag aagaactcaa gctgacctat aaacgtgaaa acctcggcgc aacccaccaa     57000
     aaaatactgc ggaacttgcc agaaaatcgt catcgggata gtctcttcat tgtaaagatt     57060
     gtgtgtttga acgtagttta accttgcgac ctcgaggatt cccgcagaga ccatagaaaa     57120
     gatggagatt acaagcccga ttccaatccg ttgaagctgt gtgaatccgc gttcgtgacc     57180
     tgtgtatttc cgggcgaagg gaacaattag cttgtcgtag acaggtgccc aaaacaggac     57240
     actaagcgta tcgaataagg agagtgatgc ggaagggatt ttgaagttag gtcccatgtg     57300
     ttggtccagt gtgttgcctt gtagtacaaa cacagtcccc atttggctat aaaccgaagc     57360
     gaaaacaatc cctgtggccc aaatcggtaa gagacggatc agtgctttga gctcttctac     57420
     ttgtgtcact gtgcatagct tccatgaaga cgacttagct gctcctttgt tgtcactctc     57480
     tgtttccact gctgccttat caaagaacct gaaatgattt gaagtgagcc aaaagttaac     57540
     ctaacaacac aaaattacag accggacttg cttgtgcctt acgttaatat tttggtgtgt     57600
     tcgagcttgc ggcttcctat gatactgctt tcggcgtctt ggttctcgta gagaagagat     57660
     tcatcttcag gaattttcac tttagatttt ctgcatgaag ccacaatgac ttgcagcatt     57720
     cttgtgagag gacttcctcc tggtttctgc agcctgtaga agttgcttcc ggcgaagaag     57780
     aacacgacgg ctatagccat tgcgacggtg ggaacaccta aaccccaacc ccaaccaaca     57840
     ttcatctgaa tccaaacgag aacagaggaa gcaatcattg caccaacgtt gatcacaaag     57900
     tagaaccagt taaagaaaga gctcttagac tctttctctt tttcgtctgt atcatcaaac     57960
     tgatcagcac caaaggaaga gacacaaggc ttgatccctc cagttccgag tgcgatcaag     58020
     taaagcgcta tgaatgtaat agcggtttga cccgctgttg cgtgacaggt ttctccgctg     58080
     caggttggtg ttagaccagg aaccgaagct gatatcgtca atagcgtcat tccctaaatt     58140
     acagaaacaa aaaaaaaaag agcaaacagt ttcaagattc tgtgattttc tttgttcacg     58200
     ttgagagcaa acagagcaaa gagtaaatta ttacggcaat gtagatgacg acaaaggaag     58260
     cgatggtcca gtatcgaccg agataagcat cggcgataaa agcaccgatc aaaggagtag     58320
     cgtaacatgt tccagaccag ttactgacac tcttagaagc agagacgttt tccatattca     58380
     tttgtttctc gagatagttg atgagattag tactcattcc atagtaagct aatctttcac     58440
     agcactcagt tcctgccaat tgctcataga tacaatcaaa tcaaattcag aacaaaaaaa     58500
     aacgatttgg tttttattac aacaaaagat taaaggtttg aacaatacca agaatgaatc     58560
     tgcaagcttt ccaggttcca gttttattct tgttggctgg tttcttgtga atgtcaagag     58620
     ttccatcttt tgtgtatata tccttgtcat cttccattgt tgtttggttt cgacaagttt     58680
     aagtgtgacc cctgagtttt caacaatgtg agaatttttg acctgattta ctgagaaaaa     58740
     ggacaaaaga tgacttcttt gccaagtaaa atctacacaa cgatatttct acgactaatt     58800
     atcggattta gacagataag cctccatata tatatatgtg tgactccacg aagaaacaga     58860
     attgaaaaac atcgatttat tttatgagca atagccaaag taatgtccat tacatgcatc     58920
     atgacaaaaa cataacgcgt tttctagaca caaactgaca aaatcggaag ccatacatac     58980
     atatataatt tcgtcgaaga aagctacgga tctgaaaact cgaaaacaca caatcgcaaa     59040
     tttcgtttga aaatgaaaat aaatctaaga acactcctcc cgaaaatgtg tgattactag     59100
     taacagaaat tgttcataga atcaaaaaaa agacagatca aagataacca gatttaatat     59160
     ttagaaacgg ttaatcgttg gtgaaagatt cgtttacctt ttctcgggga agcgacgaca     59220
     gagttttgtg ccgggatttg aactacacgg ctgaggaaga taaacttgag ggcttgagcg     59280
     tttcgttttg cgccgtgtga tagatattta taaggaaaca ctctgaatag tgaaggtgaa     59340
     tcaggcagtt tcgtgatttt accagttacg tcctcgcatt tattatcttt ctctttgtta     59400
     ttttgttgaa ttttgaataa ctttcttgaa tctttgagaa gatgtgggga tgctaaatcc     59460
     tattcatagt aatgtatcat taaagattgt ggttgtgtag gtttgaatcc ctttcattta     59520
     tatgttaaag aatcaaaaat tataacaaaa ttacctaatt cctaacaaaa aattgaaata     59580
     gttatggaaa catatctttt tgtttttgat caaaaggaaa catatctata aacggataat     59640
     caatattgtg aacaaaaaaa aaacggataa ttaatacacc aaataactta tggattcttt     59700
     ttgtgattgt gtccagattc atggaacggt tacatgacac atcgatcata gaattgaaat     59760
     ttatttcaac gactcaagag aatagcagat tgagaatctc tgtacaactt ttctatttct     59820
     acaacttcta gtcaaaacaa acctaccaca caaaagaagt gttaagtggt agagaaagat     59880
     taactttttt aaccataaac tcacaagagg ttaaacaaac ctaccacgca aaagaattgt     59940
     taatatcctg attagtagaa ctaataaact tgtttgaaaa cttaatgcac acgcattatc     60000
     tgtgacctat atatggaata aacaaaatgc gtaaacaagt tgtaatagat gttaatataa     60060
     ccacgaaaaa acaaaaaaca aaagttgaga gactatagaa ctatgaaaat aagtttaata     60120
     gtacttaaga aaaaaaattg atataatttt ctgttatgtt ttctcagatt gttttctacg     60180
     attgatgctg tgaagaacta acttgtttct tattgattca taatgaggtt acatcacata     60240
     tatatacata cttgaggagg ttacatgtct aatgggctag gttacaaaag cccataacta     60300
     cttaagtata tgaccgacct aagtatagtc tccatgggcc ggacctacgg gccggactga     60360
     ctgtggcttc tctccatgga ccgggccgac aggccgacgg gccgatggac cgatggactg     60420
     atgggccgac tggtcgatgg gccgtcacac caatgggctg acggacctat cctccaaaga     60480
     catgggccac ggttatggag tccatccaac aagtggttta caacactccc ccttggatga     60540
     cataaccgtg tagatgccaa cgggatctca gtaatacgct aggggaatgc tgcctcatta     60600
     aaaccttact aggaaaaccc ttttcgggac aaaaccatag tgaggaaaaa gagtacagca     60660
     cgcattactc cccctgaatt ggtcatctct ataagtcctt aagcctccgc atcccaacct     60720
     gatgcgcgag cttcctcaat gtcgttgctg gtaatgcctt ggtgaataga tcggctgaat     60780
     tgtcgcttga acgtacttgc accaccttaa cttcaccatc cttctgtaag tcatgcgtga     60840
     agaagaactt gggcagaatg tgcttcgtcc gatctccctt gatgtatcct tccttgagct     60900
     gagcaatgca tgccgcgttg tcctcgtata tgatggtcgg ctccttgtct tcgaccattc     60960
     cacaatcggc tcgtatgtgt tgagtcattg acctcaacca cacacactcg cggctggcct     61020
     cgtgcattgc caatatctcc gcgtggttag aggaagtggc cgtgatggtc tgcttcattg     61080
     atctccagga tatcgcggtt ccaccatgag taaacacata acccgtttgt gactttccat     61140
     tgtgcggatc tgaaagatat cctgcatcag caaaaccaac taaaccttct ttgttatggt     61200
     tagtataata taaaccaaaa tcaattgtcc cttgtaggta tcgaagcaaa tgcttgattc     61260
     cttcccagtg cctcttggtc ggacaagaac tgaatctaga gaggaggttc acggcaaaac     61320
     atatgtccgg tctagtgtgg ctagacaggt acatcaacgc tcctatggca ctgagatatg     61380
     gcatttcagg accgagaatt tcttcatcgt ccttctttgg accgaatgga tcactatcca     61440
     atcctaggct cctcacctgc attgggctgg tcaatgggtg agccttgtcc atattaaatc     61500
     tcttgagtat tgtctctgta tatgcccttt gatgcacaag gattccttta tctacatact     61560
     caagctgcaa tcccaaacag aactttgtct tgcctaagtc tttcatttcg aattctttct     61620
     ttagatattc gactgtttgg gcgatttccc cagagattcc caggatgttc aaatcatcca     61680
     catatactgc tattatcaca aatcctttgc tagcaaactt cttgatgaag atgcatggac     61740
     tgatggggtc atttttatag ccctctttga ctaagtactc acttaaccta ttgtaccaca     61800
     tgcgcccact ttgtttcagt ccataaagtg atctgttcag ccttatgcag tattggtctc     61860
     gagacccatt tttatctttt cctttgagct caataccctc tggtaatctc atatatatct     61920
     cattatccag tggaccatat agatatgcgg ttacaacatc cattaaccgc aagtcaaggt     61980
     tctctcttat tgccagactt attagatatc taaaagtcgt tgcatccacc acaggggagt     62040
     atgtctcttc ataatctact cccggtcttt gtgagaatcc ttgtgccaca agccgtgcct     62100
     tatgtctcac gatttcgttt ttttcatttc tcttcctcac aaagacccac ttgtgtccta     62160
     ctggctttat attagatggt gtcctcaata ttggaccaaa cacatctctt ttctttaatg     62220
     aacctaactc cacatcaatg gcttctttcc acttaagcca atctgacctt tgagtgcact     62280
     ctattataga cgtgggttca tgatcctcat ttatctcata tgctacctca tatgcaaatt     62340
     tctcgtcgac gtcgacttct tttcggttcc attttattcc agacatgatg tagtttattg     62400
     agatctcatc attatcaatt ccttcaggac catgagcttc ggcgtcccga atctcatttg     62460
     gtggttcctt aggacttgcc gcggccatgt ctatggtttc ctttacctcg gttcccattg     62520
     cacctttctt agtctttcga ggaattttat ctttggaacc tattggtcta ccacgtttct     62580
     tctgtgggtt agactcggta gcaattacat tgattccctt ctggatatca atacgtactg     62640
     gtgcattaca agctggtatg tacgatttca caactctctt tgggtcagca aaggaatctg     62700
     gcaactcatt agctagcttt tgcaaatgta taattttatg gacctctgaa tcgcacatca     62760
     gagtccgagg atcttgccaa ttcaaggatg tttgattcca tgctatctct tttatttctt     62820
     tacccagctt gttcgtctca ccacctaacg cagggaactc ggattcactg aagtgacaat     62880
     ccgcgtatct agccttaaat agatcgcccg ttgtcggctc tagatacttt ataatggtgg     62940
     gagaatcaaa tccaacatat attcccatcc tcctctgagg tcccatcttt gttctctgtg     63000
     gtggagcaat tggtacatat acggcacacc cgaatgtcct tagatgggat atgtctggct     63060
     catgacccgt taacaattgg gatggtgaat atttgtgttc actagatggc ctgatacgaa     63120
     taagttccga tgcatgtaat acagcatgtc cccaagcggc tactggaagc ctcgacctca     63180
     taagtaatgg tcgagctatc aattggattc gtttaatgaa ggattccgct aatccgttct     63240
     gtgtatgtac atgtgccacg ggatgttcca cacttacccc catggacata cagtagtcat     63300
     taaacgcttg ggacgtgaat tcaccggcat tatctagacg tatagtctta agcggaaaat     63360
     ctggaaaatg ggctctcaga cgtatgatct gggccagtaa cctagcaaat gcttggttcc     63420
     tagaggacaa cagacaaaca tgtgaccatc ttgtcgatgc gtcaatgagg accatgaagt     63480
     atcgaaacgt cccacatggt gggtgtattg gtccacatat gtccccttgt atcctttcca     63540
     gaaagtttat ggtctcttta ttgacctttg ccggtgatgg ccttattatg agtttccctt     63600
     gtgcacatgc agcacacgtg agcttctttg ggataactct cttttctttt agggtgtgcc     63660
     cctttgaact tatcattagc tttcgcatca tgttatgacc cggatggcca agccggtcat     63720
     gccacaaagt gaactcctct atgaactctt tgttcattgc caaattatct tcgatcatgt     63780
     tgatcttagt atggtaaaga ccagtggaca atgcgggtat agtttctagg actctcttaa     63840
     gtccttgggc gatctctgtt atatgtagga attctctatt cccttcaccc tttgtttcaa     63900
     cgtggaaacc attaagacgt atgtctttga aacttaacaa gctcctcttt gagctgggtg     63960
     aatacaaggc atcacttatt tcaagatgtg tgccgtttgg taagagtaca tgggcttggc     64020
     cgtagccctc aatgagactc gctatacccg ctatagtgct aatgttggca tttctcaatg     64080
     ttagatttat aaaatatctt ttgtctctta atatagtgtg gcttgagcca ctgtccacta     64140
     tgagtatgtc cttgtcctcg gccatttcta aatgtggaca agaactatat cttaggcgat     64200
     aaagcaaaca ataatgaagc aaagcaattc cataaaaata aataaatcca agacatcgag     64260
     caatagaaat caaactacaa agcaaagcaa acaaatcaaa tttaaaatta gatgtctatt     64320
     ctcccaagat gtccgaagtc tcataatcca ttaggtcatc tttctcgtgg tcgaaatccc     64380
     cttcaccatc gagatgaacc aaatttgctt cgggtccctt ttgctttatc atctcttgat     64440
     atgcctcaat gaggtgctta gaggttctgc acgtctttgc ccaatggtcg tccatgccac     64500
     acctatagca cacggactta gcctttcctc gcggtttgtt aataccacgg cctctacccc     64560
     tacctcggcc atagttccca cggcctctac caccatagtg gtttccttgg ccgtagaaat     64620
     tgccacgacc tcttccacca cgtcctctgc cacggccacg gccgtgaggg ttacccctat     64680
     ggacgtagtt ggattccttg gtcgcctgag gttcattagg cgctttggcc atttcggctc     64740
     tattggcttc gggcacagct gtggatccgg gaggtctcaa tgcgctgttc atgagtaact     64800
     gctcattgtt cttctcagca agaagcaggc aggaggctag acttgtgtaa gtcgtaaacc     64860
     ctttcgcacg gtactgttgc tgaagcagta cgttgttcgc gtgaaaggtc gagaaagttt     64920
     tctcgagcat gtcattctca gtcaccttct caccacacag cctcaggata gagacaatct     64980
     taaaaagctc ggagttatac tcctccacgg atttataatc ctggatcctg aggttaagcc     65040
     aatcatgttg ggctttgggt agttgtatgg tcctttggtg gtcatatcga ttcttcaact     65100
     caagccaaag ctcaagtgga tcctcgactg taaggtactg atttttcaag ctctctgcta     65160
     tatgatggcg tatgatcgag atcgcctgat actttgacct ctccgttttc tcatttcctt     65220
     ccacaatgca ctcggcgagt cctttagact tcagctcaat cttggtgtcc aatgcccatt     65280
     gaaggtaatt gtcaccagat gccaagagtg cagcgtacat gaggtttgtg agcttcgaca     65340
     tctacaatga agaagttacg agtcaatatc atgtaatgga caaatcataa atgtcatgaa     65400
     gaccataaat cgattttcct atttactcaa ggatttgact ttctcttttc ctctttccct     65460
     tgggacaatt tcctcttttc tctaggataa tttccctttt ctctttagga taatttcctt     65520
     tttctcttta ggataatttc ctttttctct ttaggagaat ttcctctttc tctagggatt     65580
     atttttcttt ccctcttggg agagtttcct ttttcggtct tagggtaaat tttccttttt     65640
     agcgattttc tattttcctt agggttttgg ttttagggtt tatgcaacat gaaggatttt     65700
     aacaattcat gcatgcaacc atgaaatcaa tcaaactaaa catcctagac aacttcaaac     65760
     aatcacgaaa tagaattagg gttttgatcc gattatagtg ttttcgattt agggtttatg     65820
     tcttttaggg tttcggattc taggttaata tgttttcgat ttgcaagttt aggataagca     65880
     ataacaagac aaacaatcga gcaaacaagc aatcatatta caaacactac tcaaccattc     65940
     gtttttaggg ttttagccgt ttgttagatc catgttcgat tagggttctt tagctttagg     66000
     gtttaatgaa ttacctttct cctttggggt tgtacggact ggaaccagga gctaaagacc     66060
     ttggttatcg aacggtggtc gctggtcgac agttggtggt cgacggaagt atcgtcggct     66120
     gacagacggg cagcaaacgg tcgacaggcg gtcagcaaac ggtcgacagg cggtcagcaa     66180
     acggtcgaca ggcggtcgac ggaacagcgg acggcggacg agctagggtt gagcggcggc     66240
     ttctagggtt ttgttaagag caatgtcgtg ctgataacgt gtgaagaact aacttgtttc     66300
     ttattgattc ataatgaggt tacatcacat atatatacat acttgaggag gttacatgtc     66360
     taatgggcta ggttacaaaa gcccataact acttaagtat atgaccgacc taagtatagt     66420
     ctccatgggc cggacctacg ggccggactg actgtggctt ctctccatgg accgggccga     66480
     caggccgacg ggccgatgga ccgatggact gatgggccga ctggtcgatg ggccgtcaca     66540
     ccaatgggct gacggaccta tcctctaaag acatgggcca cggttatgga gtccatccaa     66600
     caagtggttt acaacagatg ctactttttt ttttttttgt cgctacgatt gatgctactt     66660
     agatgaatta tttattcgct tgcttgataa ggttgtaata tttgctgaga taatttaaca     66720
     tcttaaaacc aaaataaatc taacatcagg gatcttttag caaatgtttt cacttcttaa     66780
     aatgcatatg atatcatcca catatgttac tgtaatatca tgaatgtttt ttggtcaaat     66840
     attatcatta atatatgacc aatattcttg tctattttgg tcaaacatag tgtggggaat     66900
     aaatctgaag tagtctttaa ttgtttggta tgaatttttg ggccttaagt attgttatat     66960
     gatcatattt ggcctttata gacccaaaaa aaaaagtata tataaaattt ccatgaaaaa     67020
     taaattaaga ttactctgct ccgaatgaaa atgatatatt tatatagatc aattaatcca     67080
     ctacccacag agaagaagaa aaaaaaccat cgcactcaaa tataggttga acacttttaa     67140
     ttgtgaacaa caaattagtt cggttattgc ttcccaacaa atataatcat tttctgttag     67200
     atgctatcct ccaatcagat ttcttgaaag gtaattctca accatttcat tttcacatta     67260
     aggcttttag atattcattt acctttgtta accgaaagtt taaatatgaa tagttacacg     67320
     ttatcactag atgtcattca ttcttgtaaa ctacgtacta tggtgattat tactagaaga     67380
     aagtattgtt tttaattaga acatgtttac acgtaatttt tacataaata tttagatgtg     67440
     tttccaaatt ttaaagacat agaatcgggc taaaaatctt atttgggaca tccagaaatt     67500
     aaacttttga aacatagaaa caagacattg tgatgagaag agtaaaagaa aacataaaaa     67560
     gataccaacc tacacttagg ttccaaccca caaagagata catatacttt ccctctaagc     67620
     tttgaagctt tagtttcacc aaactgacga agcacaagaa cccaacattt gcatctttat     67680
     aaggcaatga tcatgaatca ttttcgaatc acaaaaccaa gagagaaagt tgagaaatca     67740
     tcagtagaag atcaaaagaa gaaaagtcat agtatacatt taaagacaca tcaaaagctt     67800
     caagggaaat ggtatttcca attcggattt tggttctttt cgcattgctc gccttcccgg     67860
     catgcgtcca cggtgcaatc cgcaagtaca ccttcaacgt aagtccgcat gatcaatgtt     67920
     atcatcataa tatattatat gatttcatca aggttgtatc attctttttg agtctaaaaa     67980
     attcttaaat aaaagtagta aaacgtacgt acgtaattat ctaaaaataa caggtggtaa     68040
     cgaaacaagt gacgcggatt tgttcaacga aacagatcgt taccgttaac ggtaaattcc     68100
     caggacccac aatctacgct aatgaagacg acacaattct cgttaacgtc gttaacaacg     68160
     tcaagtataa cgtctctatc cattggtgag actgtcctcg tatttttaaa ttatcaactt     68220
     ttcctccctt aattatcaca aaattaacct aaaaattgat tttgttggtt tgcaggcatg     68280
     ggataagaca attaagaacc ggttgggctg acggaccggc ctacataact caatgtccaa     68340
     ttaagccggg tcacagctac gtgtataatt tcacggtcac gggtcaacgt ggtacgctct     68400
     ggtggcacgc acatgttctc tggctccgag ctacggttca tggtgccatc gtgattctgc     68460
     ctaaactggg tctaccttac ccgttcccta aaccacatag agaagaagtc atcatactcg     68520
     gtactaatta caatgacata attatgataa acgttaattt ttaaaattgt ggttttaaca     68580
     atttgaattt cccggtttaa tgtttaatag gtgagtggtg gaaatcagat accgaaacgg     68640
     tagtaaatga agcattaaaa tccggtttag caccaaatgt ctcagatgct cacgtcatta     68700
     acggtcatcc cggtttcgtt ccaaattgtc cgtcgcaagg tgaaatacta aattcgattt     68760
     ttaaaactaa acttcactat aatcattatt tccttaattt gtattattat atgatctgat     68820
     tataattttt gtcctttttt ataaataaag gtaattttaa attagcggta gagagcggga     68880
     aaacatacat gctacgacta ataaacgcag cattgaacga agaactcttc ttcaagatcg     68940
     ccggccaccg tttcaccgtt gtggaagtcg acgccgtata tgtcaaaccc ttcaacaccg     69000
     acacaatcct aatcgccccc ggtcaaacca ccaccgcctt agtctccgcc gcacgtcctt     69060
     ccggtcaata tctaatcgcc gctgctcctt tccaagactc cgccgtcgtc gccgtcgata     69120
     atcgcaccgc caccgctacc gttcattact ccggcacgct ctccgccaca cccaccaaaa     69180
     ccacttcacc accgcctcaa aacgccacct ctgtcgcaaa tacattcgtt aattccctca     69240
     gaagtctcaa ttccaagaca tatccggcta acgttccgat caccgttgac cacgatcttc     69300
     tattcaccgt tggattagga atcaaccgat gtcacagctg taaagccgga aacttctcac     69360
     gagtcgtcgc cgccataaac aacattacat tcaagatgcc taaaacggct ctgcttcaag     69420
     cgcattactt taacctaacc ggaatataca caaccgattt tcctgcaaaa ccaagacggg     69480
     ttttcgattt taccggaaaa ccgccttcca atttagcaac catgaaggct acaaagcttt     69540
     acaagcttcc atataattcg acggtgcaag ttgttttgca agacaccgga aatgtagcgc     69600
     cggagaatca tccgattcat ctacatggat ttaatttctt tgtggttggt ttaggaactg     69660
     gaaactataa ttccaagaaa gattctaaca agtttaatct tgttgatccg gtggagagaa     69720
     ataccgtcgg tgtaccttcc ggtggttggg cggcgatcag attccgagca gataatccag     69780
     gtttttatct tattatacta gtacataata tctacaactt ttgtatagta atatatattt     69840
     ttcaatttgt aacaatgact atttgaaata atatatatgt atatttgtgt ggtttcaggg     69900
     gtttggttta tgcattgcca tttagaggta catacaacat ggggactaaa aatggctttc     69960
     ttggtggaga atggtaaagg ccctaaccaa tcaattcgtc ctcctccaag tgatcttccc     70020
     aaatgttgaa aactccatta ttattttttg aatcgattaa ttcgtttctt gacattttaa     70080
     aattttgata tgtgtatgct catgtaaatt gtcaataaag tcattgtatg atttgttacg     70140
     ctttaatgaa aggttgaaaa gaagcatcct tttaattaaa ctcaccaact tttttttgag     70200
     ctgaaatttt tttcggactt ctgattgatc catagtttgt cctaatttgt ttttatcact     70260
     tgtttaatac atgtggtaga taataaaaaa tgttcaaaac gcaataccat acttgaaaaa     70320
     aaaaaatgtt agacctagtt ataagacaag actgaactaa ttaagtgatc ggttagttgg     70380
     taaaacaaaa tagtatttcg aacttaattt tcacctaaag tttaaacgtg tctactaatg     70440
     actcgataaa ctaaaaaaaa cagtcttttt tttcttccaa aaagtcgtta tcaaagcaga     70500
     attcatctgt cgtcgaattt tgaatgagta ggtgcaatgt cacatttcca atattaaaag     70560
     aaaacgagaa agaaaaaaac aaaatactcc tcataaaacg atagaaatga aataaaacga     70620
     agcaagagta ataaattcga cagaaaaagg agtaatttac taattatagt aagagaatct     70680
     tgctaaatat agaatccaag aagaagtcac tctctgtgga acagaaacct tgtgtctgct     70740
     acaaatcagc agatgacact tacagtttac gtttcatcat gcatgtgagc gacactatag     70800
     ggagaattcg gtattggctt cctttgttgt ccctacctta tttaattact cctgataact     70860
     atttttctgt gtatttcatc gtatcgaaat atccaaattt cattcttcat ggctgattta     70920
     actagtgttt aattataatt atactttata cttttttttg gttcttaatc acacatgctt     70980
     tcgggatctt gaatacgaaa ttttaaaccg tctatcattt gtttcctgaa ccgggtattg     71040
     caaatagtta aatcttagtc aactattttt tcgagttttt tttaaaaata gttctgaaag     71100
     acaaaaatac atgagtttgt gaaaatgttt gacagttggc tataataatt ggttgcaatg     71160
     ctttatactt ttaccaaatt taaattattc aattggctag aagtggagct gtggtaccgt     71220
     ccacatgagg tggtgtcgtg gtgagacatt aatatatgaa cttttgttac gatatgaaag     71280
     cacccgacac atacattctt cgtattatct tgccttatat gaataaacat aaaataacca     71340
     atactaaatt tgaaactgtg atacactaaa gaaaatatct ttggttacat ccagctctgg     71400
     cttctgttca aagtttttct tttgaattta tttaaaggtt aattaagatc accacctaac     71460
     ccacttgtac aacggttctg cagtttttgc catcgaatcc cattgtttaa ttcgcatatt     71520
     tgtatgatct ctactttttt tttaaagtta aatagattaa ttaacaaaat gaagtttatt     71580
     tacaacaaaa taaatgaaaa gtacaaatac gttaaaaaac aaattgtttg ccagccaaaa     71640
     attaattaaa tacgtaattt tcgaaggtgt aatattccaa cttgtttttg tatatttgtt     71700
     tagcttatgg agttatggtt gtgttattat atattgaatg ggctatttcg tgttgacaaa     71760
     taagctcttt agttaaatat tattatgttc ttgattaaac aacaaattaa gaaccggcca     71820
     aaccattgaa cagtcgtttt ctggtctttt tcattttatt ggttacacct tctttgtcat     71880
     aaaatagaaa ttatgttata ctttctttca tgtatcgaca cgtgcatttg gttagtctta     71940
     atcccatttc aattttatat gatttatcat attagcagaa aacaaatatg ctaattatca     72000
     catagataag ccatactaaa agtatttatc tgaccttagg ttaaaaaaaa tattaaaata     72060
     tagcttataa gaaacattca ctactgagtt gtcatatttc tactggccga cttagattgc     72120
     aacaactaaa atatattttt tataaatcat ttgacatagg caaaacaaaa acaaatatct     72180
     ctgtaacttt ttcctcaatt ttttctttta aaaaaacact tttttataca ccttttcctg     72240
     ttgaatgtat tattattcct attgatcatc acgtgaaata tagaaaaata aaataaaaaa     72300
     gcaaaatcca cttttgtgtt ttccttttcg tttacgacca aagagatcca ctttatgctc     72360
     tcttcatttt ctccatgtaa taatttttct cgagagattt ctgaaaataa agtcgtttct     72420
     tttttttttt gccttggtca ctcaagactc tcttcttcac tctctgtttt ttgtcctctt     72480
     ctaaaattta gagaaaaaaa cgaaagtttt caccaaaaac agaggaggag ctatgtcatc     72540
     gtcgacgatg tacagaggag ttaatatgtt ttcaccggca aacacaaact ggatttttca     72600
     agaagtcaga gaagccacgt ggacggcgga ggagaacaaa cggttcgaga aagctctcgc     72660
     ttatctggac gacaaagaca atcttgagag ctggtccaag atcgcagatt tgattcccgg     72720
     caaaacagta gctgacgtca ttaaacgata caaggagcta gaggatgatg tcagcgacat     72780
     cgaagccgga cttatcccca ttccgggata cggcggcgac gcctcctccg ctgcaaacag     72840
     tgactatttc tttggtctag aaaactccag ctacggttat gattacgtcg ttggaggaaa     72900
     gaggagttcg ccggcgatga ctgattgttt taggtctccg atgccggaaa aggagaggaa     72960
     gaaaggagtt ccgtggaccg aggacgaaca cctgtaacta ccaaatttct tcactacttc     73020
     taattaatgt tataaagatt tgttctaaaa aaatcgatat tttatgttat aatactatag     73080
     aatttaagtt tctaagccta acaatttgtt tattttggta aataattttg gaactaaatc     73140
     ttgttttgtg gtattttgag gtaaatatat ctcttttatt aatatttact tgaaattctc     73200
     tgtttttata tgaactcact gaggagaata tttcttttga taattaaaat gcctaggatt     73260
     tatacttttc ttacaattta tatctatttt caaatacttt cttgaaatta tttatcttat     73320
     gtgaagttaa ctaaatataa tattgattta cttttctttg tttgacagac gatttctgat     73380
     gggtttgaag aaatatggaa aaggagattg gagaaacata gcaaaaagct ttgtgacgac     73440
     tcgaacgccg acgcaagtcg cttcacacgc tcagaaatat tttcttcgac aactcacaga     73500
     tggtaaagac aaaagacgat caagtattca cgatatcacc actgttaaca tccctgacgc     73560
     agacgcatcc gcaaccgcca cgaccgctga cgtagcactc tctcctactc cagccaattc     73620
     ttttgacgtt ttccttcagc caaatcctca ttacagtttc gcgtctgcgt ctgcgtctag     73680
     ctattataat gcgtttccgc agtggagtta aatcacttag aaattatcta gagtttgtgg     73740
     tctcctatag atttgttaca tacattttct acgtacatat tactgcagaa ttgttgtaaa     73800
     tatttgtatg aaaaggtttg tgtgattctg ctgtccatat attaggtctg gttggttgta     73860
     attttcagtg ttccgagttt tataatacca atatatgata tatatatatg atatatatat     73920
     atatatatat atatgtgtga ctttacatac tatattcttt aataatcata taattataat     73980
     gtaaataccg ttgactttaa tgtcaatgct tggtgtgagt cgctttttct tcccgacaac     74040
     ttaggattag ttcgaatcag catctaattc agtttttttt tgttcaaatt aaaagtaaaa     74100
     ctgacgaagg atctgactat taaatactac ttttttactt aatattcttc ccatggcttc     74160
     gctgatcgtt caacataaca gaagaattat attccatttt cgtggttcca tttacctcca     74220
     attattatca tgaacctgac gggtgttgcg tcccaaatgc ttcgagcttt caatttgttt     74280
     tttttttgtt taactaaaaa aaacgaaaag aaaagggaaa acaaaaaaac aacgtcggct     74340
     tacaaagccc aaagaagaag aaatagttaa tgcccattaa actgtgcccc aataagatcc     74400
     cttaaacccc gtaaaaatcc atgattttca agcccagtag tgatttggag tgtaccggtg     74460
     atttggagtc tactaaaatg ttaaattcat aaattgcaaa aagttgtaaa ctacagtatt     74520
     aggattacga cctcttaaaa atagagatac aaaagagtat aatatgaagt cgcaccacat     74580
     gtttttcata tttcaaattg caaccaatcg tagagagtta taactagtaa gacttccatc     74640
     gccgtaccta aaactagata aaagttgatt aaaagcaagt acacttcctt tgtcttaaca     74700
     ttaaaaccaa aaaaaaaaag tacacttcct ttgtcttttc aacacgaaga agatagaaaa     74760
     ccgtaaaaag aattctaaaa tcatgtattt tgataaaagt catgcgaatc caacaaatta     74820
     aagaggttgt agccgcctta gttgtgtaaa tcgttatagg tgtcaccgtg cactaaagat     74880
     caattgtata atagacatgc acttgtatgc aaaggtttgg atccctcttc tcttgctttt     74940
     atatgtaatc ttataaatta taaattcaca aaacaaaatt tcttgaatca gttcacagtt     75000
     acgaaaacgt tatagttaac tagaaaacca taaaaacatg taatggggta gtgttgtaaa     75060
     ttcaacatcc aacaagtctt gtcggggtag gatataagag agagcaacaa agaaacaaac     75120
     aatcaaagac cacaattttt ctttctcaaa caagacatgt tctttgtacc aacttgtgtt     75180
     ttaaaaaata aaataaaaag tcaagctggt tctaagggta gtttcgtcat tgtgataaca     75240
     atctccatca ggtatgacgt ggcttccgca tcagattatt cgtttttagt tataacctcc     75300
     gaaaataatt tcgctaaaca tttaattaat tattgtgtac ctgtttgatt tgtgttttaa     75360
     ataattagca tgttgtgcgg tagacgtaga ttagactcgg aaatcacaaa cccccgtgta     75420
     gttaactatt aataacaaac aaaaaacatc aattgtttag aaaatataca gaaattttga     75480
     attttccgaa aatacatgaa aaataaaaga aaagtaaact agacaaaatg atagtataga     75540
     cttataagtg ccttacgcat ctaattaagg acatgattca tcgtagactt gatgacctga     75600
     tcttaggata gccggatgga ttatgattta tgattcatct aataatatac ggatgaatta     75660
     tatcacaaat ttcagattag agaagagatg tggagctaaa caagatttac aaggttgaca     75720
     ttgattaatt tgagtataga gattaataaa tctataacga catatgtacc atgtacttaa     75780
     tgagtgggaa ttaggggtca catgcatgca ttatgggtca tgtaatgatt agcttgacat     75840
     taaataagta agttggtgtt aaatcaatat tgattaatta atgaaaaagg tatatgcatg     75900
     tattgcttac tccaaaatat ctgattagtg ggaagttaaa aagtattatt tcttaccact     75960
     aagttgcacc attcccagtt gataatttta tgatcacaaa gacaacatct attcacattt     76020
     atacatgaaa actactaaat tgaattcata atcccggaag tgtgtatata tgttgcaaga     76080
     atatccgtaa atgatgttct taaaatctga actccaaaat ctttctaggc aacttgtcgg     76140
     tggatgcata aaaccgatat gatgaacaag gtctgaaaca acatttcacg tgaacaaagc     76200
     tctggcacga agcagttcca tttgataaac tacattcaca cattatgtcc cgaaaaacca     76260
     ataagcgata cctataatgc atgtaactca ctgttcatat tcgtgagttt tcactttttt     76320
     tttccttttc tcatgagaag tacttttttg ttgttgctgg ttggctatca taaaaagtac     76380
     tataatctac gttattggta tatctttgta ctcgttataa ctacaattaa aaaaaaaaaa     76440
     aaagacacaa gtattatcca agaaaaacaa tccttgtaaa tcgaatgaaa cagtgaagcc     76500
     gaatctatat ggtattgtgg gaaatctaaa ccttttgttt atatatagat tagtgaaagt     76560
     gatttaaaat tgtccctacc attaatatgg agaaaaacgg tcaaagcact cagttttggt     76620
     agattttata gatgcattga acatgcttct aattaacaga gttgactctt ttttccacca     76680
     ttctctttta tatattagta tatatatcca ctacagcatg tatatacatt tctttcttga     76740
     aaaaggaata agtaaatatg aatagtgtac actgaacaat ccacttcgaa aggttaatct     76800
     aagttaactg ttacagctag aaaagtttga agttgcaaat ttttaaatat tagagattag     76860
     gatatgtcta gctagtggac aacccatagg ccatagggta attggtgggg taactttatc     76920
     taaagcttta taacacgaca gcaaaagtgg aagatgttgc aattttcctc ttttattcaa     76980
     ctttttcgct tccaagtttc gtgatttaca tggtattgat cacaatctgt ttttactatt     77040
     gcatttttct tttccgactt cttatggttt agagtcaaag taaacttaga aaagcaacat     77100
     gctgtatcac agattaagcg aatgcaaaat aagaagacat ttttttaagt ccattgtgac     77160
     atgtttagtt catagagtcc atttattatt tattttcctc actatacagt agacatggta     77220
     cagtttctca tactacaatc atatctattc tgcttttttc tccaatcata gtatttatta     77280
     tgcttttaaa tgccttcatt aatcccttaa tgccgcttat taagataaga accataatac     77340
     catattccaa acttttaatc tttaaactac cgtaaaaaat tcctttgatt ttacgacgat     77400
     ctttttttcc aacagtagga gtttcgtata aatatgcaat ataaagtcat gctacctttt     77460
     gaaaaccagt aacatacatt taatataagt tgaagacaag tgatgataca acattattac     77520
     ttaatagcat tagtataatc taccatatgt tttttttaat atgctgtatg ttggcatcaa     77580
     tgccatactt tatttgcttc ataaatcatg ctgattttct tataattttg ttttcagtaa     77640
     taacattgtc ttatgtttta ttttatcagc acatgtaaat agttataaca agataagtaa     77700
     tataacttat taatagaatt tgaactaaag ccattataat tttgatatat attgttacga     77760
     aaattattaa cgttagttga caatagtatc aatcattttc ctcattgttt ttgttgttgg     77820
     ttatatatgc tcatcattat taatcaccac atgaagtgat tataactaat tgttgctgtc     77880
     agaggcgaat cagacttgag aataagcaat gattactaag aacaaattat gtaatggaaa     77940
     tgcagttgaa ttctactact aatttatttc cttaaactca ataattgtta accattgtag     78000
     tagctgaaat ttgggatgca tactaaacaa aaattattgt agttggggaa gaaataatta     78060
     atgatcatgt ttcatgttat ttgagttaat aatggaccat atgataactg agtcattaaa     78120
     tgcttttgtt ctttgaaatg accaactaga atcaatgcga aagacacata tatagcgcat     78180
     ttgatgtcat atatactatt attaaattca tatatacatc taacgataca atttaattta     78240
     tctatgttat gtactgttat ttttcatgat tctcagctga taagacatta tacatatcca     78300
     aatcgaatgc ttttgaataa gtgcacagaa gttaatagaa agtaagcatc aaattctata     78360
     ttaacatttc cacactattt taatattcat tgcatttgca tacatatata tatatatata     78420
     tgtatatgat tctaaaagtt ttgaaaatag cataacaaga aattaataag tggtaaaaat     78480
     attaaatgtc atcaaccgtt aaatattaac tattcaagta agaaatcgta ttaaaatact     78540
     actatgttac aaatcttcgt ttttttttgt ccgaaacaaa acagagcttg tgttccccat     78600
     gcaattaatc ttgggatcta aaaaacaagt gaaaaaggca gacttgttaa gtttcctatg     78660
     agatttatat tgtcagagga ttagattttt tgtgcatgag tacatactca taaaattaaa     78720
     gaagaaaaaa agcagaagag taggtcttaa cgctccatct gtttcccatg gaagctatct     78780
     gtcctttctt ctccttccga ccgaacacgt cctctccatc tttttctttt ttccttccat     78840
     atattaaaac agtttagatg tgacgaaact ttataatatg tgttaaagtt cgagatttac     78900
     gatctcatgt caaatatgaa aaataaagat agagagtaag tacgtaccct gttatataac     78960
     tcttataaaa tttagtactg ttacgaatgt tacgagtctg tgaccacttg aaaacatgac     79020
     aacaacatca agttcgacta taagatataa acaagttttt aatttggttg ttgttggatt     79080
     caacgtccac tgaatatata attattttag atgacatttt gtgttttcaa ttatatttat     79140
     attaacgatt tgtacttaga caaaatgata catgcatgag ggaatctatt atattactac     79200
     tattacttag acatatatat atttctatat gcaaaacaga ggatactcaa atttcctcat     79260
     ttgtcaaaaa tgctggcaga tgttatccac tacaaataat tacacattag gtcattgtaa     79320
     cttactgatt ttgtcatgtt tgtctgttat ataaatcgac taactgtata tatagatttg     79380
     atctaaaccg aataatcgaa ccaaaacaga atcaaaatca atcaaggaag caagcaaaca     79440
     aaaaaaccaa aacatttcac acataaaagt ccgaaattgg gttctttctg attttgattt     79500
     gaaatttcaa agaaaaaaca accaaacaca cttttactta tcctaaaaca aaacattttg     79560
     ctcgtgaaag tgatgttaac acttgctata aatattcatc tagaatttgc atggtgagat     79620
     atgatactaa ttgaggcaag aatgtgcgtt tgatataatt ttttctttag taacaaatta     79680
     acaatataaa tatcaccggg attttcatat agttttatta tacaaaccta ttgtgattat     79740
     aggcttcata gctaaagaaa aagaaaaaaa tatgaaatat agaaaacaac taaaataaaa     79800
     agacaagaat agtaacaact caagttcatg aatccaacca ttgatccgac cactatataa     79860
     acccctatcc cccccccccc ccataactcc tactcatcac caatacgggc aagttaaacc     79920
     cataactccc aaaatccata tcctctttaa aacatttttg tccaaataaa atgccttctt     79980
     gttcggtaac tgaaatttca aaatgtatcg tctatccgga gaagaagtcc accgtctccg     80040
     atctccgtct ctccgtctcc gacctcccta tgctctcatg tcattacatt caaaaaggcg     80100
     tcctcctcac cagccctcct ccttccttct ccttcgacga ccttgtctcc tctctccgcc     80160
     gttctctctc ctccactctt tccctcttcc ctgctttagc cggccgtttc tccaccactc     80220
     ccgccggtca catttccatt gtctgcaacg acgccggagt tgatttcgtc gccgcttccg     80280
     ctaaacacgt caaactctct gatgttctct taccaggtga agacgttcct ctgcttttcc     80340
     gtgagttttt cgtcttcgag cgtctcgtta gttacaacgg tcatcataag cctctcgccg     80400
     ccgttcaagt gacggagctc cacgacggtg tcttcatcgg atgtaccgtg aatcattccg     80460
     ttactgacgg aacttccttc tggcacttct tcaacacctt tgctgacgtc actagcggtg     80520
     cttgtaagat caaacacctt ccagatttct cccgccacac cgtcttcgat tctccggtcg     80580
     ttcttccagt ccctcccggt ggtccacgtg tcactttcga cgccgaccaa cctctacggg     80640
     agagaatttt tcatttcagc agagaggcga ttaccaaact gaaacagagg acgaataaca     80700
     gagttaacgg aattgagact gccgttaacg atggaaggaa atgtaacgga gagattaacg     80760
     gaaaaataac aaccgttttg gatagttttt tgaataataa gaagagttat gatcggacgg     80820
     ctgagatttc atcgttccaa tctctcagcg ctcagctatg gcgatccgtt acacgagcga     80880
     ggaatctcga tccgagcaag acgacgacgt ttcgaatggc ggttaattgc cggcaccggc     80940
     ttgagccgaa gatggatccg tactacttcg gaaacgcgat acagagcata ccgacgttgg     81000
     cgtctgcggg agatctgcta agcaaagatc tcaggtggtc cgccgaacag ttacacagga     81060
     acgtggtggc gcacgacgac gcgacggtcc gccgtggaat cgccgcttgg gaaagcgatc     81120
     cgaggctgtt tcctctcgga aatccagatg gagcttcgat cacgatgggg agctcgccga     81180
     gattcccaat gtacgacaat gatttcggat ggggaaaacc gttagctgtg agaagcggcg     81240
     gagcgaataa attcgacggg aagatctcgg cgtttcccgg tagagaagga aacggaagcg     81300
     tggatctgga agtagttctg gcgccggaga ctatgactgg gattgagaac gatgctgagt     81360
     ttatgcaata cgtatcagaa gtcacttacg attgttgaaa acgacgtagt ttctgataca     81420
     gaggaaaaaa aagcaaatat ctaaagtgat agaggaactt aatggcatgg cactttggac     81480
     ggttgagatt tatctataaa gtttttagat atttcgatct gagagttgtg aagcgaacga     81540
     cgtcttatga gtcaatctac tggtcttaat gtgacagtgt attattaatg tacaaaatcc     81600
     cgtctttttc aagtttttct ttctaaatta acaactctgt attatcattt tagaaacttt     81660
     tatttcttga ttactataat tgacgtttta gaaattaata attgactttg gaactatctt     81720
     aatacgatta tttgggggca aaaaagtagt aatgggaccc agcccatgct tgtaagttgt     81780
     ccacttgtaa caaaaggccc aagtttgtag cgattaatgg gcctatcgat aggctggtgc     81840
     gtccttgtgc ttccagcaac taagaaccgg cctcgtacac gttcctcgaa caaaaaacaa     81900
     caaactaaaa cagaattgac aacttgtata acgatcaaac caactaaaca gtttgtgggt     81960
     gcatttaatt tctttgtccg agccttaata gtcacaaaaa tagcaagaga aacataaact     82020
     aatctgctaa tcgttttttt acagaataaa aagaaaagaa aaaaacaata gaataaaaac     82080
     acaaagtata tatctaaaaa aaaactaaaa ccctaaaggc caaagttcaa accaggtttt     82140
     aaacctccta ttagacatag acacacatat cttacaattt acaacatcaa cctttccatg     82200
     aacatatata agcaatccaa gtataagata aacaccatta atcaaacaga ggattttcag     82260
     taaatgaaac catagactat caaatcttca cattccatac caaatcctcg tccactgctt     82320
     tttctacacg ttaccttccg gtactggaaa cagtcgttta atcaaccaat tgattggtcc     82380
     caaaacatga actttctttt tcctccagaa ccaaatcgct gcactgtact gttcattgcg     82440
     tatctttgtc gttgctgctc tccaatcata tttctcggtc tcttctcttg ccgcttttcc     82500
     aatgatctct cttgtttcac ggtcgtgcag taaagttctc agttttgtca cgcaatcttc     82560
     aacatctcca gggttgaaca aaaatccggt ttttccctcc tgatgaaaac atcagaatca     82620
     gaaaaccaca agctcaatat aggttgaccc ataagaacaa tcaatgcaag atcattttgt     82680
     gtaccagtct atgattgaat aaagtttcag ttcggttaca gctcgcttat aagaaaattg     82740
     gcagaaattg ttttttcaac catttcggtt cggttgatat gctcatcaat atggtttggc     82800
     agttaattgt aattcagata attcactgac ctgatcttca gggattatat cagggattcc     82860
     accggcacgg gccgcgacga caggaagtcc tgaagacatt gcttcaagaa ccacaaggcc     82920
     aagtgtctcc gactctgatg gcatcacaaa cacatctcca cttgcgtaag cttgtgagag     82980
     ttcatcgcct tgtaacgttc cagtgaaaac cgctggcatt ccggtaaaca acttctcaag     83040
     atcctctctt taagaaaacg aaacagataa acaaaattac aatgttgttg actagaaatc     83100
     ttcagataac aatatggcca atctttaaca aaactagtac ttgtatggtc catctccaat     83160
     gaaagcaatc cgagcttcag gtaatttgtc cattacactg cacacaaatt tctcaatatc     83220
     aaaattcgat acaccactta aaagaagtga gtccagttta tacaaaattc taacctcttt     83280
     aaaagctcca aactcttttc tacgccaatg cgacctacat gaatcactag tggcttttct     83340
     ggttcgccat tactgttaat tacaaaatat taaacatcaa gattagcgtg gaaagtatca     83400
     ttgtttttaa tgcatataaa agaaacgtat attctattct tgcctcagtc ttatacgcat     83460
     ttcttgagaa cggaaacggg gattgaagct ttctgaatcg acacccttat tccaaagtcg     83520
     aagttgatta gcttcaatat atgaaaaaaa gaagaagaaa atgtaagttt tgaacaatca     83580
     tagagcttgt acaaaaatgt aatgtatgat ctttcttcac ctgcagttgc accagctgct     83640
     ataagatctt ttccaatggc agcagaagga actaatgtaa gatcagccgc tctgtgaagg     83700
     aaccctgata aaagcatatt caagtttagt ttcatattat acatcacaat aaaccagaaa     83760
     aagaagaagg aaattttgac atttgaaaag cgggttttac atacttatta tagaccacat     83820
     tggttttacc aaccaactaa aagtgtatct tgggatgtat ctgcacatca acacaagctt     83880
     aatcttagac aaaaattttt ttataacaac attgtgaaat gaggcagaaa aaggtactta     83940
     cacagggacg tgtgtgtggt aagacattac tattggtaca gatagcattt ttgctattgc     84000
     cagagcacca aagacctaaa aattttagtc agggaaaaaa gagagtcaag ttctggattc     84060
     tctccagttc actggtcttg ctaatgtttt agtaatgtga attcttgagg gatttaccat     84120
     aactccggga gatgaagcgt gtataatgtc aggcttaaac cgtgcaattt cagagatgat     84180
     tcttggacta agcgcaagcg agagtggaac cttttggtaa taaggacaag ggaagctaca     84240
     gaagagaaga agaaattagc gatattacca aatagagaac atccagtgag taaactaaat     84300
     ggtgctacct tcttgatcca atgactctgg ctccataaaa ctcttcagga acaccttcat     84360
     gtgtcgtcac gactataacc tatgaagcaa aaaagttatt aaaaaaaaaa aaaaaggaac     84420
     agttaacact tgtcaagtaa ttctaattct ggaaacagtt acttatgagc tgactgaaaa     84480
     gatacttaag ttgaagaatg agatagtaaa agaagaaacc tcgtctccca tttcacggag     84540
     gtatctaatg aaattctgga atctgttttt gtagccggat acatagctgc aacaaaatca     84600
     aagagagaat cacttccaat aataacatga catataataa aagcttttgg tcaatggatc     84660
     ggtgattccg agaatcttgg gatattcaca actaaaatct gacaactttg actcaaacaa     84720
     atcctgaatg taattggttt taacgatcta ctatataatt tgctaaattg gtggtgtagc     84780
     aaattcatac attagcgagt atctcttcat aaaataaatg taacgatcaa atcgaaagaa     84840
     aaaaacatta caggaaaaag tcaaccaagg aaaaaaatga gtagaatctg ttttcacaga     84900
     gacatttcgt cgaacacaaa acaagcaaaa aaagaacact gtgaagaaga cttacgcaaa     84960
     gggagaaggc tcaacaaaga gagcaattct cctaggctta gagagcgact caggatcgag     85020
     aagcggcgca tcaatctccg attcgtcatc ttctctgact tgagtaatag tcatatcgtt     85080
     ggacccagaa acagcttcct ttgtaatcac tccacagaag cggagcttgc ttttcttgct     85140
     aatgggtaat ctccggtgac caaacgaaag aggggaatga agaacaaaag aagaagacct     85200
     gggaggagaa caagaggttg cagaggaaga agaacaagtg ttagtcgtgc taggaagcaa     85260
     atgaggaggt atagagagat ttatagaaga aagagtcgtc atgactcctt tttattttga     85320
     cagagaagct taaattaata attatatatt tgtgaggatt tgggtgtcgt cgtcgttata     85380
     atcggatttt taacaaccgt cagagagaat ctgaagaaga cgaaagagag gtatatcctc     85440
     tttgtgaggc agagacagat aagcatccta atactcgttt tagcatatgc taaaatttat     85500
     cttttattaa tattacagaa gttatagaaa aatcgttgtt gttataatgg tttatgcata     85560
     cattaggggt ttaaacactt gagaaaacaa ttactacaaa aaaaaaaaaa acacaatcac     85620
     aataacgtac tcctgacaaa aaaaaattga ctttgtaatt atttggtcaa aatacttttc     85680
     gttacgtatc atatcattag ccgcgctaat tacttgtaga tcgatataac ataaaactca     85740
     aataattacg ccaagacaac cttatatata ttctttatat atatttatat aataattttt     85800
     tttatattgc ttataaatac aaccaaaaaa agagaaagaa atgtggaatc ggaaatctat     85860
     tccaatgaat attcgcttca cataattata aagcatcttg tcttatatta tacaacacaa     85920
     cacaacatat aaactgcttg gctgtcccat atgcatatca ttgcatgtga aagatctaac     85980
     ttcattttct cgattaccaa tattttatgg tttttaatct ttctaaagtt agaacgcaac     86040
     atacaaacgt agtgtgttcc tcggagaatt caaatcttac ataatttact caatgccaac     86100
     atgattgctt tcaatatttc tcttggttta tttgattgtt tcgacttttc taatagaaaa     86160
     tctcaagaca tgatgatgca aaaatctatt acactaaatg ccttatatgg gcccatatat     86220
     gaatggatcc taatcgggct aagttttctt tgttccttcg gcccaaagat gacgaggtac     86280
     acaaaatata tggactatga cattcgtctc aattgagatt aatgtacttc aaatgaaact     86340
     tccaaacaaa taattgagat gaacttaacc tgagttattt ggattggtta gaaaattgtt     86400
     taactgttat tacatctaat gttgaactaa agtgatattg ataagtctct ctatattcaa     86460
     acttctcatt caaattttct tgtttgacat aatcaaactt ctatatagtg tcttagtata     86520
     tatcagagcc ggcccaataa attattggac cttgtgctat gctccaaatt tctttaccta     86580
     aaactctaaa tatttaaaaa ctaaatccta ttttgcaatt atttgaaaat ttggacccta     86640
     aaatataaag aaaaaactga ataaagaagt gaaacccggt gcactagcac actcagcacc     86700
     tcccaagagc cgggcctgat atatatctca aaacttctct atatatatgc ctatgtttac     86760
     acataaagta ttataatgaa tggggaacat tgggggtagg acccctaata tttcacctaa     86820
     aaaaacaaag ctctcacaac agtgacaaga agagaatcaa cctttttttt ttttttgtct     86880
     tattgattta tttcatcata catatgagaa tttatctacc taattactta tattgttatt     86940
     gttgaatctt cgacttcaaa cctagattta ttccaagtac tcaatttact cttttacttc     87000
     aaaccttttt ccttgtcttt tcttttgact ataattttgg ttttacaaat cgcatcatct     87060
     tcgtagaaat tctacaagct ataatggaaa aaaatcaaga atcaattaaa caaatctaga     87120
     tattggaaac catttcatat caattggtta aataacttac gtgtagttgt acatgtataa     87180
     acaagtaact tgttcaaatt tccttcctta ataaaattcc tccccaaaca ttatacatga     87240
     cttgccccca taaataaatc ttcaaaatcc ctcacgtctc cattttgttt ctctttttct     87300
     ctctgtctct ctctcgataa agtttcagac aagaatatgt ctcgaagagc atccaaaaga     87360
     gtacgcttta gtccggaccc agaagcaaac gacgaactga tcttcccaac acacagctca     87420
     tcacggcatg gtcgcaggag ggtcgttgtt ggaatattca gtttcagctt cagtgactcg     87480
     ccggcaacga cgaagagatt actccgcagt attggagaca gagttggcaa aacgtttcgt     87540
     tatatatcat tcggcaggat gaacaccaaa acgacaccgt catcttccag taacgtttct     87600
     tcgtctcttt atttgatgaa gtcaaagtct ctaaacggat cagagtctca ccgtgcagaa     87660
     gccattgagg actgcattga gttcttaaac tcttgctctt ctttgtcgag atcaaactcg     87720
     atctctacct ggtctcgcta aacgattttt attgtttcct ttgtaatgta aaagagttga     87780
     cactgagagt tgcataggtg atcagttgat taaagtctta tgtttatcga ttcaattatt     87840
     caactagcta gtgactacta aaagttataa ttcctcaaat cttaatccat tttttttttt     87900
     caagtttcgt tacaaactaa aaacgaaaaa cgaagtgggc caatttagaa ttcaaaaaga     87960
     agggtcgaaa tcaaaggacc ataagactga aaaagcttct tcttttgttg acccaatatt     88020
     tgatttcttc ctagcagtat taaacaaaag taataatata atctcttatt ctataaaaaa     88080
     tataacctca tcataacaaa aacattaagc gttatagaaa ttgtaggtcc ctgaatatat     88140
     cattacgaca ggctacagaa tccaatgaaa agtttgttcc tttttctttt ttggtatcac     88200
     cttcttcaag agttgaagct ttgtgctgaa gctttcttga gctcaagagc tcgtttataa     88260
     ggcggtgcga tcggaggttg aatcgggtcc aaactctggt atgatgatcc atctgcttct     88320
     ctagggagtg ggtaagaccg gtctgagtca taaccggtta agtcaccaca tgccaagaat     88380
     ggtatataaa ctttgttggg tccttcaagc caaccactac tgcaatctgc agagtaccaa     88440
     gaaaatacaa aatctcaagc acaataataa cgcaaaaaaa aaaagaggtt aaaatattct     88500
     ctttctgaat ctgacataat aatacttaag aagatttctt tgtcttgccc aaaaggttaa     88560
     cttcacatga agagagagca ttttttaggt gagagttagg ttgaggaaga gtaaattgaa     88620
     agtgtactac tcaacaatgc ataagttagt tgtgtctaac tagaagagct tcagaatttt     88680
     gaagctgaag ccaagagatt tttaccgaga tcgcttccac ctgaagggct tccgactttc     88740
     tccaagagac gatgcagatc tctcgggtta aatccttctg gcggagagta attctcgcag     88800
     actgcaaaag cctctataga aacagagtgg agaacatgta atcagaatct cttttaaaaa     88860
     gcaacattta cgtctttgat gattaaacct tgagtaagca aatcatattt gcacatgtga     88920
     aagttctatt cttttaccta tacttgaatt gcggctgctt ttcggtttcg caaaagttac     88980
     ggttgggaaa aacaatttca gctacaaata aaaggaaata aacttatcag taaaaacaac     89040
     agttaatttc atcagcaaaa catctaaact tacttgacag tagagagtac tgagtagaga     89100
     cttgtatcta acttgacagt aaatttcatg agcacaacat gtaaacttac ttgacagtac     89160
     aagagacttg tatcttttcc acggaatatc tttgcaataa attttccacc ttctttaaga     89220
     atatgagtta caatcgttaa tccctggaaa aaaaacggat tgtttgttat tgtcattatt     89280
     catgaaaata tgcttcaaat tagtgctaaa ttttgttcaa acatgacata tcgatcatgt     89340
     atatacatag atataagaaa cttactgcta gtatgagttg ggactggaca aattcatcca     89400
     tgtcatgcaa accagtaact gcaaaccaaa ttgtaaaagg cgttttttat agcataacgt     89460
     atatattgaa cggcgagaca gacactttat ctactgtttt accatctgga gcaccatcac     89520
     agacaaccag gtccgctttg cagccgtcaa agtgtctaat gaccttgaaa aaaaacaccg     89580
     gaaaaggtaa gccatggaaa caaacacaaa cttgaagcat aattaaagag gaagaaagag     89640
     atgtagaaaa atttatgaga taggagtcga gaaattttac cacttcagca gtccgagcat     89700
     tagttatgtc cccttgaacc tggatgacac cttcaattgg agccataggc tgcaaatcga     89760
     tggctactat aagaggaaga tccccatctc tgcatagtgt ttcaacagta acaaatcagt     89820
     tcaaccttgt caaatagtgg attactaact agcagattaa aacaactaaa gaaaaacgat     89880
     ggtggaagag aaacttactt tgactcagct gaggactttg caggaagata taattgacga     89940
     ctcaagacct acaaatgcag tgcactgata aaattcaaaa cgtgtttctc tttaactttt     90000
     ccactgggaa ccgaggatca accaaacaaa gaacttcaga gattaatttt acagcatccc     90060
     tgctctctca actcaatttc ccaatgctta tcatcttctg tttaccatat ttaactcctc     90120
     ccactctaca ttaaacaagc taagttttgt cggttagcta actgagattg caactcaact     90180
     ataatcctat acaaaaagat ccacacagtt atgaaatata gcctgaaaat ctaaaagatg     90240
     ggatctagtt ccagctatag actttttaaa cggattcttc tttcttctat gagagatcta     90300
     ctaagtgact aagccaattt acattgtgca gaatgtgagt agtaacaacc taggatcacc     90360
     atacctgact ccagctacca ggtgcagcac ataaatctac gaccctcttc acacctgcat     90420
     ataattaaga caaagtcggt gagttatacg tctatcaaaa gtattgcatt cattcaatta     90480
     agcaggtttt tggactcatg tcccgtgatt aggcttgagt ctgtgaatga gggttcatat     90540
     gagagataag attaaggatt caagagacca ccttcaaaaa tattaaattc ttcatcaatc     90600
     tgaagaagct taaaagcact tcttgcacgc catccttctt ctttagcttt acgataatag     90660
     atatcctgca accaattggt ggaggaacag ttaagaactc acgagtataa ttctgagaaa     90720
     tgcgcacctt ttacataaag ctctaagaac ctcattcaag gcatacatac ccttttgtct     90780
     cgagaagctt ttcccatggc ctctaaagta gaatacggag ttggttcact gcgatgaaca     90840
     ctaaaagtca gcgaaaactg aagggacaga gataagttaa gccactagtg tgtctcagag     90900
     gcattctatc aaacacatta agtgcacaac aaaaatatct gcaaggtaga aaatttcgag     90960
     attaaatcga tatacaagaa gaagacccgc caaattaccg tatagtatac agcagctagg     91020
     tatgtgaaga agagtagcac caaagtagaa attcaaggta gagccaagtg aagaagactg     91080
     tgtgagagaa caaaaaccga ttcttcttat ttttcttttg atctgtgccc taacaatttg     91140
     gaagatgacg aaatagagtt attgggcttg agaccaagtt cttttgggtc acatattagg     91200
     cccaagtatt tattaatgga attttcgaga ccaataagta aaacatgtcc gtatccaaat     91260
     aaaacaaaca ttcggccatg taaattctga cgaacattta gtgtaattat tgtatcgaaa     91320
     tttttattaa aaatataatt gattttttgt ctttttacaa aaaaagcagt cgattcctaa     91380
     cacaataatt acacatccca agggcattgg gttcgaatct tgttaaggaa aatcaaatca     91440
     actgattgat ttcatatatg gattgtcacc tgtacgttat gattataaac agtcattaaa     91500
     ccactctaat ggcaaatatt ctccattgaa aaacaagaac tggattatct ttttctgtta     91560
     atttacaaaa cggaaaacaa aaaaatgatt atgaaataca ataaccatta taaaaactag     91620
     gttaaatatt gtaaggtttg gagtgaaact gagcatgcat aaaatctttg aaagtaataa     91680
     tgaagaaata gattgctttc aatgaattga taaggcaaca atatgaatgg tcggtcgatc     91740
     taatgtaatg gtctcacttc acagttcaca caactatctg tatatccctt agacgtttgt     91800
     cttgtctccc acccactttt tttttttttt ttttaaatca taatcttctt ctcaagattt     91860
     ccctactcat ggatctcttg ttttgttttc atcccttaaa taatttccaa aaatggtgac     91920
     cactatcaat gtgtaatttc cccactaatg tactgaataa ttgatagaga aaaaatcgct     91980
     aaactatagt acaagtatga aaagcaaaac atttttaata cgatcaaact gttataattt     92040
     gtactatatc tcaatagtaa atattaaatt ctaatagaaa tgagtgagtt taaaatattc     92100
     atatcatatg ctactcccga taataaagta gtaaattcca agtgaaacat aaaaaataaa     92160
     atctagttga atcgaagaat caaattcaga gggatcagaa ctggaaagct gctgattcaa     92220
     caagtctcgg tccatttgaa aagacccaaa ggcatcaaag tccattactt attctgtgtt     92280
     tgttaaaacg cactaaaagc ccattaataa agtatgttct ttttcctaat gtaattatgc     92340
     aaaaaaatgg ttcatacata atacattcgt aaccatgacg acactgaata aaaatgttct     92400
     ttttgtatcc aattcagttt ttgacactaa aaagaactac aatagtattc tctttgacga     92460
     atcaaagact gcaaaagtcg tgaacaaata tttaacaaaa attttattat aaattagacc     92520
     aagtgatgat gataggaaag atgattgtgg attgtaggac aatccgacgg tgcagagatg     92580
     gcgagtgcac ggagaatcaa tggatgcacg cgtagaagaa cattggcgcg tagggtcaag     92640
     ggcttgatga cgcgcgtggg gggtttgctt taaacgcgtg aagaaggttt aattcccaca     92700
     aaatggctcg gctcaaggct caagccgacg gtatattaca ctgtcactct cactcccatc     92760
     tcttccgttt aactgttctt tcttttcttt tagggaataa gaaaatcttt ataaatgata     92820
     aaatatgtta tcgaaagaaa gaacaatgtg cactgagata tttaccaaca aaacaaaaca     92880
     atataaatac actaaaaact ctaagaaaag ttacttatta ttagctatgt gttttgtgta     92940
     ttaatgtata atcaaaatat tataatgcta gaaagtttgg tatagtgacc actgtgaagg     93000
     taacaaatag taatataatt tgtgttcaaa atcaaaactg gatacccaaa atttatgtgt     93060
     gtcatcataa gttacaaatc aaaatggtaa acccacaaaa gaaaacacac taagtttaat     93120
     tagagaggtc taaatgatgt gggaatcata gagaaggcag gtaaaaagaa atgaagaaaa     93180
     agcttcctgc ttttatgctc tctctctctc tctttcattg aacatgtata attataacaa     93240
     aggcggccgc attaaaagta aaaaacagaa cattttttta agtagacttc gttattacag     93300
     tactctccta ctcacttgcc attgttatta cataaccaga gagctcttct tcactctttt     93360
     cctctctctc cctccctccc tcttccatta aatctttgtg gttctctttt attgttttga     93420
     tactgtgctc tgcttcggag agtgtagaaa gagacagagc taaagtctct gtgtttcttc     93480
     tcagcaggac taaaaggaaa aaagggtaag agcttggaga caatttttct tccttcataa     93540
     gattctctct ttttaaacca taaaaaatca aaagattgta acttttcaat tatttgtttg     93600
     ctttatataa ttatctttgt gtaccgtaca gaaatcgatt gctaatgtcg ggtgagaaac     93660
     aagcggagga gtcaatagta gtctccgggg aggatgaggt ggccggtaga aaagtggaag     93720
     attcagcggc ggaggaggat attgacggca acgggggcaa tggatttagt atgaagagct     93780
     tcctctggca tggcgggtcc gcttgggacg cctggtttag ctgtgcatca aatcaagtaa     93840
     gtacaatttc gataatgaat aattcatcta gtagtaatat ttactataag aaaacaaatg     93900
     tttctttatt ataataagac caaattactc ttttttcgtc tgtcctaaag ttttttttta     93960
     atattctttc ataaaacatt cttgaaataa ataacaactt aagttataaa aacaaaaata     94020
     tatggttgca ggtggcacaa gtgctgttga cgctgccgta ttcgttctcg cagttgggaa     94080
     tgttatcagg aatattgctt caaatattct atgggttaat gggatcttgg actgcttatc     94140
     tcatcagtgt tctttacgtc gagtatcgtg cccgtatgga gaaacaagaa gccaaatcct     94200
     tcaaaaacca cgttattcaa gtaaattctt ccttatttta gtttagtgac atattcgaat     94260
     ttgatctcac ttttagattt actaaattga attgcatgtt tgttttgttt tcttaacaca     94320
     aaaaaaataa aataaaaaaa tgggaagtgg tttgaagtgc ttgatgggct gctgggtccg     94380
     tactggaaag cagcggggct cgcatttaat tgcaccttct tgttattcgg atcagtcatc     94440
     cagctcattg cttgtgctag gtacttcttc ctctcttttt tattactttt taccaatctt     94500
     tttaatagta tattgatata gagggacaaa tacatatatc taaatgatac catcaattga     94560
     ttcatgtgtg tgttgttgtt gggatgatgc agcaatatat attacataaa cgataggtta     94620
     gacaagagga catggactta tatatttggg gcttgctgtg ccacgaccgt tttcatacca     94680
     tctttccaca attaccgtat ttggtctttc ctcggccttg gcatgaccac ctacaccgct     94740
     tggtacctca ccatcgcctc ttttctccat ggtcaggtat gtcctcatca aaatcaaatg     94800
     atttaaatga agaaaaaaca atgtgactta aaccggttgt aacttactgg tttgtaggcg     94860
     gagggtgtga cacattccgg tccaaccaag cttgtgttgt actttaccgg agccaccaac     94920
     atcctctata ccttcggtgg acacgctgtg accgtgtaag tatttttaat atttctcatg     94980
     gattttcaat taattgtata atccacaaca attggaaaag tgatgcattc ctaacaaact     95040
     aattatagtt ggatataagt tataatttct tctccatata cagcatttgt tgtgttgcaa     95100
     tttgcaaata ttaaaaaaaa aaatgaattt tccctgaaga tttatgtttc cttcttcttt     95160
     tttaaagact catctctttt agcttctata tgtgcagctt ttgccggtta ctttaggttc     95220
     tgtcctaaac gcacaaacag acaaaatcat tattacggaa taaataaaga caaatttacc     95280
     agaaaaattc tatttacctt tttaacacac actatagcta ctagctactg aactcaattc     95340
     ctaacattct ttttatttta gtaaatttta ctcacaaata tctatctcat cttcgagagt     95400
     acgactacgt aacgtaacca cagtggtcgg acccggacgg ccaatctctg gtcggaccca     95460
     taaatccact gtaaaagact tttatgccat ttccttttac attttatcta taaaaaaagt     95520
     tataaaattt tcagggaaat aatgcatgcg atgtggaaac caaggaagtt taagagcatc     95580
     tacttgatgg caactctgta cgtcttcaca ttaacgcttc cgtcagcctc cgccgtctac     95640
     tgggctttcg gcgaccaact tctcaaccac tcaaacgctt tctctctcct ccctaaaacg     95700
     cgtttccgtg acaccgccgt tatcctcatg ctcatccatc aggttcctat catcctaact     95760
     ctcactatgt tacatgtctc acaataatta cactatgcca ttaatgattg gtccaagtta     95820
     catgctatta tttatacggt accggtccat actaagaaca ttattctctt tcgcaatgaa     95880
     attcatactc ataaggaatc ttgttatagt ttatgacatg gataaatacg tctaactagt     95940
     taattaacat ttttcgccgt attaacatct agggcgaatg atatatatgt atgaatacaa     96000
     atgttatcgg attatatatt ctttctcaaa attttgtttt ggatttacag tttataacgt     96060
     tcgggtttgc gtgtacacca ttgtacttcg tatgggaaaa agcgatcgga atgcaccaca     96120
     caaagagctt atgtctaaga gcgctggtga ggctaccggt ggtggttccg atatggtttt     96180
     tggcaatcat ctttcccttt ttcgggccaa taaactcggc agttggagcc ttacttgtta     96240
     ccttcaccgt ctatatcatc cctgccttag cccacatgct cacgtaccgc accgcctctg     96300
     cccgccgggt acctacattc ttctctcgct cacattacca ttcctaaact atactaaaga     96360
     ttttatgaat tcagtagatg acatacattt atttcattta gatagatagt tttgtaaaaa     96420
     aaattattgg aggagagaga taaagatata catacgttgg tccatagtat ataatgagct     96480
     ggcttataat acttttgcat ttaatcacat atcaatgggg taggtccata gtatataatg     96540
     tgtccattat tgtcacttga ctagttttat aaatgtctat aacatatatt ctcgtcgatg     96600
     attaaaataa gtagattagt tcatgcaatg atatgatacg atgtattgat ttggcttttt     96660
     ttctttaaac gtgatggcgt ggcagaacgc ggcggagaaa ccaccgtttt ttatccctag     96720
     ctgggctgga gtttacgtga taaacgcttt catagtggtt tgggtcctag ttctcgggtt     96780
     cgggtttggc ggatgggcca gtatgaccaa cttcatcagg caaattgata cttttggcct     96840
     ctttgccaaa tgctaccaat gcaaaccacc tccagctccg atcgccgccg gagctcacca     96900
     ccgccgttag ttaacgtaag cgacgtgtga tagtgtgatt gaaccctttt ttctttaatt     96960
     ctgtatgaaa gaaaatatct gtaattcagt gatttagtga atctatgcta taaaatttcg     97020
     ttgaagtcac gtacgtgatt agggagctgg tgctgttttg tgttgtcacg tgccagtctt     97080
     cagttttatg acagactaat aggtcttcct aactggtaga aaacaactgg gtgaggacaa     97140
     aatggttttc atttttatca atcagccaat ctgtcatatt tgactccgag aggacaatac     97200
     aaacattttg tataaccatt ttaatcaatc caactttcga attaatgtaa aacctagcag     97260
     gctatatcgg cccaatataa gaccagacca aaatagtggg gttgatatct tattgtgaag     97320
     gtttctttgc ttcgtgttta attttattga gaatttatta ttctgttttt aaaatgaatt     97380
     aaagtattaa atctatatta cataaaatca tgttgagctt cgaatatcaa aatttacaga     97440
     tcaactaaga acaatatgct taatcgcagt tttcgacgtt tttaaaattt taatatttaa     97500
     actaatcttt aaaagtaata atgaaattaa gatggtttta gttattttaa cattattttc     97560
     ttaaggttcg gtggtaaaaa ctcaacggct agtcagatgg ttcgggtaag actttccatt     97620
     tttctgtgac gtctttggtt ttgccacgtg tattctcagt tgctgttaaa cccaaccaaa     97680
     attagtgggg cttaatgtct tattgtgtac ctgaaggttt tgcttcttat ttacaacaaa     97740
     gttatctaca gtgtgtgtga ttaatggaac aaattcaaac aatagactat gatgatacag     97800
     aactaatttc acagattatg caatgctctg aaaccagttt ccacatggca cttccttgtt     97860
     caatttcgta tttcctgcta aacttattcc acagatgcaa accataacca ttcctctgca     97920
     tatgaagaag cttggttttg acccatttcg aatctttctc tgttttaggc actttgaaca     97980
     acttcttaat ctcgagccag tttaccgaat agaacacaga tggtcgcatg acggtgaagt     98040
     tatagccact tgatccttct acagctctag ccactcgtga aacaaggtat ggtccgttgt     98100
     atccccatat gtttccgttg aaagttttag cgaactcttc catgaatttg agtaacagag     98160
     gatggttctt gtcgaatatt agtaccgcgt tgtttagtct tgtccaattc gttgatgaag     98220
     gatcaagtgt ttgtgcacca atcacgtttc tcagaccttt gaagcttttt agaacaatca     98280
     tgtctgtgtc taagtacaca cctccatatt tgtacaagta agcaagcctc atgagatttg     98340
     agagattctg agctaaagaa atctttccgg gatctctttt accgctcttt atttcgtcga     98400
     gccacaactc tcccgcggtt cctttgagca gaaaaggcaa atctggtgtg actgcaagaa     98460
     ctttgtaacc acgatcaata aacggcttca aagttgcata accttgagga gaatccatgg     98520
     ttgcggataa gatcatcaag caaccatacg gatgagactt aaagacactt tcaatagcta     98580
     aaacctctct attgccaaag aaatctgctg gtgatatcca tgtcatgacg aagttgactt     98640
     cgcatccatc accgacaaac tcatttaccc tcttttgaaa cttgtcagac aagttatctc     98700
     cactgaaaac ttcgataact tggagcttct cgtttacttg tgtctgttgt ttgagcagat     98760
     cacttctttc accttctctc tcagaactca gaggtaagtg tggaatcact ctcttgatct     98820
     ctatcttcac tcctgagaaa tctctatgcg gttgcatcga gaaattagaa attagagtaa     98880
     acgtggtaac cacgatcaga gttacaaagc tgatagcgaa ggcggtgaaa agtgatgatg     98940
     atcctgattg gtttagtcgt ctgttatcaa tcaccaccgt gaatctcttt tctatatcat     99000
     gacgatccat aataaacaca gaactgaaat gttctgaagt tggaaaccag aaaagaaaag     99060
     gagatttaga ttgataagaa agaaaccact tttgagtttc tctgtgtctg ttttatttct     99120
     tgtttaactt gttttgacca cgttcttgtc tttgggggct gtctagtttt gaaaagttaa     99180
     agaactcaga catagacatt tttgacgtat taccgaaata attaatattg atgaaacgaa     99240
     taatgggaaa ataagtaatt tcaaatttct aacaacacat atatttaaag ttttaaaagg     99300
     attctttttc attcatccta aatggaaatg ttctaaatat atattttttt ggtttaatgt     99360
     gaatctaaat gttctaaaca gctaataata tttttgttct tttcaattat ttggggttat     99420
     catcacatat tttgtagaat tctctagtca tacccttaat agtactacac taaccaaaaa     99480
     ctgtttcata tgaaaacttg tacatacttt atttgtcatt ctttattact aacattttct     99540
     attattgcct tattggtcaa ctttttggct aacacggaac ataataacta aagttcgatg     99600
     tgtattcttc ttacgaaaat actgatttat atcgtattga tatttctgtt tgaactctta     99660
     atcaatgata agtgttaata tattgttatt tggttgatgc aaaatgatat ttggaaaaag     99720
     acgtgtgtgt attaaaatcc aaattatcaa tgactcattg tatttcaatc tctaggcttt     99780
     ctagtttcta gctttgataa ggttcttatt ttattataat actatttaaa caatgttagt     99840
     tggattttaa tattattttg aatgaaaaac cctgctattt tacggttgac taattaagaa     99900
     atataaaata ttaagacatt tgaactatgc aataacgaca aaaatatgta aactcgaata     99960
     gatagaattg gttggctgga ttttggttta gctccaaatt cagttttcac tattagatcc    100020
     ttaatgttta ctataggtta gaataagatg aattgtgaat tagtaaatga atgtatagaa    100080
     tataatatat gtattttatt ggttctataa ggcatgatta gggttatctt tgtttatctt    100140
     tatattggaa acttgattgg tccatgcata atcagtttcc tccacacgac ttgtcaaagc    100200
     tatgtaagca ttttgaccgt aacaactgaa agcaccttat agaattaaat tatatatgta    100260
     tcacattact ttaaatctca ttactgtaga ttgataatat cagctcaaca acaactagag    100320
     aaatgcaact tatgcagcag tataagtttg ttgtattgtt cctccgatcc ttccaagttc    100380
     caagcctatt cattgacata gacaacgttt ctaaagctaa tgaaagattg catataaact    100440
     ttgtgtaaga tccaccaaag tcaaaattaa tggcaatgga tcataatttg gcccatgggc    100500
     tttaagtgaa ttatatggaa tgatctaatg acatttatgc ccctaaggtt ttgaccgtca    100560
     cgcagaaacc aaggagttag ttccaatcac gtgggaaaca atcgcgtaaa tcggacggta    100620
     gaaattaaat gcgggtgagc accgagctgt gagtataaga gaattccaat gttcagacaa    100680
     ttgccacgtg gacttatgct ttgctttcgt ttccacacag tacattgctc ccttcccact    100740
     cacacaaacc aaaaaccaaa aactcttctt cttctgatga aagatgattg gcattggaag    100800
     aaccctaact tcttcttctc catctaagat cattctcgaa gatcttcctc ctggaattta    100860
     tcgctatgga acagagatat tcacttccgt tcccaggaaa acgttccatc acatcaagtt    100920
     tttgcgtttg gattctgctc agagcagcag gattcttaag ccggtcccgc ttcgttcttc    100980
     gtcgattaag gattcgcagg taattaatca cacctctctt tctgtctttc acgtgtaatc    101040
     gtttctctgt aattcctatt tgctctgttt acgacgaaga atgagattca ggtttgttca    101100
     tacattttga taggtaaacg tagaagatga agaaatcgaa gcttctaaca aaacagttcg    101160
     tgtaaggttc cagttgcgga aagaatgtgt ctttggggaa cattttttca ttgttggtga    101220
     tgatcctgtg ttcggtggcc tttgggatcc agaaactgcc ttaccactga actggtctga    101280
     tggcaatgtt tggactgtag atttggtata aatgagtgaa tttctttttc tttaagagtt    101340
     taaaatactg aatgtgttag gtttaccctg atgttgcttt ctttctgctc aggatttgcc    101400
     tgttggaaga ttggttgaat ttaagctttt attgaaggca cagacagggg agattttgtg    101460
     gcaaccaggt ccaaaccggg ctcttgaaac ctgggaaact aacaaaacta tcagaatatg    101520
     tgaagactgg gataatgctg atcttcaaat gatgattgag gaagattttg tgccttacac    101580
     caatatttcg tcgatcggtt cagaagatga ggatgaagtg cttggtagtg tacaacaaaa    101640
     ctcttcagta gtagctgtag agaatgcagg atacgtgagt gatgagtctg cccagaattc    101700
     gagtttcagt atccaaagtg agaaaactat ggaaccttcg aatggagctt tgactgctcg    101760
     ggaggtgatc aaagaagcca tgtttactga ggaagaaagt ccagttttgg ttcctggatt    101820
     gattcctctg tctgacttgg ataatgaaca agtggaagtt attaatgaag gtaaagcaga    101880
     aacgttcccg gaggtaataa cctgatcagt tttgaagttt tatgttcctg tttttctata    101940
     aaaaccttaa gagctgttgt tatgcacact gctgctgatg gtaatgaaat ctttgcatgt    102000
     ggattattga tgctttaaga catcatgttt gtgtgtagaa taagactatg cttgtccact    102060
     ggttcaatgt atattgttac cccagttcat gataaaagtt tccttcacta tattgactat    102120
     tcttgtccac tggtacaatg catatctaac tgttaaatta ttttccagca atgtgatttt    102180
     cggctgcaaa tgcccttctt gtgctatttg caggtagata agaagcaaga acccaaagca    102240
     gaaagaaaca agaaagcaaa agtaaaagcg atttcattat tcgagaaatc ggagcaagaa    102300
     gcagtgaaaa gtgtagagca gaggcaatac aatgcagtag aggaagagca gcagcggcta    102360
     gagacagagc cgcttggaac gccggatgtg ctttttgaga atgatatcca atggggacgc    102420
     agaacacttt acaagcttct aagcaacttt agacttttct aaactcgact aagttttgag    102480
     tgcatacata catcggcaaa agagcctcaa gagtcaagaa gatgtttccg acagatagtc    102540
     aaaaactgct cttaaaaggt aggctacctt cttcttctat gctcatcttt acgttttgta    102600
     tctatgagaa ctgggagtag attgaaacca atgttgtgtt gtctttgtat atatgtaatg    102660
     atcaaatggt tttggtaaag agaaagatga agaaagaatg gactgttagt gttagctgtt    102720
     aagtacatag gacagtatgt agcatctgga tcctattctc ccatataatt gtattgttgc    102780
     tacataataa tgatgatgat gatgatgatt atcttatgat tgaacttaca attccaatgt    102840
     cttacataat gatgatgatc atgattaaac atatcaataa tttagttgta cattttttaa    102900
     tggtttatca agtttggacc tttggtgctg ctcttgacga agggccaggt aattgctgac    102960
     gccgtacgtt taggagcacc tcgttttttt caccttgtca tatatttgta aatctcgatg    103020
     accatatgct tttattttta tcccaatata atcgaaaaat cccaaatgat atgcgatttc    103080
     ttgttgtatg atttacacac aacatgagat gcaataatgt tagtgggcac tgggcaggag    103140
     gaaatgcgat aaagttaata aaattgtgac aaaaacgtaa ggtgataaac taaagggttc    103200
     ttaatcaaaa actacataaa tcccttctaa ctaatccaca tgctggtttt taagaaccac    103260
     aacaacaaaa aaaactatca acttagacta caaatataca atcactatac acaagacaaa    103320
     gcctaattga ggtggagcct tgggtgcaag gtttcatact cactttctca aaactctaga    103380
     aaccaaaaca gcaagagtca tgagactagc tccctgagga ataggccatc ttttcatcaa    103440
     aaagtctctt atttgggaca ctttgttacc ttttttgatc tttgcttatt ttctcacatt    103500
     ggtaatgaat atataccgta tgtcttcttc cccacaatca catctctctt tcgacctaaa    103560
     ttttgcattt ctgcaaaact cacaactctg aaatgttttc tttaggcgct tcctcttcaa    103620
     gtcctttgtt tgatacatct tcactgcttt cccacaaaaa tccattatca ttttccggac    103680
     ctttctctgt ttctctagct agaggtgcca catgtgcaac atacttttct gcacaaagca    103740
     acacaaagaa gatttaccaa tctgtaacca aatttgctca ctacacaaaa gactaagaac    103800
     aatctgcaga cttaatcaag tggtgaaata gatccacagt tattaattcc cctagaagaa    103860
     actttaccag ccaaacttcg aagagcattc tcagccgctt gttgatgtgc atctttctta    103920
     gtttttgcca tcccaatgcc tatcttctca cccgtgaaca acacctttgt aaaattaaca    103980
     acaacgatta aaaacaaata taagtaaagc taacaataga caaagatgct tcaataaact    104040
     gatccagctg acctcaactg aaaactgtaa ctctttgttg gtacttatca cagtcctaaa    104100
     ctccacctgc aaaatcgtac atcaattaat cagaatccat taaaagagaa gaagcaatgg    104160
     cttgcgtggt tagtgaatat gcacctttga accacatctt cttccaattt cttgcagtgc    104220
     actcacaaat aaatgagatt gcccgccatt actctttcca ccatctgtat gatgttctct    104280
     accatttgac accaaatgat tctgggatat tccaccttct gcaaatagtt taaacaagtg    104340
     ccaatgttaa aaaggtatta atgcacctta ttattcaagt agctgttaca gattcagtag    104400
     aaagacaata catcagatag ggaaaccaac aattctctaa tcctaagtca atatctaatg    104460
     tagctttaga gcggtacact gaaaacaagc ttcacggagg aaacaagaaa ttcagggata    104520
     gactaatcat ctttaatatc agcttgattg cattagtgtt gaaactagaa catacctgtt    104580
     gtttgacgtg aaggattttg ccttttcagg tcatcatcca ttgctacctg caagaaaact    104640
     atcagaccgt agacaacata ctttgatgtc aaaagagaga cacttagaac gcaaaactaa    104700
     cctcttcact cctcaagtgg gatggatgtg caaatggacc aacaggagca gaacctggtg    104760
     ttccatgagg aaattgactt ggataaagtc ctgaaggccg accaggaaaa gaaggtctat    104820
     tctcatcatc taccaaccaa ccacccggag aatgcataga cgaggaaggt ggctgcatag    104880
     gaattttagc cagaatgggg ggttgattaa agttttggtt ccttatatct acaccaggcc    104940
     tcatcataag gggtcttcca ccatcagaaa aagtgaagcc atcccgccta ggagctccaa    105000
     gcaaactagg ttctagattg tgattgaaga caagagatag agaacgtcag agacaaacat    105060
     atacgtgcaa aataactgta cagttcaaaa tttaaagtta tattaagtca aaagtttgta    105120
     ctatgagaag gtaacagtgc tgctgcagtt gccgtgcttg cattatttgg tataactgct    105180
     atctgcggct taggggtttc aggtttctgc tcagcgttac ttgttgcagg aagagtagaa    105240
     tgatcagctg cagccttctc atcccagaaa ttgaaaagtc aacagaaatc aaattacaac    105300
     tgacacaaaa gctatgcacc aaaacatatt ttagttaatt aatcccaaat tttgtatata    105360
     ttttactaac cgcttggttt agtcttcgtt ccacttcacc cccacacatt ccttcgttaa    105420
     ttggaggagc atttatgttt ccatttgaag caaagccagg atcctacaga cagatatagc    105480
     tagattacat attgtagttg gggcaaatta gcaatatgtt aacaatgata aagttctaac    105540
     tacagttacc tctataacga cgtagttgct cacatccggt gatggaggta aattttccac    105600
     atcatcttca tagtaaacca aagatatact actcattaaa ctctcatcaa attccctgcc    105660
     ataaaagtct agaaacagta agaacaacca gcatgaattc attacataaa aataaaaaaa    105720
     aaacataatt tttttttcca acttacttga aaaagtaacc tctgacattg catgcaacat    105780
     ttcttgctac gcagagatgt ggaacgacaa gggctgtctg ataaatgggc atacgaaaat    105840
     ggttagatac ccacttggaa aattaagtga tacagaattt aattcacaac taaatgcaag    105900
     agcaaccaca tgcctctgct tgtggagcat aataaggaag atatgcagaa acaacatgaa    105960
     cccgtggttg atccttgtcc tcccaaacct tcatacggtc atcaatgacc attgccattt    106020
     tcgggtggca aatgccacca ttgaagacac ttaacaacga tttcttggcg tctgatatgc    106080
     aaagagcaag acataaaaaa attgttagtt cgagtttcag agagagacag agacagatag    106140
     ttgggtaaaa aatgatcagg ttcatctctt aatactaaaa actgagaggt cggcaaatca    106200
     atcaggcacg atagagggag ggagaagagg cacattatat taaacaattc accacaaaaa    106260
     gagtaatgaa agctacacta atggagcatg gtggctatgt accaaaacca agatcaaggg    106320
     tatcaaagaa gccagagttg gttttgacct ggttttacgc agacgatacg atctcgaagc    106380
     tccttgagac ttatcaagtg tgcttccgga tcaagcagtc tccacatttc cagagcataa    106440
     tccctttcag ccatggtaca aacgtaaact tcaaaacgtt tcctagtttt ggctgtcaaa    106500
     taacttctta actcctccca tgctggtctc agttttacaa gcacactagt gtcacggatc    106560
     tgcatcagca ataacttggt ttcagttcca acaatattaa agctaaatca ctcaaatata    106620
     cttaagcgac cttatcctat cacatgccag agaaggtaaa tccaaagcat caaataagat    106680
     gaaatgaata aatatccagc cacaacagag atgaatcttc taacctctgg cttaatccga    106740
     gtaagcacag tattcttctc cggcaatcta atcacgggtc tacaaacttt ctcttgtcca    106800
     tcagaagttg ggcggacttc ctcaggttga gcctttaaca aaactccgtt atcaaaagca    106860
     tagtcattat caatatactg cttcagcagc atcctatcat ccatatacct tttaagttct    106920
     gctgacatcc cattaatcct cacaggatcc atctcacgtg aaatccaaga tttaagagcc    106980
     tcgattctat cctcaaatga cttcatagta tttgcaacaa tcaaagtctc atccaaatca    107040
     aacacaatag acaaacaccg agtattaagc atccttaagc acgaatcata aagacctgaa    107100
     ggaaccgaaa aacaccaaaa acacgggaac ttcttctcct tactcggcat cgccactaaa    107160
     tgaatctcct catctccgag cataaccact gcagtctgta ttcacaaaat caaactagtg    107220
     aatcactcct aacaattgga aaacatccaa aatcagctaa atgtcatttc ggaaatctca    107280
     aacctacctt caattcatgg aaacagactg cgtgtagatg cattaactct tgagatttca    107340
     ccggagccga tgactcaagc ttgcatcgaa cggcaaaaga agcaatcgtc tgaagaatcg    107400
     cgagcggagg acatctctca ccagccggag atagatggtg gattcgaatc tcatcgttcg    107460
     ggaatcgaaa ttcatgactt gaagatacat ggttcacatc aagttccccc aaacgtaaat    107520
     ctccgtgata aaccacggat ttatgaccca aacgattcat cgtgaattcg ttcaattcac    107580
     acttctgaag gacgaatcag gtagtgaaga taaacagttt ctgggaaaat gcgtgagaga    107640
     atctgcagat tcaatttctc tcaaacttcg ctacttttct ctgtgatttt tctccgcaaa    107700
     tgagggtttt tctgggtctc cttaaacatg agaaccaaag taggctcaga tatatattta    107760
     taggcgagag aagcgtttta ttgttacgac atcgatttta atgtaaatta cgagaaaacc    107820
     tgagacttct ttacacgtgg cgtcagatgc attatcctgt tttcaccaac atcgcttgtc    107880
     agccgtcaat taccgttcct aacaaaataa aatattcgag aattattttt tgtgtgtatg    107940
     acgaaatcgg attaggtcga taattttggt tgacttcgaa caaatggata gttaatgttt    108000
     acaactatat attgtaaaat gtggaaacgt attcaataac ttactttaga agtaaataaa    108060
     aattgtgaaa aaaaaacgga agaggatata tatatggtaa aatcacaaaa atcaaataag    108120
     aacataaagt tggttggcaa aaaaagagaa gacatcaagt tgcgagtctt gtgacgtttg    108180
     agtaagaaag ggacaaatca attttataca atctgtatca tcatattatt atgggtgtgt    108240
     tggcaaatta gtcacttttg aaaacataat tatggagttg ggcaagttac tatttataat    108300
     tggcaaaaca ggtaactcac tttgggcgtg taatagacga gcgtgaaata gaggtttggg    108360
     gtggggtaag tgatgtgttt tgaaattacc gaactatcct tttgacaaag aagaaagata    108420
     aaagtgaaat attctttttt ttttttattt ctttttaata acccctccaa tttaataatt    108480
     gaaatactta tcaatataaa tttattttct aaactaattc atatacataa aaatctatgt    108540
     atttttctct ataatttgat atgcattttg ttaatatttt ttaatatatt acagacattt    108600
     tatcagtagt cggtacactt aattatgtgt acagacttta ttttgtatgt tgcattagct    108660
     gtacagagta tataattgta tggagtatac aattatcaga agtcactttt cactgttgat    108720
     tcgtacactt agacctgtac aatattttta gtgtatatat atatatataa atatacacaa    108780
     catacactta catctgtaca ctaaaaagtg ttgtacagat ctaagtgtac gaatcaaaca    108840
     gttaaaagtg actactttgc aaattgtgaa tagtaaaatg actattttcc caattatggc    108900
     tggacgattt caatttgtac ttattaaata agttgtataa ataaaaatct gtacacataa    108960
     ttaactgtac tgactactaa taaaaatgtt tatataatat atttaaaatt attaacaaaa    109020
     tgcatatcaa attatagaga aaaaaatata gatttttatg tatctgaatt aatttagaaa    109080
     ataaatttac attgataagc atttcaatta ttagattgaa gaggttatta aaaaataaat    109140
     aaatatatat atatataaag aaatacaaag aatgagagta tgaggagaga gaaatgttga    109200
     atctaaaagc acaaatccca attgctttca acgacattag agaagaagaa gattagtggc    109260
     atatttgtaa ataatagagt tggtatgggg tatatttgat tttgtctgta atagggtcaa    109320
     aggtcagtga ctaaaaatcc aattataaat agtaacttgc ccaattccat aattaagttt    109380
     aaataagtga ctactttgca acttaaccct attattatca agattctaag agacagatgt    109440
     ttattgcaag tcggaaaaca attgcctctt cggtccaaaa ttaacatgta aatcaaaatt    109500
     catggccatt ctaatagttg agaaccttca tgagagtatt taaatatgta tctcaactta    109560
     tgtcgcttaa agttatagtt acttgttgta agttgtaact cttaagagca actcatgtcg    109620
     ctgagattat cgtcgctacc gtctaagcac aaaatgttga cacttgattc cgagcttcgg    109680
     ctgctgctca ccggccggtt tcgacatgat ctcacactgt acaccgaagt cgccggtgct    109740
     ttcgtcactg aatgtcggaa attccccgcc atgcttcctt ttctaacatc ctattaacac    109800
     ataaacaaaa gtactccaaa gttgaaagtc gttgaaattc atggttgatg acctttaata    109860
     tcatttcatt tgttaccgta ccatgtgtct caaggccatg tcgatggagc ttttagatag    109920
     gtttctacca aacccaaaac caccagatcc agagctcgac ttcccagcgg aggagtctcc    109980
     gccacctcca ccaagtcgtc gactgccgct ttctgtcagt cgcggtgtag caagttttct    110040
     catattcaca actttctcga ccttttgatt ccccttagcc gcatgactta tcaatctacc    110100
     atcatcgttg ttagtctttg ctcgttgtcc acgtaacgaa ggaacagcac catttacgtt    110160
     tccattagga gctcggcttc tagaaggcga acacgattgc ctctttgcaa catcgcgttc    110220
     tgtggacgct gatcttgaac tacttgacgc atcaaaggct ctggttctgc tacttgaagc    110280
     ggtttgtggc ctatctggta acgtagttct gagattcgat ggcgcttcta ctgagaatcc    110340
     aggcatctcg taaggttccc atggccttga tctcacgatc ggagaagctt ctaaagacag    110400
     agccggttta ctcaaaggct tagttggttt acttctcagt acagtcgatg aaccgttcgg    110460
     agttgatgga cggcgagttg gagtacttga cctcgatccc ggttttgaat taggagccga    110520
     catcggcctg ttattggatc gagtagaggt ggctgaaccg gtagtttgtt ggtctgttga    110580
     ggtggtgggc ctggttgcac gtgcagcggt taaggtaaca cgtgaggttc cagttccgga    110640
     gctagaggaa ggtctgctcc atgatcttgt tgagctagta gtagaggacg aggttaatgt    110700
     cgcacgtgta gttgttgagg tggcacgtga ggtcggcgtt gatggccttt tggctggagt    110760
     tttagacttt ctggttggcg tgggaggtct actcgttgat cttgagctac tagaggacga    110820
     tggtcttctg attccagaaa cagaggagga actgtgtaac gacgtcgttt ggtgctcgga    110880
     ctcttctttg ctatagttct ctaactgcac ataaaaaaaa aaaaaaaaaa acagagatga    110940
     gcaagagtgt gacgtatatg cagacactta aaaacaaaga gattgacgag attagaccac    111000
     gagatatact gagtccgtac ccgagatata agagtcatca ggttatcatc gggtgcgttg    111060
     aggtggttcg ttacgtttct actcggtgag cctggtggcg tgaccagcct gaacaataag    111120
     aacaatcaat aaagatcgat ggcaacaaat atataaatcg attatgttga aacattggca    111180
     aaaggtccaa ttttgaaaaa tatatatttg agatatgtaa catcaataaa agtgattgaa    111240
     aagtacaacc ataactagtt aacaaaaaca aataaaaatc catagctagt gaattgtttt    111300
     ttagaatgct ttaccaactc aaattctgat gaacaagatc agacatcaaa ctactgtcta    111360
     gcaagaagaa taaccgagaa aattgatcaa atttactctc tttttgttcg gtggaatgtg    111420
     tgctacgttc tatacgaaca caaatatttt taatgcaaaa atgtaacaaa acataataaa    111480
     aaggggggaa atgtttcaag gcaagatttt taaatcatga tcagactttt agagagcatg    111540
     atcaaattaa ttaaaagggg gaaatgatta ccattcgtaa tcggacttct cgccatcgga    111600
     gtacaataag ttctccccgg cagttctccg gacagggtat tgttgagacg acatcgccgt    111660
     cgtactacta gtattatcag attctgccaa aaagataaat cagaacaaaa aagaagataa    111720
     tttttcgaca acatatatta acacatatac gaacacggac ccattaaaag cgtaggtcgg    111780
     tgacgtttct cgcaacgacg catctccagg aacaaaagaa gctcttcatc tttgttttgg    111840
     gtcaacattt taagacattt tttaaattaa attgctgatg ctggaagaaa gtggtgaaga    111900
     tgttctttta cgtgtttttt cttcttctta ttatttgaaa atgtcagatt atcattcaca    111960
     cccctactaa tgatatatgt ataagcaagt aatatttatt attaaaaagt aaggaaagta    112020
     attattgttg ttttttactt atatcatatt aatgtatttt ggctactact aagagaattt    112080
     ttattatttt ctccagcaaa aatttaagag attttttttc tcaatgatat tattagttta    112140
     tatctttact ttaaaaaaga aatacaagat tatttctcaa tctccactaa atttctggaa    112200
     atggtattat taaatttcat tagattttct taaagcattc aattttatta tatctttaga    112260
     aaaaaaaaat gccatgctgg aaataaaact aaaaatttac aatacattaa tccaaggtgc    112320
     cgaaaaaatt ctcacgagta aaatcaatgc atctgtgtga aatatatgtg aatctcgcgt    112380
     atagatgagt ttgtcttaca ttgaatcctt ccaatgttgt gatatatttt taagtttagc    112440
     atgttaatgc aaaaatgact tatcgatctc ccccatgtca caactacaag cctcaactct    112500
     gctaataaga aataaacgaa ggattccatg gaggatcaat atgtcgttat gtgtccaatt    112560
     cccgattcta cttaaatgaa gttggtttga gagacattat tcttatttaa gtggatttaa    112620
     agctcaaggc ccaataccca ttttcaaagg cccaaacatt aactaggttc taggtatccc    112680
     cccccttatg tttttattca gcaacagttt cgaatatgtt tcgtctagac gagcgagact    112740
     ctctctgcta ggtttcgatt tcaatttcga tatcagggac cattttcctg attcttcgaa    112800
     ttctgcatag agaagcgaaa ttgggataga tctcgtttac tttgatttgt caatttcctg    112860
     cattctatta tacgggtttt gtgtttcctc gcaaattgat acagactgtt gctttgccat    112920
     tgaattattt gctgcgatgg acctaaatgc ttcaccacaa cccgaagaag acgatgaacc    112980
     ctttaagaga cgtcatgaag atcgaatgga atctgctgtt gagatcgcta gacgggtaca    113040
     ataacccata tatatgaatt gattcatgtg ttactcgtac ttgtttgaat atgtttggag    113100
     caagtttgat acttttggat gatgatatcg caaattcgtt atctttttgg cgttatagga    113160
     gcgtgaagaa cgaaagaaac gaatgagatt tgataggcca acacgagtct ctcagccggc    113220
     ttttcgtgat cagtatagag atactagagt ttatgatcaa agcaagcttc ctcagggtaa    113280
     attatatgct ttgccacttc ctcaaaagat cattttaggt tcattggtat gtggtttttt    113340
     tcttaacagg ttggctagat tgtcctggtt ttggtctgga gataggatgt attattcctt    113400
     ctaaggttcc acttagtgaa tcttacaacg aacatgttcc tcctggtaaa agatactctt    113460
     tcaaacaggt ggttcgtaac cagagaatta atggaagaaa agtaagtgaa aaaaatacat    113520
     gaatcaatct ttttctttgc tatgttaact ctctaaaggt aatgggtctt ttgcagcttg    113580
     gtctagtcat tgatcttact aatacaactc gttactaccc tacattagac ttaaagaagg    113640
     atggcatcaa gcatgttaag gtgactagaa tacatttttt tcttagtgtt tgtatcgtct    113700
     gcaccagtgt tagccgagtg ctttatcctc tttttcctgt ttgtagattg catgcagggg    113760
     tcgtgatgct gtgcctgata atgtctctgt aaacaccttt gtcaacgagg tacttgtttc    113820
     ataagttcag ttctcttctt gactgacgaa taagttcaat tcacgtgaag tttattttct    113880
     cctcttgcgt tttaattgaa gctcataatt atagctcatt tgaggacact gtcttcaggt    113940
     tctgcagttc gtccttaatc aaaaacacgc aaagaagtat gtcctcgtcc actgtacaca    114000
     tgggcataat cggacagggt tcatgatagt tcattatctc atgcgctcta tgccaacgat    114060
     gaacgttaca caggttcaat tctttctttc acatttgtac ttgttcactc gttttattaa    114120
     tcctctttag aatggagatt cttacctctg tgtggccttt ggcaggcatt gaagttgttt    114180
     tctgatgccc gcccacctgg gatttataaa ccagattata ttgatgcttt atacactttt    114240
     tatcacgaaa taaagcctga aagtgttact tgcccaccaa ctcctgaatg gaagaggtct    114300
     gccgagcttg atcttaatgg tgaagctgtt caagatgatg atgatgatga ttctccgcct    114360
     gaccctgttc aagtaagcgt ggtgcaagca agtgcttatt ctttaataag ctcttatgtt    114420
     taaccctcat attacagaat tatccgttcc aatgaatatc atgcatgcat tgttaagctc    114480
     ttacccttgt gaatacagag ctcataattt tacgaacggc taattttttt taaattctag    114540
     cttcataact attgtttcga ggtcatatat tcactacaca gtgatcttgg aaaataacgg    114600
     tatcatctaa acaaatgaac tgttctaaag attatctatt tgtgcatgtt gatgggtgca    114660
     gttgagtctt tcaaagctaa caaatttcat aaagtgtcaa tctcattttg cttgagtttt    114720
     ctaatgggtc tcttgctgat actgcctttc tttactgttt tgttgtttca ggaaatcaat    114780
     caggagaatg tgaagatgtc aaatgatgac actttgggtg atgaaatacc ccattatcag    114840
     gaggaagctt accggcaatt ctgttataaa atgcttatga tgaatgttgg ggtatgatat    114900
     caacactgct tatatgtttt cctagttttg ttcttctcta tctatgttct cctatggaat    114960
     attatgttga gcccaaatgt tgtttccggc atgtatgttt cattaaaagc atgctaaatg    115020
     tttttttaga ctaatgcaat aatactaatc ttcattgatt ggaaataatg tgagatatta    115080
     gtcatttgat ggactaaaat ttctctgatc cagggaagag gatttatgca attcccaggt    115140
     tcgcaccctg tatcattaga caggtcagaa tctctgcttt acttttggta ttgcgtacaa    115200
     agaggattta gcaagtgtat gttctgaatt ccagaggttc attagtccta gtttctcaat    115260
     gtagttaaat ctttacgatt tttgcataca cagggagagt ttgcaacttt tgaggcagcg    115320
     atactattat gcgacatgga aggcagatgg aacacgttat atgatgctct taactataga    115380
     tgggtgctat ttgatagata ggagctttaa gtttcggagg gtacagatgc gttttccctg    115440
     taagcactca cgtgaggtca gtaattttct gtcattgctt ttgtgttgat atctaaaact    115500
     tgtgaattcc ctgacttatt tggttttggg tggtagggaa tttctgataa agtgcatcac    115560
     tacactttgc ttgatggaga gatggtcata gataccccga caggtgagca aggggaggca    115620
     aggaggaggt atctcgtata tgatatggta gcaatcaatg gtgaatcagt tgtagaggtt    115680
     ggaactgtcg atccattata ttatcaattt ctttggaatg agttcagtag cacgagatct    115740
     tagcattcat tgttttccat catgtcactg tcatttctac tcggtatcaa ccagtattat    115800
     agatgctaaa gataacttac agttgattta aatatctacc agcggacttt ctgtgaaaga    115860
     tggaacatgt tcgtgcgtga ggtgatcgga cctcgagcag ctgagaagct cagaagtcat    115920
     tgctacagat atgaccttga gccttttgcg gtgagtttgc attttctgtt ccatgccata    115980
     ttttccttct cctttatata aatttgttgg taaaatttca ttgttgccca ggtacggatg    116040
     aagggtttct ggttactttc tactgttgag aagctgttga agaataccat tccatcgctt    116100
     tcgcatgaag cagatggctt aatatttcag gtaaccaaga gatgtttata tttcaggtct    116160
     tagtcaatat tttttcctga acgcagacag acacaaattt aagagattag tattatttgt    116220
     ttccctggat aaagtaggaa gattgcatta cttgagcatg acttacattt ggtttattag    116280
     ggttgggatg atccgtatgt tccacgaacc cataaaggtc tactgaagtg gaagtatgca    116340
     gaaatgaact cagtagactt tctgtatgag atgggtgagg aagaggggcg tggtttcctc    116400
     ttcttgcatg aaagagggaa gaaaaagctt atggaaggat attcagttga gtttagagat    116460
     gattcggacc cgtcaagtta caatgggaag attgtagaat gtgcttggga taaggataag    116520
     aaagtttggt ttagcatgag gatcagagtt gacaaaacta caccaaatga tatcaacact    116580
     gctcgtaagg tcagttgaag gattttctat atatttaggt attgcttttg tcaaatggtt    116640
     atattctcta catgatttct aatgtgatgt tgtaacacaa taggtgataa agagcataaa    116700
     tgataacatc actgaggagg ttttgcttca ggaaataaga gagatcattc gtctcccaat    116760
     gtacgctgac cgcattcgaa atgatagtca agctgcccgc cgccggtaga gattacattt    116820
     ttcaattttg tttagtagta atacactaga acgaactaat aattgttttg ggcggtttct    116880
     cttctctcac acttgtacag ctaaataatc tacatggtta tacacattac atctagtttg    116940
     tttcccaacg gaatttgaaa ctagaattat ttcattgata atcctcaata cgtgatatgg    117000
     aattattaac tatgatacat atccaacggt gttatgacta taacgacgaa cgacatattt    117060
     taggccaaac acgtcaagat ggcttctcct agcacgtgcc cttcaattgc gatcagcaat    117120
     ctctctttcg tcacctagct catattcaga acaactattt ataaaaaaaa gtactacata    117180
     aagtactaca tatcattcaa atcagatagg aaaataataa aacgatgtag taccgtgtga    117240
     ccaatcttgg gtttatcatc gagagcaaaa agcttgaact gaaaacggtg accgtgacta    117300
     ggtaagagag gtccacgcca tcccggaatc ttgtgatcgt tgttcccttc ccgaataccg    117360
     gtagtctgat cctcattgcc ggaatatcct tccggtaggc ctttcatctc tggtggtatg    117420
     tcgacgacaa cccacaccgt ccatggcacc agcgggccac taggatcagg cgcatcgatg    117480
     tcttccacca ccaaagctag cgtttttgta ccttctggaa cgttgtacct acaccatatc    117540
     aacattctta ctaattcaat gcaatccttt gggtcggtca ataaaccaca aaataattaa    117600
     aaaatggaaa catgttactt caaacagaaa aaaacaaaca actaggaagc cttgtgaatt    117660
     gtgataatta acaaatcgac aaaattaata atctctgttt cagcatcatg aatcaaagtc    117720
     ataaataaag agcgatcgat cggtaccatt caagaggagg agagatgtct ttcttaacac    117780
     cttgacctgc catcgtatac tttctcggca acttcccatc gttgtctatc gtcggcgaaa    117840
     ccagcctcaa ctcctcactc gacattccct tttactttta tgctatttct tacttagttt    117900
     tatcacaaag agtctcttct tttctacttt cgtacatatg aatgctcttt tcgtgtttgt    117960
     tactgatttg tatggatcgc ctatgtgtag aaacaacgcc acgtgacggt cttgaatgac    118020
     acttggcgtc atgattgaca cacggcgtca taggaaatct ggcgaagacc tgtgtttgag    118080
     cacaactcta tattgggctt tattgggcct aaattgtatt ttttcctctc tactatatta    118140
     gcctgtctcg ttctttttta aatcacgtta tcttattatt aaaggaccac ttaacagtat    118200
     actaattatt gttttaacaa ttcccaccaa aaaaataatt attgccttaa caataaaaca    118260
     aagataattt taatataaat taaatttgtt taattttaaa attacaataa aagatatttc    118320
     ttattttata aacaaaaact cttctcatct ttttttcttc tattttttaa tttattaaat    118380
     aagaatatct aaattaacta ccttctaact aaaattaaag tgatttccat gtaatattta    118440
     tcaattttga agtcatagta ggatgctcta acgtgagccg ttttaaccaa tcgttaacaa    118500
     agaattc                                                              118507
//

If you have problems or comments...

PBIL Back to PBIL home page