(data stored in ACNUC7421 zone)

EMBL: AL157959

ID   AL157959; SV 1; circular; genomic DNA; STD; PRO; 2184406 BP.
XX
AC   AL157959; AL162752-AL162758;
XX
PR   Project:PRJNA252;
XX
DT   18-JUL-2002 (Rel. 72, Created)
DT   06-FEB-2015 (Rel. 123, Last updated, Version 4)
XX
DE   Neisseria meningitidis serogroup A strain Z2491 complete genome
XX
KW   complete genome.
XX
OS   Neisseria meningitidis Z2491
OC   Bacteria; Proteobacteria; Betaproteobacteria; Neisseriales; Neisseriaceae;
OC   Neisseria.
XX
RN   [1]
RP   1-2184406
RX   DOI; 10.1038/35006655.
RX   PUBMED; 10761919.
RA   Parkhill J., Achtman M., James K.D., Bentley S.D., Churcher C., Klee S.R.,
RA   Morelli G., Basham D., Brown D., Chillingworth T., Davies R.M., Davis P.,
RA   Devlin K., Feltwell T., Hamlin N., Holroyd S., Jagels K., Leather S.,
RA   Moule S., Mungall K., Quail M.A., Rajandream M.A., Rutherford K.M.,
RA   Simmonds M., Skelton J., Whitehead S., Spratt B.G., Barrell B.G.;
RT   "Complete DNA sequence of a serogroup A strain of Neisseria meningitidis
RT   Z2491";
RL   Nature 404(6777):502-506(2000).
XX
RN   [2]
RP   1-2184406
RA   Parkhill J.;
RT   ;
RL   Submitted (30-MAR-2000) to the INSDC.
RL   Submitted on behalf of the Neisseria sequencing team, Sanger Centre,
RL   Wellcome Trust Genome Campus, Hinxton, Cambridge CB10 1SA E-mail:
RL   parkhill@sanger.ac.uk
XX
DR   MD5; 47227eb8d34557220e6e34692edb07a7.
DR   BioSample; SAMEA1705949.
DR   EnsemblGenomes-Gn; EBG00001182126.
DR   EnsemblGenomes-Gn; EBG00001182127.
DR   EnsemblGenomes-Gn; EBG00001182128.
DR   EnsemblGenomes-Gn; EBG00001182129.
DR   EnsemblGenomes-Gn; EBG00001182130.
DR   EnsemblGenomes-Gn; EBG00001182131.
DR   EnsemblGenomes-Gn; EBG00001182132.
DR   EnsemblGenomes-Gn; EBG00001182133.
DR   EnsemblGenomes-Gn; EBG00001182134.
DR   EnsemblGenomes-Gn; EBG00001182135.
DR   EnsemblGenomes-Gn; EBG00001182136.
DR   EnsemblGenomes-Gn; EBG00001182137.
DR   EnsemblGenomes-Gn; EBG00001182138.
DR   EnsemblGenomes-Gn; EBG00001182139.
DR   EnsemblGenomes-Gn; EBG00001182140.
DR   EnsemblGenomes-Gn; EBG00001182141.
DR   EnsemblGenomes-Gn; EBG00001182142.
DR   EnsemblGenomes-Gn; EBG00001182143.
DR   EnsemblGenomes-Gn; EBG00001182144.
DR   EnsemblGenomes-Gn; EBG00001182145.
DR   EnsemblGenomes-Gn; EBG00001182146.
DR   EnsemblGenomes-Gn; EBG00001182147.
DR   EnsemblGenomes-Gn; EBG00001182148.
DR   EnsemblGenomes-Gn; EBG00001182149.
DR   EnsemblGenomes-Gn; EBG00001182150.
DR   EnsemblGenomes-Gn; EBG00001182151.
DR   EnsemblGenomes-Gn; EBG00001182152.
DR   EnsemblGenomes-Gn; EBG00001182153.
DR   EnsemblGenomes-Gn; EBG00001182154.
DR   EnsemblGenomes-Gn; EBG00001182155.
DR   EnsemblGenomes-Gn; EBG00001182156.
DR   EnsemblGenomes-Gn; EBG00001182157.
DR   EnsemblGenomes-Gn; EBG00001182158.
DR   EnsemblGenomes-Gn; EBG00001182159.
DR   EnsemblGenomes-Gn; EBG00001182160.
DR   EnsemblGenomes-Gn; EBG00001182161.
DR   EnsemblGenomes-Gn; EBG00001182162.
DR   EnsemblGenomes-Gn; EBG00001182163.
DR   EnsemblGenomes-Gn; EBG00001182164.
DR   EnsemblGenomes-Gn; EBG00001182165.
DR   EnsemblGenomes-Gn; EBG00001182166.
DR   EnsemblGenomes-Gn; EBG00001182167.
DR   EnsemblGenomes-Gn; EBG00001182168.
DR   EnsemblGenomes-Gn; EBG00001182169.
DR   EnsemblGenomes-Gn; EBG00001182170.
DR   EnsemblGenomes-Gn; EBG00001182171.
DR   EnsemblGenomes-Gn; EBG00001182172.
DR   EnsemblGenomes-Gn; EBG00001182173.
DR   EnsemblGenomes-Gn; EBG00001182174.
DR   EnsemblGenomes-Gn; EBG00001182175.
DR   EnsemblGenomes-Gn; EBG00001182176.
DR   EnsemblGenomes-Gn; EBG00001182177.
DR   EnsemblGenomes-Gn; EBG00001182178.
DR   EnsemblGenomes-Gn; EBG00001182179.
DR   EnsemblGenomes-Gn; EBG00001182180.
DR   EnsemblGenomes-Gn; EBG00001182181.
DR   EnsemblGenomes-Gn; EBG00001182182.
DR   EnsemblGenomes-Gn; EBG00001182183.
DR   EnsemblGenomes-Gn; EBG00001182184.
DR   EnsemblGenomes-Gn; EBG00001182185.
DR   EnsemblGenomes-Gn; EBG00001182186.
DR   EnsemblGenomes-Gn; EBG00001182187.
DR   EnsemblGenomes-Gn; EBG00001182188.
DR   EnsemblGenomes-Gn; EBG00001182189.
DR   EnsemblGenomes-Gn; EBG00001182190.
DR   EnsemblGenomes-Gn; EBG00001182191.
DR   EnsemblGenomes-Gn; EBG00001182192.
DR   EnsemblGenomes-Gn; EBG00001182193.
DR   EnsemblGenomes-Gn; EBG00001182194.
DR   EnsemblGenomes-Gn; EBG00001182195.
DR   EnsemblGenomes-Gn; EBG00001182196.
DR   EnsemblGenomes-Gn; EBG00001182197.
DR   EnsemblGenomes-Gn; EBG00001182198.
DR   EnsemblGenomes-Gn; EBG00001182199.
DR   EnsemblGenomes-Gn; EBG00001182200.
DR   EnsemblGenomes-Gn; EBG00001182201.
DR   EnsemblGenomes-Gn; EBG00001182202.
DR   EnsemblGenomes-Gn; EBG00001182203.
DR   EnsemblGenomes-Gn; EBG00001182204.
DR   EnsemblGenomes-Gn; EBG00001182205.
DR   EnsemblGenomes-Gn; EBG00001182206.
DR   EnsemblGenomes-Gn; EBG00001182207.
DR   EnsemblGenomes-Gn; EBG00001182208.
DR   EnsemblGenomes-Gn; EBG00001182209.
DR   EnsemblGenomes-Gn; EBG00001182210.
DR   EnsemblGenomes-Gn; EBG00001182211.
DR   EnsemblGenomes-Gn; EBG00001182212.
DR   EnsemblGenomes-Gn; EBG00001182213.
DR   EnsemblGenomes-Gn; EBG00001182214.
DR   EnsemblGenomes-Gn; EBG00001182215.
DR   EnsemblGenomes-Gn; EBG00001182216.
DR   EnsemblGenomes-Gn; EBG00001182217.
DR   EnsemblGenomes-Gn; EBG00001182218.
DR   EnsemblGenomes-Gn; EBG00001182219.
DR   EnsemblGenomes-Gn; EBG00001182220.
DR   EnsemblGenomes-Gn; EBG00001182221.
DR   EnsemblGenomes-Gn; EBG00001182222.
DR   EnsemblGenomes-Gn; EBG00001182223.
DR   EnsemblGenomes-Gn; EBG00001182224.
DR   EnsemblGenomes-Gn; NMA0059.
DR   EnsemblGenomes-Gn; NMA0175.
DR   EnsemblGenomes-Gn; NMA0179.
DR   EnsemblGenomes-Gn; NMA0191.
DR   EnsemblGenomes-Gn; NMA0193.
DR   EnsemblGenomes-Gn; NMA0235.
DR   EnsemblGenomes-Gn; NMA0265.
DR   EnsemblGenomes-Gn; NMA0266.
DR   EnsemblGenomes-Gn; NMA0267.
DR   EnsemblGenomes-Gn; NMA0268.
DR   EnsemblGenomes-Gn; NMA0269.
DR   EnsemblGenomes-Gn; NMA0270.
DR   EnsemblGenomes-Gn; NMA0271.
DR   EnsemblGenomes-Gn; NMA0273A.
DR   EnsemblGenomes-Gn; NMA0285.
DR   EnsemblGenomes-Gn; NMA0306.
DR   EnsemblGenomes-Gn; NMA0309.
DR   EnsemblGenomes-Gn; NMA0312.
DR   EnsemblGenomes-Gn; NMA0315.
DR   EnsemblGenomes-Gn; NMA0319.
DR   EnsemblGenomes-Gn; NMA0344A.
DR   EnsemblGenomes-Gn; NMA0368.
DR   EnsemblGenomes-Gn; NMA0407.
DR   EnsemblGenomes-Gn; NMA0526.
DR   EnsemblGenomes-Gn; NMA0530.
DR   EnsemblGenomes-Gn; NMA0531.
DR   EnsemblGenomes-Gn; NMA0532.
DR   EnsemblGenomes-Gn; NMA0561.
DR   EnsemblGenomes-Gn; NMA0626.
DR   EnsemblGenomes-Gn; NMA0627.
DR   EnsemblGenomes-Gn; NMA0669.
DR   EnsemblGenomes-Gn; NMA0679.
DR   EnsemblGenomes-Gn; NMA0683.
DR   EnsemblGenomes-Gn; NMA0787.
DR   EnsemblGenomes-Gn; NMA0822.
DR   EnsemblGenomes-Gn; NMA0823.
DR   EnsemblGenomes-Gn; NMA1040.
DR   EnsemblGenomes-Gn; NMA1042.
DR   EnsemblGenomes-Gn; NMA1058.
DR   EnsemblGenomes-Gn; NMA1166.
DR   EnsemblGenomes-Gn; NMA1181.
DR   EnsemblGenomes-Gn; NMA1212.
DR   EnsemblGenomes-Gn; NMA1218.
DR   EnsemblGenomes-Gn; NMA1224.
DR   EnsemblGenomes-Gn; NMA1239.
DR   EnsemblGenomes-Gn; NMA1242.
DR   EnsemblGenomes-Gn; NMA1252.
DR   EnsemblGenomes-Gn; NMA1280.
DR   EnsemblGenomes-Gn; NMA1285.
DR   EnsemblGenomes-Gn; NMA1288A.
DR   EnsemblGenomes-Gn; NMA1318.
DR   EnsemblGenomes-Gn; NMA1319.
DR   EnsemblGenomes-Gn; NMA1331.
DR   EnsemblGenomes-Gn; NMA1385.
DR   EnsemblGenomes-Gn; NMA1393.
DR   EnsemblGenomes-Gn; NMA1427.
DR   EnsemblGenomes-Gn; NMA1430.
DR   EnsemblGenomes-Gn; NMA1432.
DR   EnsemblGenomes-Gn; NMA1454.
DR   EnsemblGenomes-Gn; NMA1467.
DR   EnsemblGenomes-Gn; NMA1509.
DR   EnsemblGenomes-Gn; NMA1531.
DR   EnsemblGenomes-Gn; NMA1589.
DR   EnsemblGenomes-Gn; NMA1601.
DR   EnsemblGenomes-Gn; NMA1612.
DR   EnsemblGenomes-Gn; NMA1618.
DR   EnsemblGenomes-Gn; NMA1663.
DR   EnsemblGenomes-Gn; NMA1676.
DR   EnsemblGenomes-Gn; NMA1677.
DR   EnsemblGenomes-Gn; NMA1741.
DR   EnsemblGenomes-Gn; NMA1890.
DR   EnsemblGenomes-Gn; NMA1907.
DR   EnsemblGenomes-Gn; NMA1925.
DR   EnsemblGenomes-Gn; NMA1977.
DR   EnsemblGenomes-Gn; NMA1992.
DR   EnsemblGenomes-Gn; NMA1997.
DR   EnsemblGenomes-Gn; NMA2043.
DR   EnsemblGenomes-Gn; NMA2069.
DR   EnsemblGenomes-Gn; NMA2085.
DR   EnsemblGenomes-Gn; NMA2087.
DR   EnsemblGenomes-Gn; NMA2094.
DR   EnsemblGenomes-Gn; NMA2096.
DR   EnsemblGenomes-Gn; NMA2183.
DR   EnsemblGenomes-Gn; NMA2184.
DR   EnsemblGenomes-Tr; EBT00001760522.
DR   EnsemblGenomes-Tr; EBT00001760523.
DR   EnsemblGenomes-Tr; EBT00001760524.
DR   EnsemblGenomes-Tr; EBT00001760525.
DR   EnsemblGenomes-Tr; EBT00001760526.
DR   EnsemblGenomes-Tr; EBT00001760527.
DR   EnsemblGenomes-Tr; EBT00001760528.
DR   EnsemblGenomes-Tr; EBT00001760529.
DR   EnsemblGenomes-Tr; EBT00001760530.
DR   EnsemblGenomes-Tr; EBT00001760531.
DR   EnsemblGenomes-Tr; EBT00001760532.
DR   EnsemblGenomes-Tr; EBT00001760533.
DR   EnsemblGenomes-Tr; EBT00001760534.
DR   EnsemblGenomes-Tr; EBT00001760535.
DR   EnsemblGenomes-Tr; EBT00001760536.
DR   EnsemblGenomes-Tr; EBT00001760537.
DR   EnsemblGenomes-Tr; EBT00001760538.
DR   EnsemblGenomes-Tr; EBT00001760539.
DR   EnsemblGenomes-Tr; EBT00001760540.
DR   EnsemblGenomes-Tr; EBT00001760541.
DR   EnsemblGenomes-Tr; EBT00001760542.
DR   EnsemblGenomes-Tr; EBT00001760543.
DR   EnsemblGenomes-Tr; EBT00001760544.
DR   EnsemblGenomes-Tr; EBT00001760545.
DR   EnsemblGenomes-Tr; EBT00001760546.
DR   EnsemblGenomes-Tr; EBT00001760547.
DR   EnsemblGenomes-Tr; EBT00001760548.
DR   EnsemblGenomes-Tr; EBT00001760549.
DR   EnsemblGenomes-Tr; EBT00001760550.
DR   EnsemblGenomes-Tr; EBT00001760551.
DR   EnsemblGenomes-Tr; EBT00001760552.
DR   EnsemblGenomes-Tr; EBT00001760553.
DR   EnsemblGenomes-Tr; EBT00001760554.
DR   EnsemblGenomes-Tr; EBT00001760555.
DR   EnsemblGenomes-Tr; EBT00001760556.
DR   EnsemblGenomes-Tr; EBT00001760557.
DR   EnsemblGenomes-Tr; EBT00001760558.
DR   EnsemblGenomes-Tr; EBT00001760559.
DR   EnsemblGenomes-Tr; EBT00001760560.
DR   EnsemblGenomes-Tr; EBT00001760561.
DR   EnsemblGenomes-Tr; EBT00001760562.
DR   EnsemblGenomes-Tr; EBT00001760563.
DR   EnsemblGenomes-Tr; EBT00001760564.
DR   EnsemblGenomes-Tr; EBT00001760565.
DR   EnsemblGenomes-Tr; EBT00001760566.
DR   EnsemblGenomes-Tr; EBT00001760567.
DR   EnsemblGenomes-Tr; EBT00001760568.
DR   EnsemblGenomes-Tr; EBT00001760569.
DR   EnsemblGenomes-Tr; EBT00001760570.
DR   EnsemblGenomes-Tr; EBT00001760571.
DR   EnsemblGenomes-Tr; EBT00001760572.
DR   EnsemblGenomes-Tr; EBT00001760573.
DR   EnsemblGenomes-Tr; EBT00001760574.
DR   EnsemblGenomes-Tr; EBT00001760575.
DR   EnsemblGenomes-Tr; EBT00001760576.
DR   EnsemblGenomes-Tr; EBT00001760577.
DR   EnsemblGenomes-Tr; EBT00001760578.
DR   EnsemblGenomes-Tr; EBT00001760579.
DR   EnsemblGenomes-Tr; EBT00001760580.
DR   EnsemblGenomes-Tr; EBT00001760581.
DR   EnsemblGenomes-Tr; EBT00001760582.
DR   EnsemblGenomes-Tr; EBT00001760583.
DR   EnsemblGenomes-Tr; EBT00001760584.
DR   EnsemblGenomes-Tr; EBT00001760585.
DR   EnsemblGenomes-Tr; EBT00001760586.
DR   EnsemblGenomes-Tr; EBT00001760587.
DR   EnsemblGenomes-Tr; EBT00001760588.
DR   EnsemblGenomes-Tr; EBT00001760589.
DR   EnsemblGenomes-Tr; EBT00001760590.
DR   EnsemblGenomes-Tr; EBT00001760591.
DR   EnsemblGenomes-Tr; EBT00001760592.
DR   EnsemblGenomes-Tr; EBT00001760593.
DR   EnsemblGenomes-Tr; EBT00001760594.
DR   EnsemblGenomes-Tr; EBT00001760595.
DR   EnsemblGenomes-Tr; EBT00001760596.
DR   EnsemblGenomes-Tr; EBT00001760597.
DR   EnsemblGenomes-Tr; EBT00001760598.
DR   EnsemblGenomes-Tr; EBT00001760599.
DR   EnsemblGenomes-Tr; EBT00001760600.
DR   EnsemblGenomes-Tr; EBT00001760601.
DR   EnsemblGenomes-Tr; EBT00001760602.
DR   EnsemblGenomes-Tr; EBT00001760603.
DR   EnsemblGenomes-Tr; EBT00001760604.
DR   EnsemblGenomes-Tr; EBT00001760605.
DR   EnsemblGenomes-Tr; EBT00001760606.
DR   EnsemblGenomes-Tr; EBT00001760607.
DR   EnsemblGenomes-Tr; EBT00001760608.
DR   EnsemblGenomes-Tr; EBT00001760609.
DR   EnsemblGenomes-Tr; EBT00001760610.
DR   EnsemblGenomes-Tr; EBT00001760611.
DR   EnsemblGenomes-Tr; EBT00001760612.
DR   EnsemblGenomes-Tr; EBT00001760613.
DR   EnsemblGenomes-Tr; EBT00001760614.
DR   EnsemblGenomes-Tr; EBT00001760615.
DR   EnsemblGenomes-Tr; EBT00001760616.
DR   EnsemblGenomes-Tr; EBT00001760617.
DR   EnsemblGenomes-Tr; EBT00001760618.
DR   EnsemblGenomes-Tr; EBT00001760619.
DR   EnsemblGenomes-Tr; EBT00001760620.
DR   EnsemblGenomes-Tr; NMA0059.
DR   EnsemblGenomes-Tr; NMA0175.
DR   EnsemblGenomes-Tr; NMA0179.
DR   EnsemblGenomes-Tr; NMA0191.
DR   EnsemblGenomes-Tr; NMA0193.
DR   EnsemblGenomes-Tr; NMA0235.
DR   EnsemblGenomes-Tr; NMA0265.
DR   EnsemblGenomes-Tr; NMA0266.
DR   EnsemblGenomes-Tr; NMA0267.
DR   EnsemblGenomes-Tr; NMA0268.
DR   EnsemblGenomes-Tr; NMA0269.
DR   EnsemblGenomes-Tr; NMA0270.
DR   EnsemblGenomes-Tr; NMA0271.
DR   EnsemblGenomes-Tr; NMA0273A.
DR   EnsemblGenomes-Tr; NMA0285.
DR   EnsemblGenomes-Tr; NMA0306.
DR   EnsemblGenomes-Tr; NMA0309.
DR   EnsemblGenomes-Tr; NMA0312.
DR   EnsemblGenomes-Tr; NMA0315.
DR   EnsemblGenomes-Tr; NMA0319.
DR   EnsemblGenomes-Tr; NMA0344A.
DR   EnsemblGenomes-Tr; NMA0368.
DR   EnsemblGenomes-Tr; NMA0407.
DR   EnsemblGenomes-Tr; NMA0526.
DR   EnsemblGenomes-Tr; NMA0530.
DR   EnsemblGenomes-Tr; NMA0531.
DR   EnsemblGenomes-Tr; NMA0532.
DR   EnsemblGenomes-Tr; NMA0561.
DR   EnsemblGenomes-Tr; NMA0626.
DR   EnsemblGenomes-Tr; NMA0627.
DR   EnsemblGenomes-Tr; NMA0669.
DR   EnsemblGenomes-Tr; NMA0679.
DR   EnsemblGenomes-Tr; NMA0683.
DR   EnsemblGenomes-Tr; NMA0787.
DR   EnsemblGenomes-Tr; NMA0822.
DR   EnsemblGenomes-Tr; NMA0823.
DR   EnsemblGenomes-Tr; NMA1040.
DR   EnsemblGenomes-Tr; NMA1042.
DR   EnsemblGenomes-Tr; NMA1058.
DR   EnsemblGenomes-Tr; NMA1166.
DR   EnsemblGenomes-Tr; NMA1181.
DR   EnsemblGenomes-Tr; NMA1212.
DR   EnsemblGenomes-Tr; NMA1218.
DR   EnsemblGenomes-Tr; NMA1224.
DR   EnsemblGenomes-Tr; NMA1239.
DR   EnsemblGenomes-Tr; NMA1242.
DR   EnsemblGenomes-Tr; NMA1252.
DR   EnsemblGenomes-Tr; NMA1280.
DR   EnsemblGenomes-Tr; NMA1285.
DR   EnsemblGenomes-Tr; NMA1288A.
DR   EnsemblGenomes-Tr; NMA1318.
DR   EnsemblGenomes-Tr; NMA1319.
DR   EnsemblGenomes-Tr; NMA1331.
DR   EnsemblGenomes-Tr; NMA1385.
DR   EnsemblGenomes-Tr; NMA1393.
DR   EnsemblGenomes-Tr; NMA1427.
DR   EnsemblGenomes-Tr; NMA1430.
DR   EnsemblGenomes-Tr; NMA1432.
DR   EnsemblGenomes-Tr; NMA1454.
DR   EnsemblGenomes-Tr; NMA1467.
DR   EnsemblGenomes-Tr; NMA1509.
DR   EnsemblGenomes-Tr; NMA1531.
DR   EnsemblGenomes-Tr; NMA1589.
DR   EnsemblGenomes-Tr; NMA1601.
DR   EnsemblGenomes-Tr; NMA1612.
DR   EnsemblGenomes-Tr; NMA1618.
DR   EnsemblGenomes-Tr; NMA1663.
DR   EnsemblGenomes-Tr; NMA1676.
DR   EnsemblGenomes-Tr; NMA1677.
DR   EnsemblGenomes-Tr; NMA1741.
DR   EnsemblGenomes-Tr; NMA1890.
DR   EnsemblGenomes-Tr; NMA1907.
DR   EnsemblGenomes-Tr; NMA1925.
DR   EnsemblGenomes-Tr; NMA1977.
DR   EnsemblGenomes-Tr; NMA1992.
DR   EnsemblGenomes-Tr; NMA1997.
DR   EnsemblGenomes-Tr; NMA2043.
DR   EnsemblGenomes-Tr; NMA2069.
DR   EnsemblGenomes-Tr; NMA2085.
DR   EnsemblGenomes-Tr; NMA2087.
DR   EnsemblGenomes-Tr; NMA2094.
DR   EnsemblGenomes-Tr; NMA2096.
DR   EnsemblGenomes-Tr; NMA2183.
DR   EnsemblGenomes-Tr; NMA2184.
DR   EuropePMC; PMC1431543; 16503987.
DR   EuropePMC; PMC1481605; 16686962.
DR   EuropePMC; PMC1797815; 17305430.
DR   EuropePMC; PMC2193550; 12045242.
DR   EuropePMC; PMC2228313; 17915007.
DR   EuropePMC; PMC2265139; 18305155.
DR   EuropePMC; PMC2386816; 18430216.
DR   EuropePMC; PMC2519523; 18606739.
DR   EuropePMC; PMC2731217; 19476432.
DR   EuropePMC; PMC2849579; 20107095.
DR   EuropePMC; PMC2893595; 20525335.
DR   EuropePMC; PMC2944513; 20675487.
DR   EuropePMC; PMC3078933; 21533118.
DR   EuropePMC; PMC3082526; 21541312.
DR   EuropePMC; PMC3088665; 21573213.
DR   EuropePMC; PMC3125207; 21711902.
DR   EuropePMC; PMC3133043; 21296965.
DR   EuropePMC; PMC3133314; 21622743.
DR   EuropePMC; PMC3279770; 22347552.
DR   EuropePMC; PMC3346468; 22327577.
DR   EuropePMC; PMC3898611; 19477564.
DR   EuropePMC; PMC3940162; 24291226.
DR   EuropePMC; PMC4014685; 24812217.
DR   EuropePMC; PMC4212839; 25336458.
DR   EuropePMC; PMC4392821; 25901274.
DR   EuropePMC; PMC4698195; 26598987.
DR   EuropePMC; PMC4981724; 27486197.
DR   EuropePMC; PMC5084427; 27793092.
DR   EuropePMC; PMC5282872; 28112239.
DR   EuropePMC; PMC5610715; 29026659.
DR   EuropePMC; PMC5625396; 28794176.
DR   GOA; P66891.
DR   InterPro; IPR006312; TatA/E.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00114; S15.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00522; PreQ1.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01344; CRISPR-DR34.
DR   RFAM; RF01416; NrrF.
DR   RFAM; RF01725; SAM-I-IV-variant.
DR   RFAM; RF01766; cspA.
DR   RFAM; RF01843; neisseria_FSE.
DR   RFAM; RF01850; beta_tmRNA.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   RFAM; RF02270; nse_sRNA.
DR   RFAM; RF02274; AniS.
DR   SILVA-LSU; AL157959.
DR   SILVA-SSU; AL157959.
DR   StrainInfo; 401211; 0.
DR   UniProtKB/Swiss-Prot; P66891; TATA_NEIMA.
XX
CC   Notes:
CC   Details of N. meningitidis sequencing at the Sanger Centre
CC   are available on the World Wide Web.
CC   (URL, http://www.sanger.ac.uk/Projects/N_meningitidis/)
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2184406
FT                   /organism="Neisseria meningitidis Z2491"
FT                   /strain="Z2491"
FT                   /mol_type="genomic DNA"
FT                   /note="serogroup: A"
FT                   /db_xref="taxon:122587"
FT   CDS_pept        complement(38..358)
FT                   /transl_table=11
FT                   /locus_tag="NMA0001"
FT                   /product="hypothetical protein NMA0001"
FT                   /note="NMA0001, unknown, len: 106 aa"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0001"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07330"
FT                   /db_xref="GOA:A0A0U1RGN5"
FT                   /db_xref="InterPro:IPR010329"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RGN5"
FT                   /protein_id="CAM07330.1"
FT                   /translation="MSNTQTIRSADFTTSRAWGALDIANMNGTTVRLHWTDQPYKWHVN
FT                   DGEEVFAVMDGEVDMHYRENGEEHIVRLKSGDIFYAGIGTEHVAHPRGETRILVIEKEG
FT                   SV"
FT   CDS_pept        complement(414..2438)
FT                   /transl_table=11
FT                   /locus_tag="NMA0002"
FT                   /product="NADH dehydrogenase I chain L"
FT                   /EC_number="1.6.5.3"
FT                   /note="NMA0002, nuoL, NADH dehydrogenase I chain L, len:
FT                   674 aa; similar to many e.g. NUOL_RHOCA NADH dehydrogenase
FT                   I chain L (EC 1.6.5.3) (700 aa). Contains Pfam match to
FT                   entry PF00361 oxidored_q1, NADH-Ubiquinone/plastoquinone
FT                   (complex I), various chains, and to entry PF00662
FT                   oxidored_q1_N, NADH-Ubiquinone oxidoreductase (complex I),
FT                   chain 5 N-terminus"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0002"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07331"
FT                   /db_xref="GOA:Q9JX92"
FT                   /db_xref="InterPro:IPR001516"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="InterPro:IPR003945"
FT                   /db_xref="InterPro:IPR018393"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9JX92"
FT                   /protein_id="CAM07331.1"
FT                   /translation="MNDMTLYLIIALVPLAGSLIAGLFGNKIGRAGAHTVTILGVAVSA
FT                   VLSAYVLWGFLNGSRAKFDENVYTWLTMGGLDFSVGFLVDTMTAMMMVVVTGVSLMVHI
FT                   YTIGYMHDEKVGYQRFFSYISLFTFSMLMLIMSNNFIQLFFGWEAVGLVSYLLIGFYFK
FT                   RPSATFANLKAFLINRVGDFGFLLGIGLVLAYFGGSLRYQDVFAYLPNVQNATIQLFPG
FT                   VEWSLITVTCLLLFVGAMGKSAQFPLHVWLPDSMEGPTPISALIHAATMVTAGLFMVSR
FT                   MSPIYEMSSTALSVIMVIGAITALFMGFLGVIQNDIKRVVAYSTLSQLGYMTVALGASA
FT                   YSVAMFHVMTHAFFKALLFLAAGSAIIGMHHDQDMRHMGNLKKYMPITWLTMLIGNLSL
FT                   IGTPFFSGFYSKDSIIEAAKYSTLPGSGFAYFAVLASVFVTAFYAFRQYFMVFHGEEKW
FT                   RSLPEHHSDGHGEEHHGLGKNDNPHESPLVVTLPLILLAVPSVIIGYIAIEPMLYGDFF
FT                   KDVIFVNADAHPTMHIMKEEFHGALAMVSHSLHSPVLYLAIAGVLSAWLLYVKLPHLPA
FT                   KIAQAFRPVYVLFENKYYLDALYFNVFAKGTRALGTFFWKVGDTAIIDNGIVNGSARLV
FT                   GAVAAQVRKVQTGFIYTYAAAMVFGVLVLLGMTFWGLFR"
FT   CDS_pept        complement(2487..2828)
FT                   /transl_table=11
FT                   /locus_tag="NMA0003"
FT                   /product="hypothetical protein NMA0003"
FT                   /note="NMA0003, unknown, len: 113 aa"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0003"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07332"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RGN6"
FT                   /protein_id="CAM07332.1"
FT                   /translation="MMDKNQLEQEFHKAMLNIYQEALNLPQPYKATRFLQIVNEFGGKE
FT                   AADKLLSTGEKKTQTGFTELILSGGGVHALKYSMEYLVLQKPWCDLFTEEQLAVARKRL
FT                   ERVGFVSPK"
FT   CDS_pept        complement(2952..3527)
FT                   /transl_table=11
FT                   /locus_tag="NMA0004"
FT                   /product="hypothetical protein NMA0004"
FT                   /note="NMA0004, unknown, len: 191 aa; similar to
FT                   hypothetical proteins e.g. Y977_HAEIN HI0977 (191 aa),fasta
FT                   scores; E(): 0; 80.5% identity in 190 aa overlap, and to
FT                   proteins involved in cell cycle e.g. TR:O54679
FT                   (EMBL:AF036487) Lactococcus lactis Plasmid pNZ4000 putative
FT                   mobilization protein (200 aa), fasta scores; E(): 0, 55.1%
FT                   identity in 167 aa overlap, and FIC_ECOLI cell
FT                   filamentation protein FIC (200 aa), fasta scores; E():
FT                   0.093, 29.4% identity in 126 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0004"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07333"
FT                   /db_xref="InterPro:IPR003812"
FT                   /db_xref="InterPro:IPR036597"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RGN7"
FT                   /protein_id="CAM07333.1"
FT                   /translation="MPSENPIGKTMKSIDEQSLHNARRLFESGDIDRIEVGTTAGLQQI
FT                   HRYLFGGLYDFAGQIREDNISKGGFRFANAMYLKEALVKIEQMPERTFEEIIAKYVEMN
FT                   IAHPFLEGNGRSTRIWLDLVLKKNLKKVVNWQNVSKTLYLQAMERSPVNDLELRFLLKD
FT                   NLTDDVDNREIIFKGIEQSYYYEGYEKG"
FT   CDS_pept        complement(3561..3866)
FT                   /transl_table=11
FT                   /locus_tag="NMA0005"
FT                   /product="NADH dehydrogenase I chain K"
FT                   /EC_number="1.6.5.3"
FT                   /note="NMA0005, nuoK, NADH dehydrogenase I chain K, len:
FT                   101 aa; simlar to many e.g. NUOK_RHOCA NADH dehydrogenase I
FT                   chain K (EC 1.6.5.3) (102 aa), fasta scores; E(): 1.1e-24;
FT                   65.0% identity in 100 aa overlap. Contains Pfam match to
FT                   entry PF00420 oxidored_q2,NADH-ubiquinone/plastoquinone
FT                   oxidoreductase chain 4L"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0005"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07334"
FT                   /db_xref="GOA:A1INM7"
FT                   /db_xref="InterPro:IPR001133"
FT                   /db_xref="InterPro:IPR039428"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1INM7"
FT                   /protein_id="CAM07334.1"
FT                   /translation="MITLTHYLVLGALLFGISAMGIFMNRKNVLVLLMSIELMLLAVNF
FT                   NFIAFSQHLGDTAGQIFVFFVLTVAAAESAIGLAIMVLVYRNRQTINVADLDELKG"
FT   CDS_pept        complement(3863..4534)
FT                   /transl_table=11
FT                   /locus_tag="NMA0006"
FT                   /product="NADH dehydrogenase I chain J"
FT                   /EC_number="1.6.5.3"
FT                   /note="NMA0006, nuoJ, NADH dehydrogenase I chain J, len:
FT                   223 aa; similar to many e.g. NUOJ_RHOCA NADH dehydrogenase
FT                   I chain J (EC 1.6.5.3) (202 aa), fatsa scores; E():
FT                   9.7e-21; 41.3% identity in 201 aa overlap. Contains Pfam
FT                   match to entry PF00499
FT                   oxidored_q3,NADH-ubiquinone/plastoquinone oxidoreductase
FT                   chain 6"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0006"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07335"
FT                   /db_xref="GOA:A0A0U1RGN8"
FT                   /db_xref="InterPro:IPR001457"
FT                   /db_xref="InterPro:IPR042106"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RGN8"
FT                   /protein_id="CAM07335.1"
FT                   /translation="MTFQLILFYIFAVIILYGAIKTVTAKNPVHAALHLVLTFCVSAML
FT                   WMLMQAEFLGVTLVVVYVGAVMVLFLFVVMMLNIDIEEMRAGFWRHAPVAGVVGTLLAV
FT                   ALILILVNPKTDLAAFGLMKDIPADYNNIRDLGSRIYTDYLLPFELAAVLLLLGMVAAI
FT                   ALVHRKTVNPKRMDPADQVKVRADQGRMRLVKMEAVKPQTESAEESEVSDDLKPKEEGK
FT                   A"
FT   CDS_pept        complement(4570..5277)
FT                   /transl_table=11
FT                   /locus_tag="NMA0007"
FT                   /product="hypothetical protein NMA0007"
FT                   /note="NMA0007, unknown, len: 235 aa"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0007"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07336"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RGN9"
FT                   /protein_id="CAM07336.1"
FT                   /translation="MEGLINALKYLAEHEPIDNFEEIRTRNSPIKLPSGLSNFEQNIFL
FT                   KENLSPKLQNDDSLKTHYWIIREWGGIKSFKQSAENSQLIRQFLSELNSGKLSSGLLKI
FT                   SSLSKLASFIDCERFAIYDSRAIFSLNWLLFKFTNADLFFQPQGRNRELEIRNMNVLFH
FT                   FSDIKPNYRKPDVSFHQYCGLLQDLAKQVYGKQAKPYHIEMLLFKIATTWICADMDQLI
FT                   KFDCLRNQDFQTA"
FT   CDS_pept        complement(5308..5787)
FT                   /transl_table=11
FT                   /locus_tag="NMA0008"
FT                   /product="NADH dehydrogenase I chain I"
FT                   /EC_number="1.6.5.3"
FT                   /note="NMA0008, nuoI, NADH dehydrogenase I chain I, len:
FT                   113 aa; simlar to many e.g. NUOI_RHOCA NADH dehydrogenase I
FT                   chain I (EC 1.6.5.3) (163 aa), fasta scores; E(): 0; 59.7%
FT                   identity in 154 aa overlap. Contains Pfam match to entry
FT                   PF00037 fer4, 4Fe-4S ferredoxins and related iron-sulfur
FT                   cluster binding domains, 2x PS00198 4Fe-4S ferredoxins,
FT                   iron-sulfur binding region signature, and PS00028 Zinc
FT                   finger, C2H2 type, domain"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0008"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07337"
FT                   /db_xref="GOA:Q9JQM2"
FT                   /db_xref="InterPro:IPR010226"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9JQM2"
FT                   /protein_id="CAM07337.1"
FT                   /translation="MANLVKTFLLGELVKGMGVTLKNFFARKDTIYFPEEKTPQSVRFR
FT                   GLHAQRRYPNGEERCIACKLCEAVCPAMAINIESEEREDGTRRTKRYDIDLTKCIFCGF
FT                   CEEACPTDAIVETHIFEYHGEKKGDLHMTKPILLAIGDKYEAEIAKRKAADAPYR"
FT   CDS_pept        complement(5867..6943)
FT                   /transl_table=11
FT                   /locus_tag="NMA0009"
FT                   /product="NADH dehydrogenase I chain H"
FT                   /EC_number="1.6.5.3"
FT                   /note="NMA0009, nuoH, NADH dehydrogenase I chain H, len:
FT                   358 aa; similar to many e.g. NUOH_RHOCA NADH dehydrogenase
FT                   I chain H (EC 1.6.5.3) (345 aa), fasta scores; E(): 0,46.4%
FT                   identity in 332 aa overlap. Contains Pfam match to entry
FT                   PF00146 NADHdh, NADH dehydrogenases, and PS00668
FT                   Respiratory-chain NADH dehydrogenase subunit 1 signature 2"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0009"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07338"
FT                   /db_xref="GOA:Q9JX88"
FT                   /db_xref="InterPro:IPR001694"
FT                   /db_xref="InterPro:IPR018086"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9JX88"
FT                   /protein_id="CAM07338.1"
FT                   /translation="MQEWFQNLFAATLGLGDLGITVGLVVSVIVKIVIILIPLILTVAY
FT                   LTYFERKVIGFMQLRVGPNVTGPWGLIQPFADVFKLLFKEVTRPRLSNKALFYIGPIMS
FT                   LAPSFAAWAVIPFNEEWVLTNINIGLLYILMITSLSVYGVIIAGWASNSKYSFLGAMRA
FT                   SAQSISYEIAMSAALVCVVMVSGSMNFSDIVAAQAKGIAGGSVFSWNWLPLFPIFIVYL
FT                   ISAVAETNRAPFDVAEGESEIVAGHHVEYSGFAFALFFLAEYIFMILISALTSLMFLGG
FT                   WLSPFPQSWGFIGTPSAFWMFVKMAAVLYWYLWIRATFPRYRYDQIMRLGWKVLIPIGF
FT                   AYIVILGLWMISPLNLWK"
FT   CDS_pept        complement(6946..9207)
FT                   /transl_table=11
FT                   /locus_tag="NMA0010"
FT                   /product="NADH dehydrogenase I chain G"
FT                   /EC_number="1.6.5.3"
FT                   /note="NMA0010, nuoG, NADH dehydrogenase I chain G, len:
FT                   753 aa; similar to many e.g. NUAM_RECAM NADH-ubiquinone
FT                   oxidoreductase 75 kd subunit precursor (EC 1.6.5.3) (691
FT                   aa), fasta scores; E(): 0; 37.3% identity in 632 aa
FT                   overlap, and SW:NUOG_ECOLI P33602 NADH dehydrogenase I
FT                   chain G (EC 1.6.5.3) (907 aa), blastp score; Expect =
FT                   2.1e-60. Contains Pfam match to entry PF00111 fer2, 2Fe-2S
FT                   iron-sulfur cluster binding domains, score 10.90, E-value
FT                   0.0075, and PS00642 and PS00643 Respiratory-chain NADH
FT                   dehydrogenase 75 Kd subunit signatures 2 and 3"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0010"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07339"
FT                   /db_xref="GOA:A0A0U1RGP0"
FT                   /db_xref="InterPro:IPR000283"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006963"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="InterPro:IPR010228"
FT                   /db_xref="InterPro:IPR019574"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RGP0"
FT                   /protein_id="CAM07339.1"
FT                   /translation="MLQIEIDGKQVSVEQGATVIEAAHKLGTYIPHFCYHKKLSIAANC
FT                   RMCLVDVEKAPKPLPACATPVTDGMIVRTHSAKAREAQEGVMEFLLINHPLDCPTCDQG
FT                   GECQLQDLAVGYGKTTSRYTEEKRSVVGKDMGPLVSAEEMSRCIHCTRCVRFTEEIAGL
FT                   QEIAMVNRGEHSEIMPFIGKTVETELSGNVIDLCPVGALTSKPFRFNARTWELNRRKSV
FT                   SAHDALGSNLIVQTKDHTVRRVLPLENEAINECWLSDRDRFAYEGLYHESRLKNPKIKQ
FT                   GGEWMDVDWKTALEYVRSAIECIAKDGNQNQVGIWANPMNTVEELYLAKKLADGLGVKN
FT                   FATRLRQQDKRLSDGIKGAQWLGQSIESLADNDAVLVVGANLRKEQPLLTARLRRAAKD
FT                   RMALSVLAGSKEELFMPLLSQEAAHPDEWAGRLKNLSANAEHAVTASLKNAEKAAVILG
FT                   AEVQNHPDYAAIYAAVQELADATGAVLGILPQAANSVGADVLGVNSGESVAEMANAPKQ
FT                   AVLLLNVEPEIDTVDGAKAVAALKQAKSVMAFTPFVSETLLDVCDVLLPIAPFTETSGS
FT                   FINMEGRLQSFHGVVQGFGDSRPMWKVLRVLGNLFDLKGFEYHDTVAILKDALDAESLP
FT                   SKLNNRAASTQKDFQTASSRLVRVGGVGIYHTDAIVRRSAPLQETSHAAVPAARVNPNT
FT                   LARLGLQDGQTAVAKQNGASVSVAVKADAGLPENVVHLPLHTENAALGALMDTIELAGA
FT                   "
FT   CDS_pept        complement(9489..9758)
FT                   /transl_table=11
FT                   /locus_tag="NMA0011"
FT                   /product="hypothetical protein NMA0011"
FT                   /note="NMA0011, unknown, len: 89 aa; similar to TR:O33368
FT                   (EMBL:AJ002423) N.g. hypothetical 11.4 kd protein (94
FT                   aa),fasta scores; E(): 1.1e-16; 53.0% identity in 83 aa
FT                   overlap. Also similar to NMA0292, fasta scores; E():
FT                   5.4e-19; 54.2% identity in 83 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0011"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07340"
FT                   /db_xref="InterPro:IPR000305"
FT                   /db_xref="InterPro:IPR035901"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RGP1"
FT                   /protein_id="CAM07340.1"
FT                   /translation="MANGKNGTLYIGVTMNLPERVWQHKNHVNIDGFTARYDVHDLVWY
FT                   QFFENMPEAVAKEKTMKKWRREWKIKLIEEQNPEWLDLSGVLFV"
FT   CDS_pept        complement(10044..10481)
FT                   /transl_table=11
FT                   /locus_tag="NMA0013"
FT                   /product="hypothetical protein NMA0013"
FT                   /note="NMA0013, unknown, len: 145 aa. Contains PS00017
FT                   ATP/GTP-binding site motif A (P-loop)"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0013"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07341"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RGP2"
FT                   /protein_id="CAM07341.1"
FT                   /translation="MVEAKIFILYGAANKGKSTTLNTLFNQICWKFSKFLVFFERHGNG
FT                   LDFVAVFDHEGQRIGFYSSGDNEYEVRRNLYKLYSHNCDFIFGTSRTRGGSCDAVGCYA
FT                   ELLHGDVNIINWCEKFEPTDEDNERAVKELFKSFKNIINEL"
FT   CDS_pept        complement(10481..11782)
FT                   /transl_table=11
FT                   /locus_tag="NMA0014"
FT                   /product="NADH dehydrogenase I chain F"
FT                   /EC_number="1.6.5.3"
FT                   /note="NMA0014, nuoF, NADH dehydrogenase I chain F, len:
FT                   433 aa; similar to many e.g. NQO1_THETH NADH-ubiquinone
FT                   oxidoreductase chain 1 (EC 1.6.5.3) (438 aa), fasta scores;
FT                   E(): 0; 50.0% identity in 414 aa overlap, and SW:NUOF_ECOLI
FT                   P31979 NADH dehydrogenase I chain F (EC 1.6.5.3) (445 aa),
FT                   blastp scores Expect = 2.8e-93. Contains PS00645
FT                   Respiratory-chain NADH dehydrogenase 51 Kd subunit
FT                   signature 2"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0014"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07342"
FT                   /db_xref="GOA:A0A0U1RGP3"
FT                   /db_xref="InterPro:IPR001949"
FT                   /db_xref="InterPro:IPR011537"
FT                   /db_xref="InterPro:IPR011538"
FT                   /db_xref="InterPro:IPR019554"
FT                   /db_xref="InterPro:IPR019575"
FT                   /db_xref="InterPro:IPR037207"
FT                   /db_xref="InterPro:IPR037225"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RGP3"
FT                   /protein_id="CAM07342.1"
FT                   /translation="MAIYQSGVIFDQVDTANPDCWTLDEYVKRGGYTALRKILSGNISQ
FT                   TDVIDEVKTSGLRGRGGAGFPTGLKWSFMPRSFPGEKYVVCNTDEGEPGTFKDRDIIMF
FT                   NPHALIEGMIIAGYAMGAKAGYNYIHGEIFEGYQRFEAALEQARAAGFLGKNILGSDFE
FT                   FELFAHHGYGAYICGEETALLESLEGKKGQPRFKPPFPASFGLYGKPTTINNTETFSSV
FT                   PFIIRDGGQAFADKGIPNAGGTKLFCISGHVERPGNYEVPLGTPFAEVLKMAGGMRGGK
FT                   KLKAVIPGGSSAPVLPADIMMQTNMDYDSISKAGSMLGSGAIIVMDEDVCMVKALERLS
FT                   YFYYDESCGQCTPCREGTGWLYRIVHRIVEGKGRMEDLDLLDSIGNQMAGRTICALADA
FT                   AVFPVRSFTKHFRDEFVHYIEHGGPMKEHKWGGW"
FT   CDS_pept        complement(12172..12645)
FT                   /transl_table=11
FT                   /locus_tag="NMA0015"
FT                   /product="NADH dehydrogenase I chain E"
FT                   /EC_number="1.6.5.3"
FT                   /note="NMA0015, nuoE, NADH dehydrogenase I chain E, len:
FT                   157 aa; similar to many e.g. NUOE_ECOLI NADH dehydrogenase
FT                   I chain E (EC 1.6.5.3) (166 aa), fasta scores; E():
FT                   1.5e-13; 35.9% identity in 153 aa overlap. Contains Pfam
FT                   match to entry PF01257 complex1_24kD, Respiratory-chain
FT                   NADH dehydrogenase 24 Kd subunit"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0015"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07343"
FT                   /db_xref="GOA:A0A0U1RGP4"
FT                   /db_xref="InterPro:IPR002023"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR041921"
FT                   /db_xref="InterPro:IPR042128"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RGP4"
FT                   /protein_id="CAM07343.1"
FT                   /translation="MLSAESLKQIDIELAKYPADQRRSAIMGALRIAQTEKGWLAPETI
FT                   AFVADYIGISPAQAYEVATFYNMYDLEPVGKYKLTVCTNLPCALRGGMATGEYLKQKLG
FT                   ISYGETTPDGKFTLVEGECMGACGDAPVMLLNNHKMCSFMTEEAIEKKLAELE"
FT   CDS_pept        complement(12645..13901)
FT                   /transl_table=11
FT                   /locus_tag="NMA0016"
FT                   /product="NADH dehydrogenase I chain D"
FT                   /EC_number="1.6.5.3"
FT                   /note="NMA0016, nuoD, NADH dehydrogenase I chain D, len:
FT                   418 aa; similar to many eg. NQO4_PARDE NADH-ubiquinone
FT                   oxidoreductase chain 4 (EC 1.6.5.3) (412 aa), fasta scores;
FT                   E(): 0; 60.9% identity in 414 aa overlap, and SW:NUOD_ECOLI
FT                   P33600 NADH dehydrogenase I chain D (EC 1.6.5.3) (407 aa),
FT                   blastp scores; Expect = 2.3e-80. Contains Pfam match to
FT                   entry PF00346 complex1_49Kd,Respiratory-chain NADH
FT                   dehydrogenase, 49 Kd subunit, and PS00535 Respiratory chain
FT                   NADH dehydrogenase 49 Kd subunit signature"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0016"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07344"
FT                   /db_xref="GOA:A1INN7"
FT                   /db_xref="InterPro:IPR001135"
FT                   /db_xref="InterPro:IPR014029"
FT                   /db_xref="InterPro:IPR022885"
FT                   /db_xref="InterPro:IPR029014"
FT                   /db_xref="InterPro:IPR038290"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1INN7"
FT                   /protein_id="CAM07344.1"
FT                   /translation="MANKLRNYTINFGPQHPAAHGVLRMILELDGEQIVRADPHIGLLH
FT                   RGTEKLAETKTYLQALPYMDRLDYVSMMVNEQAYCLAVEKLAGIDVPIRAQYIRVMFAE
FT                   VTRILNHLMGIGSHAFDIGAMTAILYAFRDREELMDLYEAVSGARMHAAYFRPGGVYRD
FT                   LPDFMPKYESSKFRNAKVLKQLNESREGTMLDFIDAFCERFPKNIDTLETLLTDNRIWK
FT                   QRTVGIGVVSPERAMQKGFTGVMLRGSGVEWDVRKTQPYEVYDKMDFDIPVGVNGDCYD
FT                   RYLCRMEEMRQSVRIIKQCSEWLRVNPGPVITTNHKFAPPKRTEMKTGMEDLIHHFKLF
FT                   TEGMHVPEGETYTAVEHPKGEFGVYIISDGANKPYRLKIRAPGFAHLQGMDEMAKGHML
FT                   ADVVAIIGTQDIVFGEVDR"
FT   CDS_pept        complement(13891..14484)
FT                   /transl_table=11
FT                   /locus_tag="NMA0017"
FT                   /product="NADH dehydrogenase I chain C"
FT                   /EC_number="1.6.5.3"
FT                   /note="NMA0017, nuoC, NADH dehydrogenase I chain C, len:
FT                   197 aa; similar to many eg. NUGM_HUMAN NADH-ubiquinone
FT                   oxidoreductase 30 kd subunit precursor (EC 1.6.5.3) (264
FT                   aa), fasta scores; E(): 4.8e-31, 50.0% identity in 172 aa
FT                   overlap, and NUOC_ECOLI P33599 NADH dehydrogenase I chain C
FT                   (EC 1.6.5.3) (183 aa), blastp scores; Expect = 1.7e-15.
FT                   Contains Pfam match to entry PF00329
FT                   complex1_30Kd,Respiratory-chain NADH dehydrogenase, 30 Kd
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0017"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07345"
FT                   /db_xref="GOA:Q9JX80"
FT                   /db_xref="InterPro:IPR001268"
FT                   /db_xref="InterPro:IPR010218"
FT                   /db_xref="InterPro:IPR020396"
FT                   /db_xref="InterPro:IPR037232"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9JX80"
FT                   /protein_id="CAM07345.1"
FT                   /translation="MASIQNLYETVVGVLGDQASKVISALGEITVECLPEHYISVMTAL
FT                   RDHEELHFELLVDLCGVDYSTYKNEVWQGKRFAVVSQLLSVKNNQRIRVRVWVSDDDFP
FT                   VVESVVDIYNSADWYEREAFDMYGIMFNNHPDLRRILTDYGFVGHPFRKDFPISGYVEM
FT                   RYDEEQKRVIYQPVTIEPREITPRIVREENYGGQ"
FT   CDS_pept        complement(14497..14979)
FT                   /transl_table=11
FT                   /locus_tag="NMA0018"
FT                   /product="NADH dehydrogenase I chain B"
FT                   /EC_number="1.6.5.3"
FT                   /note="NMA0018, nuoB, NADH dehydrogenase I chain B, len:
FT                   160 aa; similar to many eg. NUKM_ARATH NADH-ubiquinone
FT                   oxidoreductase 20 kd subunit precursor (EC 1.6.5.3) (218
FT                   aa), fasta scores; E(): 0, 80.3% identity in 142 aa
FT                   overlap, and NUOB_ECOLI P33598 NADH dehydrogenase I chain B
FT                   (EC 1.6.5.3) (220 aa), blastp scores; Expect = 9.4e-38; 50%
FT                   identity in 148 aa overlap. Contains Pfam match to entry
FT                   PF01058 oxidored_q6, NADH ubiquinone oxidoreductase,20 Kd
FT                   subunit,score 283.70, and PS01150 Respiratory-chain NADH
FT                   dehydrogenase 20 Kd subunit signature"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0018"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07346"
FT                   /db_xref="GOA:A1INN9"
FT                   /db_xref="InterPro:IPR006137"
FT                   /db_xref="InterPro:IPR006138"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1INN9"
FT                   /protein_id="CAM07346.1"
FT                   /translation="MGIEGVLKKGFITTSADTVLNYMRTGSLWPVTFGLACCAVEMMHA
FT                   GMARYDLDRFGIIFRPSPRQADLMIVAGTLTNKMASALRRVYDQLAEPRWVLSMGSCAN
FT                   GGGYYHYSYSVVRGADRVVPVDVYVPGCPPTAEALIYGLIQLQQKIKRTSTIARDE"
FT   CDS_pept        complement(14970..15326)
FT                   /transl_table=11
FT                   /locus_tag="NMA0019"
FT                   /product="NADH dehydrogenase I chain A"
FT                   /EC_number="1.6.5.3"
FT                   /note="NMA0019, nuoA, NADH dehydrogenase I chain A, len:
FT                   118 aa; similar to many eg. NU3M_PLASU NADH-ubiquinone
FT                   oxidoreductase chain 3 (EC 1.6.5.3) (117 aa), fastscores;
FT                   E(): 8.3e-28, 55.3% identity in 114 aa overlap, and
FT                   NUOA_ECOLI P33597 NADH dehydrogenase I chain A (EC 1.6.5.3)
FT                   (147 aa), blastp scores; Expect = 7.1e-17; 33% identity in
FT                   112 aa overlap. Contains Pfam match to entry PF00507
FT                   oxidored_q4, NADH-ubiquinone/plastoquinone oxidoreductase,
FT                   chain 3"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0019"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07347"
FT                   /db_xref="GOA:A0A0U1RGP5"
FT                   /db_xref="InterPro:IPR000440"
FT                   /db_xref="InterPro:IPR023043"
FT                   /db_xref="InterPro:IPR038430"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RGP5"
FT                   /protein_id="CAM07347.1"
FT                   /translation="MLSAYFPVFVFILVGLAAGVLFILLGTILGPKRHYAEKDAPYECG
FT                   FEAFENARMKFDVRYYLVAILFILFDLEVAFMLPWAVVFKDLGAYGFWSMLVFIVVLTV
FT                   GFVYEWKKGALEWE"
FT   CDS_pept        complement(15777..17261)
FT                   /transl_table=11
FT                   /locus_tag="NMA0020"
FT                   /product="putative integral membrane protein"
FT                   /note="NMA0020, probable integral membrane protein, len:
FT                   494 aa; weak similarity to TR:O33279 (EMBL:AL008687)
FT                   Mycobacterium tuberculosis putative spermidine synthase
FT                   speE (523 aa), fasta scores; E(): 0.00015, 24.1% identity
FT                   in 406 aa overlap. Contains several membrane spanning
FT                   domains in N-terminal half"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0020"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07348"
FT                   /db_xref="GOA:A0A0U1RGP6"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RGP6"
FT                   /protein_id="CAM07348.1"
FT                   /translation="MNTKPNTSLIYMLSFLSGLLSLGIEVLWVRMFSFAAQSVPQAFSF
FT                   TLACFLTGIAVGAYFGKRICRSRFVDIPFIGQCFLWAGIADFLILGAAWLLTGFSGFVH
FT                   HAGIFITLSAVVRGLIFPLVHHVGTDGNKSGRQVSNVYFANVAGSALGPVLIGFVILDF
FT                   LSTQQIYLLICLISAAVPLFCTLFQKSLRLNAVSVAVSLMFGILMFLLPDSVFQNIADR
FT                   PDRLIENKHGIVAVYHRDGDKVVYGANVYDGAYNTDVFNSVNGIERAYLLPSLKSGIRR
FT                   IFVVGLSTGSWARVLSAIPEMQSMIVAEINPAYRSLIADEPQIAPLLQDKRVEIVLDDG
FT                   RKWLRRHPDEKFDLILMNTTWYWRAYSTNLLSAEFLKQVQSHLTPDGIVMFNTTHSPHA
FT                   FATAVHSIPYAYRYGHMVVGSATPVVFPNKELLKQRLSRLIWPESGRHVFDSSTVDAAA
FT                   QKVVSRMLIQMTEPSAGAEVITDDNMIVEYKYGRGI"
FT   CDS_pept        complement(17251..17871)
FT                   /transl_table=11
FT                   /locus_tag="NMA0021"
FT                   /product="putative integral membrane protein"
FT                   /note="NMA0021, probable integral membrane protein, len:
FT                   206 aa; weak similarity to TR:CAB42042 (EMBL:AL049754)
FT                   Streptomyces coelicolor putative spermidine synthase
FT                   SCH10.33c (554 aa), fasta scores; E(): 0.0013, 25.8%
FT                   identity in 194 aa overlap. Contains several membrane
FT                   spanning domains"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0021"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07349"
FT                   /db_xref="GOA:A0A0U1RGP7"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RGP7"
FT                   /protein_id="CAM07349.1"
FT                   /translation="MNSTASKTLKGLSLVFFASGFCALIYQVSWQRLLFSHIGIDLSSI
FT                   TVIISVFMVGLGVGAYFGGRIADRFPSSIIPLFCIAEVSIGLFGLVSRGLISGLGHLLV
FT                   EADLPIIAAANFLLLLLPTFMMGATLPLLTCFFNRKIHNVGESIGTLYFFNTLGAALGS
FT                   LAAAEFFYVFFTLSQTIALTACFNLLIAASVWLRYRKDGYSEH"
FT   CDS_pept        complement(18070..18447)
FT                   /transl_table=11
FT                   /locus_tag="NMA0022"
FT                   /product="putative IS1016 transposase"
FT                   /note="NMA0022, possible transposase for IS1016, len: 125
FT                   aa; 91.3% identity to TR:AAD31037 (EMBL:AF142582) N.g. MAFI
FT                   (104 aa), and highly similar to part of TR:Q48234
FT                   (EMBL:X59756) Haemophilus influenzae insertion sequence
FT                   IS1016-V6 (191 aa), fasta scores; E(): 2e-12, 67.9%
FT                   identity in 53 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0022"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07350"
FT                   /db_xref="InterPro:IPR024445"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RGP8"
FT                   /protein_id="CAM07350.1"
FT                   /translation="MRKSRLSRYKQNKLIELFVAGVTARTATEPDSIVYTDCYRSYDVL
FT                   DVSEFSHFRINHSTHFAERQNHINGIENFWNRAKRHLRKFNGIPKAHFELYLKECEWRF
FT                   NNSEIKVQISILKQLVKSSLS"
FT   CDS_pept        18500..18829
FT                   /transl_table=11
FT                   /locus_tag="NMA0023"
FT                   /product="hypothetical protein NMA0023"
FT                   /note="NMA0023, unknown, len: 109 aa"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0023"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07351"
FT                   /db_xref="InterPro:IPR028964"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RGP9"
FT                   /protein_id="CAM07351.1"
FT                   /translation="MIKLDLKSINLYDIDFEKFTPEIPDNFHRWIDLDIGIEGEQGSSI
FT                   FSLCICSPKWISHHCNKEGFFWSNALILEQFDHKIIKSEIDKILEYCSKETWDLTLSNL
FT                   LRFFS"
FT   CDS_pept        18983..19198
FT                   /transl_table=11
FT                   /locus_tag="NMA0024"
FT                   /product="hypothetical protein NMA0024"
FT                   /note="NMA0024, unknown, len: 71 aa; similar to
FT                   NMA0323,fasta scores; E(): 5.6e-11, 46.4% identity in 69 aa
FT                   overlap"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0024"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07352"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RGQ0"
FT                   /protein_id="CAM07352.1"
FT                   /translation="MNIINYTGDDIIISLTREELQLLRSLVIEIYAGVCIDAEEFEIVS
FT                   GIRNSKLVQELEQQLIEAYDLMDTKG"
FT   CDS_pept        complement(19388..19927)
FT                   /transl_table=11
FT                   /locus_tag="NMA0025"
FT                   /product="hypothetical protein NMA0025"
FT                   /note="NMA0025, unknown, len: 179 aa"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0025"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07353"
FT                   /db_xref="InterPro:IPR018958"
FT                   /db_xref="InterPro:IPR037883"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RGQ1"
FT                   /protein_id="CAM07353.1"
FT                   /translation="MSQVFKDFDLSSVWESDSWADENYKEAPFTPEILAAVESELGYKL
FT                   PQSFIELMAVQNGGIFVKNCFPTTQRNSWAKDHVQICEVSGIGFEKEGSLCGETGQKLW
FT                   MEEWEYPPIGVYFANDPSGGHAMFALDYRECGKDGEPKVVFVEQESDFEIVELAPDFET
FT                   FIRSLRHEDEFIDEEI"
FT   CDS_pept        complement(20284..22491)
FT                   /transl_table=11
FT                   /locus_tag="NMA0027"
FT                   /product="DNA helicase II"
FT                   /EC_number="3.6.1.-"
FT                   /note="NMA0027, uvrD, probable DNA helicase II, len 735 aa;
FT                   similar to e.g. UVRD_ECOLI DNA helicase II (EC 3.6.1.-)
FT                   (720 aa), fasta scores; E(): 0, 48.0% identity in 736 aa
FT                   overlap. Contains Pfam match to entry PF00580
FT                   UvrD-helicase, UvrD/REP helicase, and PS00017
FT                   ATP/GTP-binding site motif A (P-loop)"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0027"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07354"
FT                   /db_xref="GOA:A0A0U1RGQ2"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR005753"
FT                   /db_xref="InterPro:IPR013986"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034739"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RGQ2"
FT                   /protein_id="CAM07354.1"
FT                   /translation="MFPDQSAPNLLQGLNPEQLSAVTWPPQSALVLAGAGSGKTRVLTT
FT                   RIAWLLQTGQASVHSIMAVTFTNKAAKEMQTRLGAMIPVNVRAMWLGTFHGLCHRFLRL
FT                   HHRDAGLPSSFQILDSGDQLSLIKRLLKSLNIAEEIIAPRSLQGFINAQKESGLRASVL
FT                   SAPDPHTRRMIECYAEYDKICQREGVVDFAELMLRSYEMLQSNEILRRHYQNRFNHILV
FT                   DEFQDTNKLQYAWLKLMAGGNTAVFAVGDDDQSIYRFRGANVGNMTALMEEFHIDAPVK
FT                   LEQNYRSVGNILASANAVIENNDERLGKNLRTDAEAGDKIRYYSAFTDLEEAQFIVDET
FT                   KALEREGWDLDEIAVLYRSNAQSRVIEQSLFRSGIPYKIYGGLRFYERQEIKHALAYLR
FT                   LAVNPDDDNALLRVINFPPRGIGARTIENLQTASQEQGITLWQAACNAGAKATKIAAFV
FT                   RLIEALRNQVGQMSLSEIIVGILKDSGLTEHYRTQKGDNQDRLDNLDELVNAAIEFKPE
FT                   DSNFETLPDNISDDPAFPILAFLSNAALESGENQAGAGEKAVQLMTVHAAKGLEFNAVF
FT                   LTGMEEGRFPSEMSLAERGGLEEERRLMYVAITRARKRLYITMAQQRMLHGQTQFGIVS
FT                   RFVEEIPPEVLHYLSVKKPAYDRYGNTRQTAAPKDKIIDDYKQPQTYAGFRIGQNVRHA
FT                   KFGTGVIIDAADKGESARLTINFGKQGVKELDTKFAKLEAM"
FT   CDS_pept        22675..23322
FT                   /transl_table=11
FT                   /locus_tag="NMA0028"
FT                   /product="hypothetical protein NMA0028"
FT                   /note="NMA0028, unknown, len: 215 aa; similar to
FT                   hypothetical proteins e.g. YBGJ_HAEIN HI1731 (213 aa),fasta
FT                   scores; E(): 0, 59.0% identity in 212 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0028"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07355"
FT                   /db_xref="InterPro:IPR003833"
FT                   /db_xref="InterPro:IPR010016"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RGQ3"
FT                   /protein_id="CAM07355.1"
FT                   /translation="MRIEITPISESALVCRLNAPSELGKQQKLWAFAAALGQHDRIEEV
FT                   VVGMNNLTVFTRFDTDLATLADELQYVWEHTAVTDHQGKLVEIPVCYGGEYGPDLAEVA
FT                   AFHQTVISEIVRRHTAQTYTVFMMGFQPGFPYLGGLPEALHTPRRAVPRTSVPAGSVGI
FT                   GGSQTGVYPFASPGGWQIIGRTELPLFRADLNPPTLLAAGDQVRFVAERIEP"
FT   CDS_pept        23319..24248
FT                   /transl_table=11
FT                   /locus_tag="NMA0029"
FT                   /product="hypothetical protein NMA0029"
FT                   /note="NMA0029, unknown, len: 309 aa; similar to
FT                   hypothetical proteins e.g. YBGK_HAEIN HI1730 (309 aa),fasta
FT                   scores; E(): 0, 59.6% identity in 307 aa overlap. Also some
FT                   similarity to part of DUR1_YEAST urea amidolyase (1835 aa),
FT                   fasta scores; E(): 2.1e-12, 27.6% identity in 323 aa
FT                   overlap"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0029"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07356"
FT                   /db_xref="InterPro:IPR003778"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RGQ4"
FT                   /protein_id="CAM07356.1"
FT                   /translation="MIHVSAVQAPAHIQDTGRYGHRRYGIGHAGAMDTVALAAGNILLG
FT                   NDEGTAAIEIALGGIMLVFERDTPFCLTGAVYQAELDGEPVYSYWRYTARKGQTLKLVR
FT                   AVQGMYGYVCVAGGFDVPEVMGSRSTDLKAGFGGHQGRMLQKGDYLPIGKGAQELSKVG
FT                   IAPIPFTDTVHLVPSSEYAAFSEKGRLNLERETWTLQSDSNRMGYRFDGQPLTLSQPLE
FT                   MLSHAVQAGTVQVPPGGKPIILLADAQTTGGYPKIATVAAADLGKLAQVRFGSKVKFKI
FT                   IGLKKATALRRKNQAYLNQIRRITHEAG"
FT   CDS_pept        24235..24972
FT                   /transl_table=11
FT                   /locus_tag="NMA0030"
FT                   /product="hypothetical protein NMA0030"
FT                   /note="NMA0030, unknown, len: 245 aa; similar to
FT                   hypothetical proteins e.g. YBGL_HAEIN HI1729 (257 aa),fasta
FT                   scores; E(): 0, 59.6% identity in 245 aa overlap, and to
FT                   LAMB_EMENI Emericella nidulans lactam utilization protein
FT                   LAMB (262 aa), fasta scores; E(): 3.3e-13, 39.1% identity
FT                   in 128 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0030"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07357"
FT                   /db_xref="GOA:P0A0Z1"
FT                   /db_xref="InterPro:IPR005501"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0A0Z1"
FT                   /protein_id="CAM07357.1"
FT                   /translation="MKQVDLNADLAEGCGSDEALLQLITSANIACAQHAGSIADIRAAL
FT                   AYAQQNGVRIGAHPGYPDRENFGRTEMNLSEADLRACLNYQLGALQALCRDQGLEMAYV
FT                   KPHGAMYNQAAKNRALADTVARIVADFDPKLKLMALSGSLLLEAGKAAGLGVISEVFAD
FT                   RRYMPDGTLVPRSRPDAQVDSDEEAIAQVLQMVRDGQVKAVDGSLVAVQADSICLHGDG
FT                   PHAVVFAEKIRQELLAAGIKVSA"
FT   CDS_pept        25101..26294
FT                   /transl_table=11
FT                   /locus_tag="NMA0031"
FT                   /product="putative transmembrane transport protein"
FT                   /note="NMA0031, probable transmembrane transport
FT                   protein,len: 397 aa; similar to many diverse transport
FT                   proteins e.g. BRNQ_HAEIN branched-chain amino acid
FT                   transport system carrier protein (436 aa), fasta scores;
FT                   E(): 6.7e-06,23.7% identity in 371 aa overlap, and
FT                   TYRP_HAEIN tyrosine-specific transport protein 1 (400 aa),
FT                   fasta scores; E(): 0.25, 24.9% identity in 213 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0031"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07358"
FT                   /db_xref="GOA:A0A0U1RGQ5"
FT                   /db_xref="InterPro:IPR001046"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RGQ5"
FT                   /protein_id="CAM07358.1"
FT                   /translation="MSNQKNRRNALIGAAFLMATSAIGPGFLTQTATFTQALAASFGFV
FT                   ILLSILLDIGAQLNIWRIVAVSEKQAQDIANQVLPGAGYFLAVLIVMGGLAFNIGNVGG
FT                   AGLGLNLLTGLSPETGAVISGVIAIGVFLFKEAGKVMDKFAQVMGFVMIALTVYVAWQA
FT                   NPPLADAAVHTFMPEKLDAMAIVTLVGGTVGGYITFAGAHRLLDAGIKGKSALPEVSQS
FT                   SVRAILIASIMRIVLFLAVLGVVSQGVQLNPDNPASTPFEYAAGYIGLLIFGVVIWAAS
FT                   ITSVIGAAYTSVSFFSGLSPSIERNKNKWIIAFIAVSTAVFSTIGKPAQVLVFVGALNG
FT                   LILPISLGLILIAAYKTKIVGDYKHPLWLTVSGVIVVGLMAVLSAITISKYIGGLFG"
FT   CDS_pept        26402..27094
FT                   /transl_table=11
FT                   /locus_tag="NMA0032"
FT                   /product="hypothetical protein NMA0032"
FT                   /note="NMA0032, unknown, len: 230 aa; similar to
FT                   NMA0403,fasta scores; E(): 0, 53.5% identity in 230 aa
FT                   overlap"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0032"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07359"
FT                   /db_xref="InterPro:IPR002725"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RGQ6"
FT                   /protein_id="CAM07359.1"
FT                   /translation="MKRFTYTLSDGLCIEIELKRSAKKNLILRPVNMQTVSINVPPFFQ
FT                   DHALANWLAANETILRNTLAKMPVHPVSHPNLPEWIWYRGIKTKLDTHSQSHIRITSSE
FT                   ILLPRKETAAQIDHLRRLLNERAREYLLPRLEKHAAETGLTPAATDLSNAKTFWGVCRP
FT                   HTGIRLNWRLIGTPEYVADYVCIHELCHLRHPDHSPRFWHLVNTLTPHTDNAKSWLKAH
FT                   GRELFVLG"
FT   CDS_pept        27359..28324
FT                   /transl_table=11
FT                   /locus_tag="NMA0033"
FT                   /product="putative transposase for IS1655"
FT                   /note="NMA0033, probable transposase for IS1655, len: 321
FT                   aa; similar to many e.g. TRA4_BACFR transposase for
FT                   insertion sequence element IS4351 (326 aa), fasta scores;
FT                   E(): 0, 41.6% identity in 310 aa overlap. Contains Pfam
FT                   match to entry PF01460 Transposase_4, Transposase IS30
FT                   family, score 373.60, E-value 2e-108"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0033"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07360"
FT                   /db_xref="GOA:A0A0U1RGQ7"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025246"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RGQ7"
FT                   /protein_id="CAM07360.1"
FT                   /translation="MSYTQLTQGERYHIQYLSRHCTVTEIAKQLNRHKSTISREIRRHR
FT                   TQGQQYSAEKAQRQSRTIKQRKRQPYKLDSQLIQHIDTLIRRKLSPEQVCAYLCKHHQI
FT                   TLHHSTIYRHLRQDKSNGSTLWQHLRICSKPYRKRYGSTWTRGKVPNRVGIENRPAIVD
FT                   QKSRIGDWEADTIVGKGQKSALLTLVERVTRYTIICKLDSLKAEDTARAAVRTLKAHKD
FT                   RVHTITMDNGKEFYQHTKITKALKAETYFCRPYHSWEKGLNENTNGLIRQYFPKQTDFR
FT                   NISDREIRRVQDELNHRPRKTLGYETPSVLFLNLFQPLIH"
FT   CDS_pept        complement(28626..31316)
FT                   /transl_table=11
FT                   /locus_tag="NMA0035"
FT                   /product="putative glutamate-ammonia-ligase
FT                   adenylyltransferase"
FT                   /EC_number="2.7.7.42"
FT                   /note="NMA0035, glnE, probable glutamate-ammonia-ligase
FT                   adenylyltransferase, len: 896 aa; similar to e.g.
FT                   GLNE_ECOLI glutamate-ammonia-ligase adenylyltransferase (EC
FT                   2.7.7.42) (946 aa), fasta scores; E(): 0, 37.6% identity in
FT                   901 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0035"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07361"
FT                   /db_xref="GOA:Q9JX72"
FT                   /db_xref="InterPro:IPR005190"
FT                   /db_xref="InterPro:IPR013546"
FT                   /db_xref="InterPro:IPR023057"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9JX72"
FT                   /protein_id="CAM07361.1"
FT                   /translation="MSDNRLDTARHHSLFLARQLDNGKLKPEIFLPMLDKVLTEADFQA
FT                   FADWDKIRAEENEEELARQLRELRRYVVSQIIVRDINRISDLNEVTRTITLFADFAVNT
FT                   ALDFAYAYYRDMYGTPIGRYTKSPQHLSVVAMGKAGGYELNVSSDIDLIFVYPESGDTD
FT                   GRRERGNQEFFTKVGQKLIALLNDITADGQVFRVDMRLRPDGDSGALVLSETALEQYLI
FT                   TQGREWERYAWCKGRVVTPYPNGIKSLVRPFVFRKYLDYSAYEAMRKLHRQISSEVSKK
FT                   GMADNIKLGAGGIREVEFIAQIFQMIRGGQMRALQLKGTQETLKKLAETGIMPSENVET
FT                   LLAAYRFLRDVEHRLQYWDDQQTQTLPTSPEQRQLLAESMGFDSYSAFSDGLNIHRNKV
FT                   NQLFNEILSEPEEQTQDNSEWQWAWQEKPDEEERLGRLKEYGFDAETIATRLDQIRNGH
FT                   KYRHLSAHAQPRFDAIVPLFVQAAAEQNNPTDTLMRLLDFLENISRRSAYLAFLNEHPQ
FT                   TLAQLAQIMGQSSWVAAYLNKYPILLDELISAQLLDTAFDWQALAAALSDDLKACGGDT
FT                   EAQMDTLRRFQHAQVFRLAVQDLAGLWTVESLSDQLSALADTILAAALLCAWADMPKKH
FT                   RDTPQFAIVGYGKLGGKELGYASDLDLVYLYDDPHPDAGDVYSRLARRLTNWLSTATGA
FT                   GSLYETDLRLRPNGDAGFLAHSIAAFEKYQRENAWTWEHQSLTRARFICGTPEIQTAFD
FT                   RIRTEILTAERDQTALSGEIIEMREKMFPTHPPADSNVKYARGGVVDVEFIVQYLILAH
FT                   ARQYPQLLDNYGNIALLNIAADCGLIDKTLAGQSRTAYRFYRRQQHNTKLRDAKKTEVT
FT                   GELLAHYGNVRKLWREVFGEEAATA"
FT   CDS_pept        complement(31491..31826)
FT                   /transl_table=11
FT                   /locus_tag="NMA0036"
FT                   /product="hypothetical protein NMA0036"
FT                   /note="NMA0036, unknown, len: 111 aa"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0036"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07362"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RGQ8"
FT                   /protein_id="CAM07362.1"
FT                   /translation="MTVDKEQVEKMIYSENKQSVIDGMLGMTFSSEEDEIPWISEKLTE
FT                   LSKHKDLDIARLSLTCFGHLARMHENIGDCDKVIALLLSKQGDPDFQGFAEDALDEISL
FT                   FIFKKRP"
FT   CDS_pept        complement(32080..32553)
FT                   /transl_table=11
FT                   /locus_tag="NMA0037"
FT                   /product="hypothetical protein NMA0037"
FT                   /note="NMA0037, unknown, len: 157 aa"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0037"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07363"
FT                   /db_xref="InterPro:IPR016630"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RGQ9"
FT                   /protein_id="CAM07363.1"
FT                   /translation="MNLDLTAQKVRLSWKDILWGYGNKYLGWADVAAYARKMTLSDHDE
FT                   RVFKLSLINKSNILELKPVLEDLASEMRDYSPKNWLYVLLSDVFHRKEEFEDPLGEVEK
FT                   IYADFDYPEEIESFVRYMPPKDGYIPSAHTYEENIARLYSHWEHYLNNGGGQG"
FT   CDS_pept        complement(32606..32887)
FT                   /transl_table=11
FT                   /locus_tag="NMA0038"
FT                   /product="hypothetical protein NMA0038"
FT                   /note="NMA0038, unknown, len: 93 aa; highly similar to
FT                   NMA2116, fasta scores; E(): 0, 88.2% identity in 93 aa
FT                   overlap"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0038"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07364"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RGR0"
FT                   /protein_id="CAM07364.1"
FT                   /translation="MENGQRNNRFPLEKRIFYLEHSGRYLMICALSDYSQNKHTVVMAN
FT                   FIYPDEKTDWRNLDDLFNELVLEELQASFMDWHPTVEEAISRHLEDFS"
FT   CDS_pept        complement(32974..33297)
FT                   /transl_table=11
FT                   /locus_tag="NMA0039"
FT                   /product="hypothetical protein NMA0039"
FT                   /note="NMA0039, unknown, len: 107 aa"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0039"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07365"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RGR1"
FT                   /protein_id="CAM07365.1"
FT                   /translation="MFKDELNEFIRLISDPESELDEWYLSDFKDEHIWEMQSYEAFSCL
FT                   REAVPYLFAYPRYGYELLEIISALKETSDTTELFYEPGIVPLLIALYKEDSYLVNMVKR
FT                   IFK"
FT   CDS_pept        complement(33630..34637)
FT                   /transl_table=11
FT                   /locus_tag="NMA0042"
FT                   /product="dihydroorotate dehydrogenase"
FT                   /EC_number="1.3.3.1"
FT                   /note="NMA0042, pyrD, dihydroorotate dehydrogenase, len:
FT                   335 aa; similar to many e.g. PYRD_SALTY dihydroorotate
FT                   dehydrogenase (EC 1.3.3.1) (336 aa), fasta scores; E():
FT                   0,54.7% identity in 331 aa overlap. Contains Pfam match to
FT                   entry PF01180 DHOdehase, Dihydroorotate dehydrogenase, and
FT                   PS00911 Dihydroorotate dehydrogenase signature 1"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0042"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07366"
FT                   /db_xref="GOA:Q9JX66"
FT                   /db_xref="InterPro:IPR001295"
FT                   /db_xref="InterPro:IPR005719"
FT                   /db_xref="InterPro:IPR005720"
FT                   /db_xref="InterPro:IPR012135"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9JX66"
FT                   /protein_id="CAM07366.1"
FT                   /translation="MYPLARRILFALDAEKAHHFTLDALYTVYKLGLIPVTDNRTKPVK
FT                   LMGMDLPNPVGLAAGLDKNGEYIDALGALGFGFIEIGTVTPKPQPGNPQPRLFRVPEHQ
FT                   GIINRMGFNNHGIDTMIRNIEKSKFSGVLGINIGKNAVTPIENAADDYLICLEKAYAHA
FT                   SYITVNISSPNTKNLRALQGGDELSALLEALKNKQAQLASVYGKYVPLAVKIAPDLDEA
FT                   QIEDIAHVVKSVEMDGIIATNTTIDKSSLGSHPLAGEQGGLSGLPVHEKSNRVLKLLAD
FT                   HIDGKLPIIGVGGIMEGGDAADKIRLGATAVQVYSGLIYKGPALVKECLKALAR"
FT   CDS_pept        34869..35105
FT                   /transl_table=11
FT                   /locus_tag="NMA0043"
FT                   /product="acyl carrier protein"
FT                   /note="NMA0043, acpP, acyl carrier protein, len: 78 aa;
FT                   highly similar to many e.g. ACP_VIBHA acyl carrier protein
FT                   (76 aa), fasta scores; E(): 2e-20, 79.7% identity in 74 aa
FT                   overlap. Contains Pfam match to entry PF00550
FT                   pp-binding,Phosphopantetheine attachment site, score 85.00,
FT                   and PS00012 Phosphopantetheine attachment site"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0043"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07367"
FT                   /db_xref="GOA:P63441"
FT                   /db_xref="InterPro:IPR003231"
FT                   /db_xref="InterPro:IPR006162"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="UniProtKB/Swiss-Prot:P63441"
FT                   /protein_id="CAM07367.1"
FT                   /translation="MSNIEQQVKKIVAEQLGVNEADVKNESSFQDDLGADSLDTVELVM
FT                   ALEEAFGCEIPDEDAEKITTVQLAIDYINAHNG"
FT   CDS_pept        35272..36519
FT                   /transl_table=11
FT                   /locus_tag="NMA0044"
FT                   /product="3-oxoacyl-[acyl-carrier-protein] synthase II"
FT                   /EC_number="2.3.1.41"
FT                   /note="NMA0044, fabF, probable
FT                   3-oxoacyl-[acyl-carrier-protein] synthase II, len: 415 aa;
FT                   highly similar to many e.g. FABF_ECOLI
FT                   3-oxoacyl-[acyl-carrier-protein] synthase II (EC 2.3.1.41)
FT                   (412 aa), fasta scores; E(): 0; 60.4% identity in 414 aa
FT                   overlap. Contains Pfam match to entry PF00109
FT                   ketoacyl-synt, Beta-ketoacyl synthase, PS00606
FT                   Beta-ketoacyl synthases active site, and PS00107 Protein
FT                   kinases ATP-binding region signature. Also similar to
FT                   NMA1957 fabF2, fasta scores; E(): 0, 36.9% identity in 374
FT                   aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0044"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07368"
FT                   /db_xref="GOA:A0A0U1RGR2"
FT                   /db_xref="InterPro:IPR000794"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR014031"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR017568"
FT                   /db_xref="InterPro:IPR018201"
FT                   /db_xref="InterPro:IPR020841"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RGR2"
FT                   /protein_id="CAM07368.1"
FT                   /translation="MSQRRVVITGLGQVSPVGNTVAEAWDTLLAGKSGIGAITRFDASD
FT                   INSRVAGEVRGFDIGQYISAKEARRMDVFIHYGIAAALQAIADSGLDDVENLDKDRIGV
FT                   NIGSGIGGLPSIEVTGKAVIEGGARKINPFFIPGSLINLISGHVTILKGYRGPSYGMVS
FT                   ACTTGAHAIGNSARLIKYGDADIMVAGGAEGAISTLGVGGFAAMKALSTRNDDPATASR
FT                   PWDKGRDGFVIGEGAGILVLEELEHAKKRGAKIYAEIVGFGMSSDAYHITAPNEEGPAL
FT                   AVTRALKDAGINPEDVDYVNAHGTSTPLGDANETKALKRAFGEHAYKTVVSSTKSMTGH
FT                   LLGAAGGVEAVYSILAIHDGKIPPTINIFEQDVEAGCDLDYCANEARDAEIDVAISNSF
FT                   GFGGTNGTLVFKRFKG"
FT   CDS_pept        complement(36762..37718)
FT                   /transl_table=11
FT                   /locus_tag="NMA0046"
FT                   /product="putative transmembrane transport protein"
FT                   /note="NMA0046, probable transmembrane transport
FT                   protein,len: 318 aa; similar to members of the SBF family
FT                   e.g. TR:O34524 (EMBL:AF027868) B. subtilis putative
FT                   transporter YOCS (321 aa), fasta scores; E(): 0, 37.7%
FT                   identity in 305 aa overlap, and NTCI_HUMAN ileal
FT                   sodium/bile acid cotransporter (348 aa), fasta scores; E():
FT                   2.4e-13, 27.8% identity in 252 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0046"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07369"
FT                   /db_xref="GOA:A0A0U1RGR3"
FT                   /db_xref="InterPro:IPR002657"
FT                   /db_xref="InterPro:IPR004710"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RGR3"
FT                   /protein_id="CAM07369.1"
FT                   /translation="MMGFLIGLSRNLTRFTALVILLASAVAFIGPTSFAWVKGDVQVLV
FT                   LGIIMLGMGMTLGREDYRILAQRPLDVFIGAAVQYTVMPLLAIGIAKLFDLSLGLTLGL
FT                   VLVGTCPGGVSSNIMSFLAKGDVAFSVGMTTVSTVLAPAVTPLWMTCLVGQTVDMDGWG
FT                   MFRFMLLVTLLPVVLGSAANILLHGKHWFENVRAVMPGVAVLAFACIVGGVASVHGHRF
FT                   AESALVMVLAIAVHNIAGYVSGYYAAALFGMDTAKKRTLAIEVGVQNAGLATGLSAKFF
FT                   PGNAESAVAAAVACVWHSVSGTVLGNLFALWDKRRDA"
FT   CDS_pept        38144..39361
FT                   /transl_table=11
FT                   /locus_tag="NMA0047"
FT                   /product="putative transmembrane transport protein"
FT                   /note="NMA0047, probable transmembrane transport
FT                   protein,len: 405 aa; similar to e.g. YHJX_ECOLI
FT                   hypothetical protein (402 aa), fasta scores; E(): 7.9e-17,
FT                   24.7% identity in 397 aa overlap, and TR:Q51330
FT                   (EMBL:U40075) Oxalobacter formigenes oxalate:formate
FT                   antiport protein (418 aa), fasta scores; E(): 1.5e-16,
FT                   26.8% identity in 377 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0047"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07370"
FT                   /db_xref="GOA:A0A0U1RGR4"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RGR4"
FT                   /protein_id="CAM07370.1"
FT                   /translation="MTHTASKTPKFWLTITAAAFILLITIGMRMTLGLFVQPVVNTTEL
FT                   SIAQFSLIIAVFQLMWGVSQPLSGALADRFGAFRVLSGGAVLLVCACLIAPNIPTYWGL
FT                   MIAVGLLLAFGTGSGGFSIIMGQVAAQVPAHKRGLASGLVNAGGSAGQFLFAPLVQGLV
FT                   VLPEVGWTGTFYVWGAIALLTLPVSWWLAGGNNAAHTQHAQATHGQSLGEAVKTAFKTP
FT                   SYILLHLSFFACGFHIAFLVTHLPTEVALCGLPATVASTSIAIIGLANIAGCIFSGWCT
FT                   SRVRGKYVLFGLYASRAAMILIYIFSPKTDLNFYIFAAALGFTWLATVTPTASITGKLF
FT                   GTRYLATLFGLTMLSHQIGGFLGSYIGGIVITQFGDYGWMWYADALLAGTAALLNLPIR
FT                   EPRTAA"
FT   CDS_pept        39717..40850
FT                   /transl_table=11
FT                   /locus_tag="NMA0048"
FT                   /product="glycosyltransferase"
FT                   /note="NMA0048, pglA, glycosyltransferase, len: 377 aa;
FT                   almost identical to TR:O87893 (EMBL:U73942) N.m.
FT                   glycosyltransferase involved in pilin glycosylation (376
FT                   aa), fasta scores; E(): 0, 98.9% identity in 377 aa
FT                   overlap. Also similar to many others e.g. TR:Q53982
FT                   (EMBL:M96064) Shigella dysenteriae RFP protein (377
FT                   aa),fasta scores; E(): 0, 48.5% identity in 377 aa
FT                   overlap,Contains Pfam match to entry PF00534
FT                   Glycos_transf_1, Glycosyl transferases group 1, and (g)14
FT                   tract at aa 246"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0048"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07371"
FT                   /db_xref="GOA:A0A0U1RGR5"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RGR5"
FT                   /protein_id="CAM07371.1"
FT                   /translation="MKIVFITTVASSIYGFRAPVIKKLIGKNHQVYAFVSEFSDNELDI
FT                   IREMGVTPVTYRSNRSGLNPFSDIKSTFLIFKELKKISPDLVFPYFAKPVIFGTFAAKL
FT                   AGVPRIVGMLEGLGFAFTPQPEGIPLKTKIIKGILITLYRIALPMLESLIVLNPDDKDE
FT                   LTDKYGIKIKNIHILGGIGLDLRQYPYSEADIPDEKEPVKFLFIGRFLKEKGIDDFIRA
FT                   AEQVKDKYPDTVFTALGAIDKSRGGGGGDLERLAARDIIRFPGFVNNVSEVIKEHHIFV
FT                   LPSYYREGVPRSTQEAMAVGRAVITTDVPGCRETVADKVNGFLIEPWNPRILAEKMIYF
FT                   IENREAIRLMGNASYAIAKDKFDAEKVDLKLLDILKA"
FT   CDS_pept        complement(41790..42641)
FT                   /transl_table=11
FT                   /locus_tag="NMA0049"
FT                   /product="RNA polymerase sigma factor"
FT                   /note="NMA0049, probable RNA polymerase sigma factor, len:
FT                   283 aa; similar to many members of the sigma-54 family e.g.
FT                   RP54_ALCEU RNA polymerase sigma-54 factor (493 aa),fasta
FT                   scores; E(): 4.7e-11, 31.4% identity in 303 aa overlap, and
FT                   RP54_ECOLI RNA polymerase sigma-54 factor (477 aa), fasta
FT                   scores; E(): 0.034, 32.2% identity in 273 aa overlap.
FT                   Contains PS00718 Sigma-54 factors family signature 2"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0049"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07372"
FT                   /db_xref="GOA:A0A0U1RGR6"
FT                   /db_xref="InterPro:IPR000394"
FT                   /db_xref="InterPro:IPR007046"
FT                   /db_xref="InterPro:IPR007634"
FT                   /db_xref="InterPro:IPR038709"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RGR6"
FT                   /protein_id="CAM07372.1"
FT                   /translation="MTLLGIKLKQTQQLNQRLQQSLRVLQMSGIELEREVENWLSDNPL
FT                   LERKDTDEFSDAEFSHYTAPARQIGGDEGEDMLSNIAGEQDFKQYLHAQVCEHPLSDQE
FT                   SACVHILIDFLDEQGYLTDSIEDILDHTPLEWMLDEAMLKQALTALKKFDPAGVAAADL
FT                   NESLILQIERSGECAAKPSALHIVRNALDSIDGNRSQTLARIKKRLPQTDSGTLEAALD
FT                   LIASLNPFPAVGFASSTPTPYSDEALANLLAFRGMEVSRRTIAKYRESFEIPAAHKRKT
FT                   AE"
FT   CDS_pept        42989..44503
FT                   /transl_table=11
FT                   /locus_tag="NMA0050"
FT                   /product="catalase"
FT                   /EC_number="1.11.1.6"
FT                   /note="NMA0050, katA, catalase, len: 504 aa; highly similar
FT                   to many e.g. CATA_HAEIN catalase (EC 1.11.1.6) (508 aa),
FT                   fasta scores; E(): 0, 91.7% identity in 507 aa overlap.
FT                   Contains Pfam match to entry PF00199 catalase,Catalase,
FT                   PS00438 Catalase proximal active site signature, and
FT                   PS00437 Catalase proximal heme-ligand signature"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0050"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07373"
FT                   /db_xref="GOA:A0A0U1RGR7"
FT                   /db_xref="InterPro:IPR002226"
FT                   /db_xref="InterPro:IPR010582"
FT                   /db_xref="InterPro:IPR011614"
FT                   /db_xref="InterPro:IPR018028"
FT                   /db_xref="InterPro:IPR020835"
FT                   /db_xref="InterPro:IPR024708"
FT                   /db_xref="InterPro:IPR024711"
FT                   /db_xref="InterPro:IPR037060"
FT                   /db_xref="InterPro:IPR040333"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RGR7"
FT                   /protein_id="CAM07373.1"
FT                   /translation="MTTSKCPVTHLTMNNGAPVADNQNSLTAGPRGPLLAQDLWLNEKL
FT                   ADFVREVIPERRMHAKGSGAFGTFTVTHDITKYTRAKIFSEVGKKTEMFARFTTVAGER
FT                   GAADAERDIRGFALKFYTEEGNWDVVGNNTPVFFLRDPRKFPDLNKAVKRDPRTNMRSA
FT                   TNNWDFWTLLPEALHQVTIVMSDRGIPAGYRHMHGFGSHTYSFWNEAGERFWVKFHFRT
FT                   QQGIKNLTNEEAAKIIADDRESHQRDLYEAIERGEFPKWTMYIQVMPEADAEKVPYHPF
FT                   DLTKVWPKKDYPLIEVGEFELNRNPENFFADVEQSAFAPSNLVPGVGASPDKMLQARLF
FT                   NYADAQRYRLGVNFRQIPVNRPRCPVHSNQRDGQGRADGNYGSLPHYEPNSFGQWQQQP
FT                   DFAEPPLKINGDAAHWDYRQDDDDYFSQPRALFNLMNDAQKQALFGNTAAAMGDAPDFI
FT                   KYRHIRNCYRCDPAYGEGVAKALGLTVEDAQAARATDPALGQAGLL"
FT   CDS_pept        44988..45554
FT                   /transl_table=11
FT                   /locus_tag="NMA0052"
FT                   /product="putative integral membrane protein"
FT                   /note="NMA0052, probable integral membrane protein, len:
FT                   188 aa; similar to hypothetical proteins belonging to the
FT                   UPF0059 family e.g. YEBN_ECOLI (206 aa), fasta scores; E():
FT                   1.5e-29, 48.9% identity in 186 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0052"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07374"
FT                   /db_xref="GOA:Q9JX59"
FT                   /db_xref="InterPro:IPR003810"
FT                   /db_xref="InterPro:IPR022929"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9JX59"
FT                   /protein_id="CAM07374.1"
FT                   /translation="MGFYALLLIALGMSMDAFAVALAKGAAVRMPPRKIAATALVFGSV
FT                   EALTPLAGWVGGFYAKPFISEWDHWAAFVLLGGLGLKMMREGLSGKAEDVRESKRESLW
FT                   MTVLTAFGTSIDSMIVGVGLAFMEVNIAFAAAIIGMATTVMVAVGLAAGGALGGLFGKR
FT                   AEFAGGLVLIAIGTWTLLSHLGLIG"
FT   CDS_pept        complement(45987..48023)
FT                   /transl_table=11
FT                   /locus_tag="NMA0054"
FT                   /product="oligopeptidase A"
FT                   /EC_number="3.4.24.70"
FT                   /note="NMA0054, prlC, probable oligopeptidase A, len: 678
FT                   aa; similar to many e.g. OPDA_ECOLI oligopeptidase A (EC
FT                   3.4.24.70) (680 aa), fasta scores; E(): 0, 49.9% identity
FT                   in 679 aa overlap. Contains Pfam match to entry PF01432
FT                   Peptidase_M3, Peptidase family M3, and PS00017
FT                   ATP/GTP-binding site motif A (P-loop)"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0054"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07375"
FT                   /db_xref="GOA:A0A0U1RGR8"
FT                   /db_xref="InterPro:IPR001567"
FT                   /db_xref="InterPro:IPR024077"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RGR8"
FT                   /protein_id="CAM07375.1"
FT                   /translation="MTDNALLHLGEEPRFDQIKTEDIKPALQTAIAEAREQIAAIKAQT
FT                   HTGWANTVEPLTGITERVGRIWGVVSHLNSVTDTPELRAAYNELMPEITVFFTEIGQDI
FT                   ELYNRFKTIKNSPEFDTLSHAQKTKLNHDLRDFVLSGAELPPEQQAELAKLQTEGAQLS
FT                   AKFSQNVLDATDAFGIYFDDAAPLAGIPEDALAMFAAAAQSEGKTGYKIGLQIPHYLAV
FT                   IQYADNRKLREQIYRAYVTRASELSDDGKFDNTANIDRTLENALQTAKLLGFKNYAELS
FT                   LATKMADTPEQVLNFLHDLARRAKPYAEKDLAEVKAFARESLGLADLQPWDLGYAGEKL
FT                   REAKYAFSETEVKKYFPVGKVLNGLFAQIKKLYGIGFTEKTVPVWHKDVRYFELQQNGE
FT                   TIGGVYMDLYAREGKRGGAWMNDYKGRRRFSDGTLQLPTAYLVCNFTPPVGGKEARLSH
FT                   DEILTLFHETGHGLHHLLTQVDELGVSGINGVEWDAVELPSQFMENFVWEYNVLAQMSA
FT                   HEETGVPLPKELFDKMLAAKNFQRGMFLVRQMEFALFDMMIYSEDDEGRLKNWQQVLDS
FT                   VRKEVAVVRPPEYNRFANSFGHIFAGGYSAGYYSYAWAEVLSADAYAAFEESDDVAATG
FT                   KRFWQEILAVGGSRSAAESFKAFRGREPSIDALLRHSGFDNAA"
FT   CDS_pept        complement(48111..49097)
FT                   /transl_table=11
FT                   /locus_tag="NMA0055"
FT                   /product="putative integral membrane protein"
FT                   /note="NMA0055, probable integral membrane protein, len:
FT                   328 aa"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0055"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07376"
FT                   /db_xref="GOA:A0A0U1RGR9"
FT                   /db_xref="InterPro:IPR006685"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RGR9"
FT                   /protein_id="CAM07376.1"
FT                   /translation="MKRYVCLRHQVGDCPVKWQKRFFATKIYTLYFSDRGAEMEIWNML
FT                   DTWLGAVPIRAEAVESVAVVAALLLARALLLNIHFKRHPDFGIESKRRFLVASRNITLL
FT                   LVLFSLAFIWSAQIQTLALSMFAVAAAVVVATKELIMCLSGSILRSATQQYSVGDYIEI
FT                   NGLRGRVVDINLLNTLMMQVGPNPLVGQLAGTTVSFPNSLLLSHPVRRDNILGDYVIHT
FT                   VEIPVPIHLDSDEAVCRLKAVLEPLCAPYIPAIQRHLENVQAEKLFITPAAKPRVTRVP
FT                   YDDKAYRIIVRFASPVSKRLEIQQAVMDEFLRVQYRLLNYPAGSETL"
FT   CDS_pept        49253..51643
FT                   /transl_table=11
FT                   /locus_tag="NMA0056"
FT                   /product="DNA gyrase subunit B"
FT                   /EC_number="5.99.1.3"
FT                   /note="NMA0056, gyrB, DNA gyrase subunit B, len: 796 aa;
FT                   highly similar to GYRB_NEIGO DNA gyrase subunit B (EC
FT                   5.99.1.3) (781 aa),fasta scores; E(): 0, 95.7% identity in
FT                   796 aa overlap, and to GYRB_ECOLI DNA gyrase subunit B (EC
FT                   5.99.1.3) (803 aa),fasta scores; E(): 0, 60.3% identity in
FT                   800 aa overlap. Contains Pfam match to entry PF00204
FT                   DNA_topoisoII, DNA topoisomerase II (N-terminal
FT                   region),Pfam match to entry PF00986 DNA_gyraseB_C, DNA
FT                   gyrase B subunit, carboxyl terminus, and PS00177 DNA
FT                   topoisomerase II signature"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0056"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07377"
FT                   /db_xref="GOA:A0A0U1RGS0"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR034160"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR041423"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RGS0"
FT                   /protein_id="CAM07377.1"
FT                   /translation="MTEQKHEEYGADSIQVLEGLEAVRKRPGMYIGDTQDGSGLHHMVF
FT                   EVLDNAIDEALAGHCDKITVTIHADHSVSVADNGRGMPTGIHPKEGRSAAEVIMTVLHA
FT                   GGKFDNNSYKISGGLHGVGVSVVNALSDWVTLTIYRDGKEHFVRFVRGETEEPLKVVGD
FT                   SDKKGTTVRFLASTETFGNVEYSFDILAKRIRELSFLNNGVDIELTDERDGKHESFALS
FT                   GGVAGFVQYMNRKKTPLHEKIFYAFGEKDGMSVECAMQWNDSYQESVQCFTNNIPQRDG
FT                   GTHLTALRQVMTRTINSYIEANEVAKKAKVETAGDDMREGLTCVLSVKLPDPKFSSQTK
FT                   DKLVSGEIGPVVNEVISQALTDFLEENPAEAKIITGKIVDAARAREAARKAREITRRKG
FT                   VMDGLGLPGKLADCQEKDPALSELYLVEGDSAGGSAMQGRDRKFQAILPLKGKILNVEK
FT                   ARFEKMLASQEVAALITALGAGIGKEEFNAEKLRYHRIIIMTDADVDGAHIRTLLLTFF
FT                   YRQMPELVERGYIYIAQPPLYKAKYGKQERYLKDELEKDQWLLGLALEKAKIISDGRTI
FT                   EGAELADTAKQFLLAKTVIEQESRFVDELVLRAMLHASPIDLTSSENADKAVAELSGLL
FT                   DEKEVALERIEGHEGHRFIKITRKLHGNVMVSYIEPKFLNSKAYQTLTQTAAALKGMVG
FT                   EGAKLYKGENGYDADSFETALDILMSVAQKGMSIQRYKGLGEMNPEQLWETTMDPAVRR
FT                   LLKVRIEDAIAADEVFVTLMGDEVEPRRAFIENNALIAQNIDA"
FT   CDS_pept        51962..53281
FT                   /transl_table=11
FT                   /locus_tag="NMA0057"
FT                   /product="L-serine dehydratase"
FT                   /EC_number="4.2.1.13"
FT                   /note="NMA0057, sdaA, probable L-serine dehydratase, len:
FT                   439 aa; similar to many e.g. SDHL_STRCO L-serine
FT                   dehydratase (EC 4.2.1.13) (455 aa), fasta scores; E():
FT                   0,51.7% identity in 433 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0057"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07378"
FT                   /db_xref="GOA:A0A0U1RGS1"
FT                   /db_xref="InterPro:IPR004644"
FT                   /db_xref="InterPro:IPR005130"
FT                   /db_xref="InterPro:IPR005131"
FT                   /db_xref="InterPro:IPR029009"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RGS1"
FT                   /protein_id="CAM07378.1"
FT                   /translation="MKAAAAFATGLDAQAVRIVIDIYGSLALTGYGHGTFDALMLGLEG
FT                   SLPHDIPLAGIPERLERIRTQHILRLNGQEIRFIPDRDLNILGNQVLPKHPNGLRFTAY
FT                   ASDGTVLKEQVYYSVGGGFVVTEEDFDRQAETEKAVPYPYTSCAELLARCRLNRLDISE
FT                   VVLANEAALAGCGEAEIRRRAAAVAEVMEGCIKRGLGADGELPGGLNVRRRAPQLAAKL
FT                   KVLRETEIVNTQLWPMVYAMAVNEENAVGGRVVTAPTNGAAGIIPAVLHYFRKFNPHAT
FT                   QERVENFLLTAGAIGILYKTNASISGADVGCQGEVGVACSMAAGAYAEVIGGTPKQVEN
FT                   AAEMAMEHHLGLTCDPVGGLVQIPCIERNGIAAEKALKLGTLALLEDGTDKKVSLDEVI
FT                   RTMLQTGRDMKSTYKETSLAGLAATLRKKAVPVSVRVVEC"
FT   CDS_pept        complement(53828..54172)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="NMA0059"
FT                   /product="pseudogene (modification methylase)"
FT                   /EC_number="2.1.1.72"
FT                   /note="NMA0059, probable modification methylase gene
FT                   remnant, len: 114 aa; almost identical to the N-terminus of
FT                   MTN3_NEILA modification methylase NLAIII (EC 2.1.1.72) (334
FT                   aa), fasta scores; E(): 6.3e-29, 78.6% identity in 98 aa
FT                   overlap"
FT                   /db_xref="PSEUDO:CAM07379.1"
FT   CDS_pept        complement(54687..56663)
FT                   /transl_table=11
FT                   /locus_tag="NMA0060"
FT                   /product="putative transmembrane transport protein"
FT                   /note="NMA0060, probable transmembrane transport
FT                   protein,len; 658 aa; similar to e.g. KEFB_ECOLI
FT                   glutathione-regulated potassium-efflux system protein KEFB
FT                   (601 aa), fasta scores; E(): 0, 33.6% identity in 563 aa
FT                   overlap, Contains PS00213 Lipocalin signature"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0060"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07380"
FT                   /db_xref="GOA:A0A0U1RGS3"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RGS3"
FT                   /protein_id="CAM07380.1"
FT                   /translation="MNEFSLAPIVIVLLVSVITVILCRKFNIPSMLGYLLVGFLAGPGM
FT                   LSLIPKSHATDYLGEIGIVFLMFSIGLEFSLPKLRAMRRLVFGLGGLQVGVTMLSVMGI
FT                   LMLTGVPFNWAFAVSGALAMSSTAIVSRILSEKTELGQPHGQMAMGVLLMQDIAVVPLM
FT                   ILIPALAGGGDGNIWAALGLAFAKMLLTLGLLFFVGSKIMSRWFRMVAKRKSSELFMIN
FT                   VLLVTLGVAYLTELEGLSMALGAFVAGMLLSETEYRFQVEDDIRPFRDILLGFFFITVG
FT                   MKLDIQALIGGWRQVLMLLAMLLVLKALVVFAIAFKMKHSVGDSLKTALYLAQGGEFGF
FT                   VMLAIAGQLDMVSLEWEQAATAAVLLSMIIAPFLLGGSDALVGRLVKSSWDMKSLDLHS
FT                   MLVETMSKSDHVLIVGFGRGGQTVGRVLAQEDIPYFALDLDIARVQVARSAGEPVSFGD
FT                   AKRREVLEAAGLGRAKMVVVTLNNMHETQHVLDNVLSMYPNMPVYVRATNDDYVKTFTD
FT                   IGAEEAVSDTKETGLVLAGYAMLGNGASYRHVYQTMANIRHSRYAALEGLFVGSDDEAG
FT                   FGETGETVRHAFPLAAEAYAVGKTVGTLPMAAYGIKLLFVRRRTGRIENPDASFTLEGG
FT                   DVLVVAGKKEEIISFENWSLQGI"
FT   CDS_pept        56812..57651
FT                   /transl_table=11
FT                   /locus_tag="NMA0061"
FT                   /product="putative ferredoxin"
FT                   /note="NMA0061, probable ferredoxin, len: 279 aa; similar
FT                   to e.g. YDGM_ECOLI putative ferredoxin-like protein (192
FT                   aa), fasta scores; E(): 2.7e-23, 52.9% identity in 153 aa
FT                   overlap. Contains Pfam match to entry PF00037 fer4, 4Fe-4S
FT                   ferredoxins and related iron-sulfur cluster binding
FT                   domains., and 2x PS00198 4Fe-4S ferredoxins, iron-sulfur
FT                   binding region signature"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0061"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07381"
FT                   /db_xref="GOA:A0A0U1RGS4"
FT                   /db_xref="InterPro:IPR007202"
FT                   /db_xref="InterPro:IPR010207"
FT                   /db_xref="InterPro:IPR016463"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RGS4"
FT                   /protein_id="CAM07381.1"
FT                   /translation="MTATAAAIDRLLPQTQCRECGYDGCLPYAQAVATGEAYNLCAPGG
FT                   EAVIRDISALLGKPLVAPAKTQAKALAQIDETACIGCTACIRACPADAIMGAGKLMHTV
FT                   IADECTGCGLCVAPCPVDCIHMQPVADTVLPRARRFSLSADSRFAAAEHARARYLKRNE
FT                   RKQREADERKAMLAEREAAVRNARPQTPDTPKKPAFNPADLIAKAMAKAQTQQDRLAAA
FT                   DNRKDYQAKQIAEARERAELRRAQRDMKYGSDSEKAAALEYLKQYKAKQEAAQNTAS"
FT   CDS_pept        57851..58882
FT                   /transl_table=11
FT                   /locus_tag="NMA0062"
FT                   /product="glyceraldehyde 3-phosphate dehydrogenase"
FT                   /EC_number="1.2.1.12"
FT                   /note="NMA0062, gapA, glyceraldehyde 3-phosphate
FT                   dehydrogenase, len: 343 aa; similar to many e.g. G3PP_ALCEU
FT                   glyceraldehyde 3-phosphate dehydrogenase,plasmid (EC
FT                   1.2.1.12) (336 aa), fasta scores; E(): 0,67.4% identity in
FT                   331 aa overlap. Contains Pfam match to entry PF00044 gpdh,
FT                   glyceraldehyde 3-phosphate dehydrogenases, and PS00071
FT                   Glyceraldehyde 3-phosphate dehydrogenase active site. Also
FT                   similar to gapC, NMA0246,fasta scores; E(): 0, 50.7%
FT                   identity in 341 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0062"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07382"
FT                   /db_xref="GOA:A0A0U1RGS5"
FT                   /db_xref="InterPro:IPR006424"
FT                   /db_xref="InterPro:IPR020828"
FT                   /db_xref="InterPro:IPR020829"
FT                   /db_xref="InterPro:IPR020830"
FT                   /db_xref="InterPro:IPR020831"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RGS5"
FT                   /protein_id="CAM07382.1"
FT                   /translation="MGIKVAINGYGRIGRQVLRAIYDYQIQDQLQIVAVNASGSLETNA
FT                   HLTKFDTVHGRFEADVSHDGGNLIVNGDKIPFFSTRNPAELPWKELGVDLVMECTGAFT
FT                   SKEKAKVHLESGAKKVLISAPGGDDVDATVVYGVNDSILTADMTVVSNASCTTNCLSPV
FT                   AKVLSESVGIVKGAMTTIHALTNDQTVTDVRHKDLRRARSGVENMIPTKTGAAKAVGLV
FT                   LPELKDKLDGLAIRVPTVNVSLVDLNFQAARDTTIEEINALMKAASEAGALKGVLGYNT
FT                   LPLVSMDFNHTTEASHFDATLTKVVDGNMIKVFAWYDNEWGFSCQMLNTARRMFGLEVR
FT                   PLK"
FT   CDS_pept        complement(59138..59863)
FT                   /transl_table=11
FT                   /locus_tag="NMA0063"
FT                   /product="leucyl/phenylalanyl-tRNA--protein transferase"
FT                   /EC_number="2.3.2.-"
FT                   /note="NMA0063, aat, leucyl/phenylalanyl-tRNA--protein
FT                   transferase, len: 241 aa; similar to e.g. LPTP_ECOLI
FT                   leucyl/phenylalanyl-tRNA--protein transferase (EC 2.3.2.-)
FT                   (234 aa), fasta scores; E(): 3.6e-29, 39.2% identity in 222
FT                   aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0063"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07383"
FT                   /db_xref="GOA:Q9JX50"
FT                   /db_xref="InterPro:IPR004616"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR042203"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9JX50"
FT                   /protein_id="CAM07383.1"
FT                   /translation="MRIPLLAPDNYAFPDPAYALAWCDGLVGVSGDLDAGRLLEAYQNG
FT                   VFPWFLRDGWFFWYAVGPRAVIVPERLHVPCSLAKTLRNGSYRVAVNGCFAEVVAHCAA
FT                   AARPNQDGTWIAPEFQTAYLKLHEMGYAHSFECHYPDENGKTRLAGGFYGVQIGRVFYG
FT                   ESMFALQPDASKIAFACAVPFLADLGVELIDCQQDTEHMRRFGSELLPFADFAERLRML
FT                   NAVPLKEEIGRREVACRGL"
FT   CDS_pept        complement(59933..60367)
FT                   /transl_table=11
FT                   /locus_tag="NMA0064"
FT                   /product="ferric uptake regulation protein"
FT                   /note="NMA0064, fur, ferric uptake regulation protein,len:
FT                   144 aa; almost identical to FUR_NEIME ferric uptake
FT                   regulation protein (144 aa), fasta scores; E(): 0, 99.3%
FT                   identity in 144 aa overlap. Contains Pfam match to entry
FT                   PF01475 FUR, Ferric uptake regulator family E-value
FT                   1.3e-68"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0064"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07384"
FT                   /db_xref="GOA:P0A0S7"
FT                   /db_xref="InterPro:IPR002481"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0A0S7"
FT                   /protein_id="CAM07384.1"
FT                   /translation="MEKFNNIAQLKDSGLKVTGPRLKILDLFETHAEEHLSAEDVYRIL
FT                   LEEGVEIGVATIYRVLTQFEQAGILQRHHFETGKAVYELDKGDHHDHIVCVKCGEVTEF
FT                   HNPEIEALQDKIAEENGYRIVDHALYMYGVCSDCQAKGKR"
FT   CDS_pept        60586..60963
FT                   /transl_table=11
FT                   /locus_tag="NMA0065"
FT                   /product="putative lipoprotein"
FT                   /note="NMA0065, probable lipoprotein, len: 125 aa; similar
FT                   to hypothetical proteins e.g. SMPA_ECOLI small protein A
FT                   (113 aa), fasta scores; E(): 1.5e-06, 39.8% identity in 103
FT                   aa overlap. Contains N-terminal signal sequence and
FT                   appropriately positioned PS00013 Prokaryotic membrane
FT                   lipoprotein lipid attachment site"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0065"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07385"
FT                   /db_xref="GOA:A0A0U1RGS6"
FT                   /db_xref="InterPro:IPR007450"
FT                   /db_xref="InterPro:IPR026592"
FT                   /db_xref="InterPro:IPR037873"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RGS6"
FT                   /protein_id="CAM07385.1"
FT                   /translation="MNKTLILALSALLGLAACSVERVSLFPSYKLKIIQGNELEPRAVA
FT                   SLRPGMTKDQVLLLLGSPILRDAFHTDRWDYTFNTSRNGIIKDRSNLTVYFENGVLVRT
FT                   EGNALQNAAEALRVKQNADKQ"
FT   CDS_pept        60973..61782
FT                   /transl_table=11
FT                   /locus_tag="NMA0066"
FT                   /product="dihydrodipicolinate reductase"
FT                   /EC_number="1.3.1.26"
FT                   /note="NMA0066, dapB, dihydrodipicolinate reductase, len:
FT                   269 aa; highly similar to many e.g. DAPB_ECOLI
FT                   dihydrodipicolinate reductase (EC 1.3.1.26) (273 aa),fasta
FT                   scores; E(): 0, 62.9% identity in 267 aa overlap. Contains
FT                   Pfam match to entry PF01113 DapB,Dihydrodipicolinate
FT                   reductase, PS01298 Dihydrodipicolinate reductase signature,
FT                   and PS00017 ATP/GTP-binding site motif A (P-loop)"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0066"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07386"
FT                   /db_xref="GOA:Q9JX48"
FT                   /db_xref="InterPro:IPR000846"
FT                   /db_xref="InterPro:IPR022663"
FT                   /db_xref="InterPro:IPR022664"
FT                   /db_xref="InterPro:IPR023940"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9JX48"
FT                   /protein_id="CAM07386.1"
FT                   /translation="MTPLKIAIAGANGRMGRVLVEAVNNHPDTVLSGALEHSGSEALGL
FT                   DAGYAVGLKTGIAISDDVDTVLAQSDVLIDFTRPEPTLKHLQKCVEKQVNIIIGTTGFD
FT                   DAGKAAIRAAAEKTGIVFAANFSVGVNLTFHILDTVALVLNEGYDIEIIEGHHRHKVDA
FT                   PSGTALRMGEVIAGALGRDLKQCAVYGREGHTGPRDPSTIGFATVRAGDIVGDHTALFA
FT                   TDGERVEITHKASSRMTFAAGAVRAAVWVNGKTGLYDMQDVLGLNNR"
FT   CDS_pept        complement(62042..62341)
FT                   /transl_table=11
FT                   /locus_tag="NMA0067"
FT                   /product="hypothetical protein NMA0067"
FT                   /note="NMA0067, unknown, len: 99 aa"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0067"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07387"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RGS7"
FT                   /protein_id="CAM07387.1"
FT                   /translation="MDYPDFPQEIPMPNYSEWVKIKFKQFSYLKFIYGYATKNQDKNIK
FT                   NVLELGELKQDDEILDYGGALEVIGGRYDLPTGFSIDIVCREIELEFLDQESFN"
FT   CDS_pept        complement(62708..63862)
FT                   /transl_table=11
FT                   /locus_tag="NMA0069"
FT                   /product="lipid-A-disaccharide synthase"
FT                   /EC_number="2.4.1.182"
FT                   /note="NMA0069, lpxB, lipid-A-disaccharide synthase, len:
FT                   384 aa; similar to many e.g. LPXB_ECOLI
FT                   lipid-A-disaccharide synthase (EC 2.4.1.182) (382 aa),fasta
FT                   scores; E(): 0, 43.9% identity in 383 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0069"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07388"
FT                   /db_xref="GOA:Q9JX45"
FT                   /db_xref="InterPro:IPR003835"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9JX45"
FT                   /protein_id="CAM07388.1"
FT                   /translation="MADKKSPLIAVSVGEASGDLLGAHLIRAIRKRCPQARFVGIGGEL
FT                   MKAEGFESLYDQERLAVRGFVEVVRRLPEILRIRRGLVRDLLSLKPDVFVGIDAPDFNL
FT                   GVAERLKRSGIPTVHYVSPSVWAWRRERVGKIVHQVNRVLCLFPMEPQLYLDAGGRAEF
FT                   VGHPMAQLMPLEDDRETARKTLGVDAGIPVFALLPGSRVSEIDYMAPVFFQTALLLLKR
FT                   YPAARFLLPAATEATKRRLAEILQRSEFAGLPLTVTDRQSETVCRAADAVLVTSGTATL
FT                   EVALCKRPMVISYKISPLTYAYVKRKIKVPHVGLPNILLGKEAVPELLQHDAVPEKLAA
FT                   ALADWYEHPDKVAALQQDFRVLHLLLKKDTADLAARAVLEEAGC"
FT   CDS_pept        complement(63928..64920)
FT                   /transl_table=11
FT                   /locus_tag="NMA0070"
FT                   /product="ribosomal large subunit pseudouridine synthase C"
FT                   /EC_number="4.2.1.70"
FT                   /note="NMA0070, rluC, probable ribosomal large subunit
FT                   pseudouridine synthase C, len: 330 aa; similar to many e.g.
FT                   RLUC_ECOLI ribosomal large subunit pseudouridine synthase C
FT                   (EC 4.2.1.70) (319 aa), fasta scores; E(): 0,53.7% identity
FT                   in 311 aa overlap. Contains Pfam match to entry PF00849
FT                   YABO, Hypothetical yabO/yceC/sfhB family, and PS01129
FT                   Hypothetical yabO/yceC/sfhB family signature"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0070"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07389"
FT                   /db_xref="GOA:A0A0U1RGS8"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR006224"
FT                   /db_xref="InterPro:IPR006225"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RGS8"
FT                   /protein_id="CAM07389.1"
FT                   /translation="MKTHEISKDSVSLIGVAEHEAGQRLDNYLIKILKGVPKSHIHRII
FT                   RAGEVRLNKKRCKPDSRIAEGDTVRIPPVRVAEKEMPSERRAAVPARAFDVVYEDDALL
FT                   VIDKPSGVAVHGGSGVSFGVIEQLRRARPEARYLELVHRLDKDTSGLLMVAKKRSALVK
FT                   LHEAIRNDHPKKIYLALGVGKLPDDNFHVKLPLFKYTGAQGEKMVRVSEDGQSAHTVFR
FT                   VLSRFSDGILHGVGLSHLTLVRATLKTGRTHQIRVHLQSQGCPIAGDERYGDYQANRRL
FT                   QKLGLKRMFLHASELHLNHPLTGEPLVLKAELPPDLAQFAVMLENGTKM"
FT   CDS_pept        65414..68173
FT                   /transl_table=11
FT                   /locus_tag="NMA0071"
FT                   /product="ribonuclease E,"
FT                   /EC_number="3.1.4.-"
FT                   /note="NMA0071, rne, probable ribonuclease E, len: 919 aa;
FT                   similar to e.g. RNE_ECOLI ribonuclease E (EC 3.1.4.-) (1061
FT                   aa), fasta scores; E(): 0, 44.3% identity in 979 aa
FT                   overlap. Contains Pfam match to entry PF00575 S1, S1 RNA
FT                   binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0071"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07390"
FT                   /db_xref="GOA:A0A0U1RGS9"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR004659"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019307"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR028878"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RGS9"
FT                   /protein_id="CAM07390.1"
FT                   /translation="MKRMLFNATQAEELRVAIVDGQNLLDLDIETLGKEQRKGNIYKGI
FT                   ITRIEPSLEACFVDYGTDRHGFLPFKEVSRSYFQDYEGGRARIQDVLKEGMEVIVQVEK
FT                   DERGNKGAALTTFISLAGRYLVLMPNNPRGGGVSRRIEGEERQELKAAMAQLDIPNGMS
FT                   IIARTAGIGRSAEELEWDLNYLKQLWQAIEEAGKAHHDPYLLFMESSLLIRAIRDYFRP
FT                   DIGEILVDNQEVYDQVAEFMSYVMPGNIGRLKLYEDHTPLFSRFQIEHQIESAFSRSVS
FT                   LPSGGAIVIDHTEALVSIDVNSARATRGADIEDTAFKTNMEAAEEVARQMRLRDLGGLV
FT                   VIDFIDMENPKHQRDVENVLRDALKKDRARVQMGKLSRFGLLELSRQRLKPALGESSHV
FT                   ACPRCAGTGVIRGIESTALHVLRIIQEEAMKDNTGEVHAQVPVDVATFLLNEKRAELFA
FT                   MEERLDVNVVLIPNIHLENPHYEINRIRTDDVEEDGEPSYKRVAEPEENESAKPFGGEK
FT                   AKAARPEPAVKGVRHTSPAPTAAPEKKTSWWDSFKAWLKRIFGGSETQAAPAAETSEKR
FT                   STANRSGSRANNRRQNPRHSKREGSKVEVREVAGKTAGQEARADKAETRNNGNRRRNER
FT                   GDRAAERANEAEIQDRNVQPAAPVADAAPSETEVQTGKRRRNGSRSERSQTAPETAAVA
FT                   ETTVQTAENTPSEPHTAEDKGSKPKSERNRRERDSRDAKERRERNNQRDRRQNGKKRNI
FT                   PSAAKIEQYLNIHDTADKVRSAAAHVFGETDANAPITVSIADPVAERDLPTASPAVSNG
FT                   DAPVYDAAEKIRRATAAILPEGATPKAEAQEMPSETATFTAAAEQARETAQTGGLVLIE
FT                   TDPAALKAWAAQPEVQTGRGLRRSEQPKPSEVATVPAEEMIQVETRQG"
FT   CDS_pept        complement(68960..69949)
FT                   /transl_table=11
FT                   /locus_tag="NMA0072"
FT                   /product="pyridoxal phosphate biosynthetic protein"
FT                   /note="NMA0072, pdxA, probable pyridoxal phosphate
FT                   biosynthetic protein, len: 329 aa; similar to e.g.
FT                   PDXA_ECOLI pyridoxal phosphate biosynthetic protein (329
FT                   aa), fasta scores; E(): 0, 56.1% identity in 326 aa
FT                   overlap. Contains (gc)6 sequence at aa 43"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0072"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07391"
FT                   /db_xref="GOA:Q9JX42"
FT                   /db_xref="InterPro:IPR005255"
FT                   /db_xref="InterPro:IPR037510"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9JX42"
FT                   /protein_id="CAM07391.1"
FT                   /translation="MKQPVFAVTSGEPAGIGPDICLDLAFARLPCRCAVLGDKHLLRAR
FT                   AEALGKSVVLRDFDPESGGAAYGELEVLHIPAVEAVEAGKLNPANAAYVLQLLDTALAG
FT                   ISDGIFDGIVTAPLHKGIINDARASTGFFSGHTEYLAEKSGTGQVVMMLAGKDLRVALV
FT                   TTHLPLKDVAAAITQPLIESVARILHHDLKHKFGIKNPKILVAGLNPHAGEGGHLGHEE
FT                   TDTIIPALENLRREGINLAGPYPADTLFQPFMLEGADAVLAMYHDQGLPVLKYHSFGQG
FT                   VNITLGLPFIRTSVDHGTALDLAATGRADSGSLITAVETAVEMARGSL"
FT   CDS_pept        70109..71536
FT                   /transl_table=11
FT                   /locus_tag="NMA0073"
FT                   /product="putative amino-acid transport protein"
FT                   /note="NMA0073, probable amino-acid transport protein,len:
FT                   475 aa; similar to e.g. ALST_BACSU amino acid carrier
FT                   protein ALST (465 aa), fasta scores; E(): 0, 49.3% identity
FT                   in 469 aa overlap, and DAGA_ALTHA Na(+)-linked D-alanine
FT                   glycine permease (542 aa), fasta scores; E(): 0,44.2%
FT                   identity in 303 aa overlap. Contains Pfam match to entry
FT                   PF01235 Na_Ala_symp, Sodium:alanine symporter family,
FT                   PS00873 Sodium:alanine symporter family signature, and
FT                   (cgc)5 sequence at aa 291"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0073"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07392"
FT                   /db_xref="GOA:A0A0U1RGT0"
FT                   /db_xref="InterPro:IPR001463"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RGT0"
FT                   /protein_id="CAM07392.1"
FT                   /translation="MNENFTEWLHGWVGAINDPMWSYLVYMLLGTGLFFTVTTGFVQFR
FT                   LFGRSIKEMLGGRKQGDDPHGITPFQAFVTGLASRVGVGNIAGVAIAIKVGGPGAVFWM
FT                   WVTALIGMSSAFVESSLAQLFKVRDYDNHHFRGGPAYYITQGLGQKWLGVLFALSLIFC
FT                   FGFVFEAVQTNTIADTVKAAWGWEPHYVGVALVILTAPIIFGGIRRISKAAEIVVPLMA
FT                   VLYLFIALFIILTNIPMIPDVFGQIFSGAFKFDAAAGGLLGGLISQTMMMGIKRGLYSN
FT                   EAGMGSAPNAAAAAEVKHPVSQGMIQMLGVFVDTIIVCSCTAFIILIYQQPYGDLSGAA
FT                   LTQAAIVSQVGQWGAGFLAVILFMFAFSTVIGNYAYAESNVQFIKSHWLITAVFRMLVL
FT                   AWVYFGAVANVPLVWDMADMAMGIMAWINLVAILLLSPLAFMLLRDYTAKLKMGKDPEF
FT                   KLSEHPGLKRRIKSDVW"
FT   CDS_pept        71870..73756
FT                   /transl_table=11
FT                   /locus_tag="NMA0074"
FT                   /product="glucose inhibited division protein A homolog"
FT                   /note="NMA0074, gidA, glucose inhibited division protein A
FT                   homolog, len: 628 aa; similar to many e.g. GIDA_ECOLI
FT                   glucose inhibited division protein A (629 aa), fasta
FT                   scores; E(): 0, 66.9% identity in 622 aa overlap. Contains
FT                   Pfam match to entry PF01134 GIDA, Glucose inhibited
FT                   division protein A, and PS01280 Glucose inhibited division
FT                   protein A family signature 1"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0074"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07393"
FT                   /db_xref="GOA:Q9JX41"
FT                   /db_xref="InterPro:IPR002218"
FT                   /db_xref="InterPro:IPR004416"
FT                   /db_xref="InterPro:IPR020595"
FT                   /db_xref="InterPro:IPR026904"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9JX41"
FT                   /protein_id="CAM07393.1"
FT                   /translation="MIYPKTYDVIVVGGGHAGTEAALAAARMGAQTLLLTHNIETLGQM
FT                   SCNPSIGGIGKGHLVRELDALGGAMALATDKSGIQFRRLNASKGAAVRATRAQADRILY
FT                   KAAIREMLENQENLDLFQQAVEDVTLDGERISGVITAMGVEFKARAVVLTAGTFLSGKI
FT                   HIGLENYEGGRAGDPAAKSLGGRLRELKLPQGRLKTGTPPRIDGRTIDFSQLTEQPGDT
FT                   PVPVMSVRGNAEMHPRQVSCWITHTNTQTHDIIRSGFDRSPMFTGKIEGVGPRYCPSIE
FT                   DKINRFADKDSHQIFLEPEGLTTYEYYPNGISTSLPFDIQIALVRSMKGLENAHILRPG
FT                   YAIEYDYFDPRNLKASLETKTIEGLFFAGQINGTTGYEEAAAQGLLAGANAVQYVRGQD
FT                   PLLLRREQAYLGVLVDDLITKGVNEPYRMFTSRAEYRLQLREDNADMRLTEDGYKIGLV
FT                   GEAQWRMFNEKREAVEREIQRLKTTWYTPQKLAEDEQIRVFGQKLSREANLHDLLRRPN
FT                   LDYAALMTLEGAMPSENLSAEVIEQVEIQVKYQGYIDRQNEEIDSRRDIETLKLPDGID
FT                   YGKVKGLSAEVQQKLNQHKPETVGQASRISGVTPAAVALLMVHLKRGFKDAK"
FT   CDS_pept        73825..74409
FT                   /transl_table=11
FT                   /locus_tag="NMA0075"
FT                   /product="ribonuclease HII"
FT                   /EC_number="3.1.26.4"
FT                   /note="NMA0075, rnhB, ribonuclease HII, len: 194 aa;
FT                   similar to many e.g. RNH2_ECOLI ribonuclease HII (EC
FT                   3.1.26.4) (198 aa), fasta scores; E(): 0, 61.1% identity in
FT                   185 aa overlap. Contains Pfam match to entry PF01351
FT                   RNase_HII, Ribonuclease HII, score 263.90, E-value 2.1e-75"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0075"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07394"
FT                   /db_xref="GOA:Q9JX40"
FT                   /db_xref="InterPro:IPR001352"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR022898"
FT                   /db_xref="InterPro:IPR024567"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9JX40"
FT                   /protein_id="CAM07394.1"
FT                   /translation="MHILTAGVDEAGRGPLVGSVFAAAVILPETFDLPGLTDSKKLSEK
FT                   KRDALAEMIKNQAVAWHVAAAGPEEIASLNILHATMLAMKRAVDGLAVRPEKIFIDGNR
FT                   IPEHLNIPAEAVVKGDSKIIEISAASVLAKTARDAEMYALAQRHPQYGFDKHKGYGTKQ
FT                   HLEALEKYGVLPEHRRDFAPVRNLLAQQALF"
FT   CDS_pept        complement(75357..76130)
FT                   /transl_table=11
FT                   /locus_tag="NMA0076"
FT                   /product="parA family protein"
FT                   /note="NMA0076, parA family protein, len: 257 aa; similar
FT                   to many e.g. SOJ_BACSU SOJ protein (253 aa), fasta scores;
FT                   E(): 0, 55.6% identity in 248 aa overlap. Contains Pfam
FT                   match to entry PF00991 ParA, ParA family ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0076"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07395"
FT                   /db_xref="InterPro:IPR025669"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RGT1"
FT                   /protein_id="CAM07395.1"
FT                   /translation="MSANILAIANQKGGVGKTTTTVNLAASLASRGKRVLVVDLDPQGN
FT                   ATTGSGIDKASLQSGVYQVLLGDADVKSAAVRSKEGGYGVLGANRALAGAEIELVQEIA
FT                   REVRLKNALKAVAEDYDFILIDCPPSLTLLTLNGLVAAGGVIVPMLCEYYALEGISDLI
FT                   ATVRKIRQAVNPDLDITGIVRTMYDSRSRLVAEVSEQLRSHFGDLLFETVIPRNIRLAE
FT                   APSHGMPVMAYDAQAKGAKAYLALADELMARVSGK"
FT   CDS_pept        complement(76229..76852)
FT                   /transl_table=11
FT                   /locus_tag="NMA0077"
FT                   /product="glucose inhibited division protein B homolog"
FT                   /note="NMA0077, gidB, probable glucose inhibited division
FT                   protein B homolog, len: 207 aa; similar to many e.g.
FT                   GIDB_ECOLI glucose inhibited division protein B (207
FT                   aa),fasta scores; E(): 3.7e-31, 45.5% identity in 191 aa
FT                   overlap"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0077"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07396"
FT                   /db_xref="GOA:Q9JX38"
FT                   /db_xref="InterPro:IPR003682"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9JX38"
FT                   /protein_id="CAM07396.1"
FT                   /translation="MERKERLRAGIAAMGLDISETAQDRLLAYVDLLKKWNKTYNLTAL
FT                   RDEEKMIVHHLLDSLTLLPHIEGVQTMLDVGSGGGQPGIPAAVCRPDVQITLLDANTKK
FT                   TAFLQQAVIELGLDNVRVVSGRVEAVSDVRADVVTSRAFAELADFVSWTAHLLKDGGYW
FT                   AAMKGVYPQGEIGRLPQDVCVEKVQRLDVPGLDAERHIVILSKR"
FT   CDS_pept        complement(76948..77433)
FT                   /transl_table=11
FT                   /locus_tag="NMA0078"
FT                   /product="putative integral membrane protein"
FT                   /note="NMA0078, probable integral membrane protein, len:
FT                   161 aa. Contains four probable transmembrane domains"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0078"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07397"
FT                   /db_xref="GOA:A0A0U1RGT2"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RGT2"
FT                   /protein_id="CAM07397.1"
FT                   /translation="MFVNEKDPYAALFAGLVFLTLPFALAVHDAFALAFGRAGLLVSVS
FT                   DGGFGWRGGWDGTVWFVFGVFAFLNLVVSAGLMKLAYKKMMRRHSCYALFLSGVAACAA
FT                   AVVAWIFELLLGSAALGGLRGEAVLEYAFAVWLVSMLTLPKRLTRAPVQPVVFHRKK"
FT   CDS_pept        77843..78970
FT                   /transl_table=11
FT                   /locus_tag="NMA0079"
FT                   /product="putative integral membrane protein"
FT                   /note="NMA0079, probable integral membrane protein, len:
FT                   375 aa; similar to hypothetical proteins e.g. YEEA_ECOLI
FT                   (352 aa), fasta scores; E(): 1.9e-20, 27.9% identity in 348
FT                   aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0079"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07398"
FT                   /db_xref="GOA:A0A0U1RGT3"
FT                   /db_xref="InterPro:IPR006726"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RGT3"
FT                   /protein_id="CAM07398.1"
FT                   /translation="MNTSQRNRLVSRWLNSYERYRYRRLIHAVRLGGAVLFATASARLL
FT                   HLQHGEWIGMTVFVVLGMLQFQGAIYSKAVERMLGTVIGLGAGLGVLWLNQHYFHGNLL
FT                   FYLTVGTASALAGWAAVGKNGYVPMLAGLTMCMLIGDNGSEWFDSGLMRAMNVLIGAAI
FT                   AIAAAKLLPLKSTLMWRFMLADNLTDCSKMIAEISNGRRMTRERLEENMAKMRQINARM
FT                   VKSRSHLAATSGESRISPAMMEAMQHAHRKIVNTTELLLTTAAKLQSPKLNGSEIRLLD
FT                   RHFTLLQTDLQQTVALINGRHARRIRIDTAINPELEALAEHLHYQWQGFLWLSTNMRQE
FT                   ISALVILLQRTRRKWLDAHERQHLRQSLLETREHS"
FT   CDS_pept        79151..79708
FT                   /transl_table=11
FT                   /locus_tag="NMA0080"
FT                   /product="ribosome recycling factor"
FT                   /note="NMA0080, frr, probable ribosome recycling
FT                   factor,len: 185 aa; similar to many e.g. RRF_ECOLI ribosome
FT                   recycling factor (185 aa), fasta scores; E(): 0, 56.3%
FT                   identity in 183 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0080"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07399"
FT                   /db_xref="GOA:P66736"
FT                   /db_xref="InterPro:IPR002661"
FT                   /db_xref="InterPro:IPR023584"
FT                   /db_xref="InterPro:IPR036191"
FT                   /db_xref="UniProtKB/Swiss-Prot:P66736"
FT                   /protein_id="CAM07399.1"
FT                   /translation="MINDIQKTAEGKMQRSVEVLKENLAKVRTGRAHTGLLDQVEVEYW
FT                   GSMVPVSQVANVTLLDARTIGVKPFEGNMAAKVEKAIRDSNLGLNPAAVGDLIRVPMPM
FT                   LTEERRKDLIKVVRGEAEEGRVSIRNVRRDANDHIKKLLKDKEISEDEARRGEEAVQKL
FT                   TDKYITEADKLLTAKEEDLMAI"
FT   CDS_pept        79764..80510
FT                   /transl_table=11
FT                   /locus_tag="NMA0081"
FT                   /product="putative undecaprenyl diphosphate synthase"
FT                   /EC_number="2.5.1.31"
FT                   /note="NMA0081, uppS, possible undecaprenyl diphosphate
FT                   synthase, len: 248 aa; similar to e.g. UPPS_ECOLI
FT                   UNDECAPRENYL PYROPHOSPHATE SYNTHETASE (EC 2.5.1.31) (252
FT                   aa), fasta scores; E(): 0, 51.6% identity in 246 aa
FT                   overlap, and to TR:O82827 (EMBL:AB004319) Micrococcus
FT                   luteus undecaprenyl diphosphate synthase (249 aa), fasta
FT                   scores; E(): 0, 45.4% identity in 229 aa overlap. Contains
FT                   Pfam match to entry PF01255 UPF0015, Uncharacterized
FT                   protein family UPF0015, score 372.10, E-value 5.6e-108, and
FT                   PS01066 Uncharacterized protein family UPF0015 signature"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0081"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07400"
FT                   /db_xref="GOA:Q9JX35"
FT                   /db_xref="InterPro:IPR001441"
FT                   /db_xref="InterPro:IPR018520"
FT                   /db_xref="InterPro:IPR036424"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9JX35"
FT                   /protein_id="CAM07400.1"
FT                   /translation="MKSSTQAVLEHTAIPKHIAVIMDGNGRWAKKRFLPRIMGHKRGLD
FT                   ALENMVKHCAKLGVQYLTVFAFSTENWRRPEDEVSFLMGLFLQALQKQVRRLHENNMRL
FT                   KILGSRERFNRQILKGIEEAEALTANNTGLTLSIAADYGGRWDILQAANKLIAEGVSEI
FT                   TEDTLAKYLMLGDAPEPDLFIRTGGETRISNFLLWQMAYAELYFTDILWPDFDGKALDD
FT                   AVASFQKRERRFGRTSEQLPIEQQRN"
FT   CDS_pept        80513..81310
FT                   /transl_table=11
FT                   /locus_tag="NMA0082"
FT                   /product="phosphatidate cytidylyltransferase"
FT                   /EC_number="2.7.7.41"
FT                   /note="NMA0082, cdsA, probable phosphatidate
FT                   cytidylyltransferase, len: 265 aa; similar to many e.g.
FT                   CDSA_PSEAE phosphatidate cytidylyltransferase (EC 2.7.7.41)
FT                   (271 aa), fasta scores; E(): 0, 44.2% identity in 269 aa
FT                   overlap. Contains Pfam match to entry PF01148
FT                   Cytidylyltrans, Phosphatidate cytidylyltransferase, and
FT                   PS01315 Phosphatidate cytidylyltransferase signature"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0082"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07401"
FT                   /db_xref="GOA:A0A0U1RGT4"
FT                   /db_xref="InterPro:IPR000374"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RGT4"
FT                   /protein_id="CAM07401.1"
FT                   /translation="MLKQRVITAMWLLPLMLGMLFYAPQWLWAAFCGLIALIALWEYAR
FT                   MGGLCKIKTNHYLAATLVFGVVAYAGGWMLPNLVWYVVLAFWLAVMPLWLRFKWRLNGG
FT                   WQVYAVGWLLVMPFWFALVSLRPHPDDALPLLAVMGLVWVADICAYFSGKAFGKHKIAP
FT                   AISPGKSWEGAIGGAVCVAVYMTAVRSAGWLAFDTGWFDTVLIGLVLTVVSVCGDLLES
FT                   WLKRAAGIKDSSNLLPGHGGVFDRTDSLIAVISVYAAMMSVLN"
FT   CDS_pept        81366..82550
FT                   /transl_table=11
FT                   /locus_tag="NMA0083"
FT                   /product="1-deoxy-D-xylulose 5-phosphate reductoisomerase"
FT                   /EC_number="1.1.1.-"
FT                   /note="NMA0083, dxr, probable 1-deoxy-D-xylulose
FT                   5-phosphate reductoisomerase, len: 394 aa; similar to many
FT                   e.g. DXR_ECOLI 1-deoxy-D-xylulose 5-phosphate
FT                   reductoisomerase (EC 1.1.1.-) (398 aa), fasta scores; E():
FT                   0, 56.1% identity in 396 aa overlap. Contains PS00017
FT                   ATP/GTP-binding site motif A (P-loop)"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0083"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07402"
FT                   /db_xref="GOA:Q9JX33"
FT                   /db_xref="InterPro:IPR003821"
FT                   /db_xref="InterPro:IPR013512"
FT                   /db_xref="InterPro:IPR013644"
FT                   /db_xref="InterPro:IPR026877"
FT                   /db_xref="InterPro:IPR036169"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9JX33"
FT                   /protein_id="CAM07402.1"
FT                   /translation="MTPQVLTILGSTGSIGESTLDVVSRHPEKFRVFALAGHKQVEKLA
FT                   AQCQTFHPEYAVVADAEHAARLEALLKRDGTATQVLHGAQALVDVASADEVSGVMCAIV
FT                   GAVGLPSALAAAQKGKTIYLANKETLVVSGALFMETARANGAAVLPVDSEHNAVFQVLP
FT                   RDYTGRLNEHGIASIILTASGGPFLTADLNTFDSITPDQAVKHPNWRMGRKISVDSATM
FT                   MNKGLELIEAHWLFNCPPDKLEVVIHPQSVIHSMVRYRDGSVLAQLGNPDMRTPIAYCL
FT                   GLPERIDSGVGDLDFDALSALTFQKPDFDRFPCLKLAYEAMNAGGAAPCVLNAANEAAV
FT                   AAFLDGQIKFTDIAKTVAHCLSQDFSDGIGDIGGLLAQDARTRAQARAFIGTLR"
FT   CDS_pept        82585..83925
FT                   /transl_table=11
FT                   /locus_tag="NMA0084"
FT                   /product="putative integral membrane protein"
FT                   /note="NMA0084, probable integral membrane protein, len:
FT                   446 aa; similar to many hypothetical proteins e.g.
FT                   YAEL_ECOLI (450 aa), fasta scores; E(): 0, 38.4% identity
FT                   in 456 aa overlap. Contains 2x Pfam match to entry PF00595
FT                   PDZ, PDZ domain (Also known as DHR or GLGF), and PS00142
FT                   Neutral zinc metallopeptidases, zinc-binding region
FT                   signature"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0084"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07403"
FT                   /db_xref="GOA:Q9JX32"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR004387"
FT                   /db_xref="InterPro:IPR008915"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="InterPro:IPR041489"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9JX32"
FT                   /protein_id="CAM07403.1"
FT                   /translation="MHTLLAFIFAILILVSLHEFGHYIVARLCGVKVVRFSVGFGKPFF
FT                   TRKRGDTEWCLAPIPLGGYVKMVDTREGEVSEADLPYAFDKQHPAKRIAIVAAGPLTNL
FT                   ALAVLLYGLSFSFGVTELRPYVGTVEPDTIAARAGFQSGDKIQSVNGTPVADWGSAQTE
FT                   IVLNLEAGKVAVGVQTASGAQTVRTIDAAGTPEAGKIAKNQGYIGLMPFKITTVAGGVE
FT                   KGSPAEKAGLKPGDRLTAADGKPIASWQEWANLTRQSPGKKITLTYERAGQTHTADIRP
FT                   DTVEQPDHTLIGRVGLRPQPDRAWDAQIRRSYRPSVVRAFGMGWEKTVSHSWTTLKFFG
FT                   KLISGNASVSHISGPLTIADIAGQSAELGLQSYLEFLALVSISLGVLNLLPVPVLDGGH
FT                   LVFYTAEWIRGKPLGERVQNIGLRFGLALMMLMMAVAFFNDVTRLLG"
FT   CDS_pept        83982..86375
FT                   /transl_table=11
FT                   /locus_tag="NMA0085"
FT                   /product="outer membrane protein OMP85"
FT                   /note="NMA0085, omp85, outer membrane protein OMP85, len:
FT                   797 aa; almost identical to TR:O30912 (EMBL:AF021245) N.m.
FT                   strain HH outer membrane protein OMP85 (797 aa), fasta
FT                   scores; E(): 0, 99.6% identity in 797 aa overlap, and
FT                   similar to e.g. D152_HAEIN protective surface antigen D15
FT                   precursor (795 aa), fasta scores; E(): 0, 31.6% identity in
FT                   813 aa overlap. Contains Pfam match to entry PF01103
FT                   Bac_surface_Ag, Bacterial surface antigen, PS00017
FT                   ATP/GTP-binding site motif A (P-loop), and N-terminal
FT                   signal sequence"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0085"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07404"
FT                   /db_xref="GOA:A0A0U1RGT5"
FT                   /db_xref="InterPro:IPR000184"
FT                   /db_xref="InterPro:IPR010827"
FT                   /db_xref="InterPro:IPR023707"
FT                   /db_xref="InterPro:IPR034746"
FT                   /db_xref="InterPro:IPR039910"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RGT5"
FT                   /protein_id="CAM07404.1"
FT                   /translation="MKLKQIASALMVLGISPLALADFTIQDIRVEGLQRTEPSTVFNYL
FT                   PVKVGDTYNDTHGSAIIKSLYATGFFDDVRVETADGQLLLTVIERPTIGSLNITGAKML
FT                   QNDAIKKNLESFGLAQSQYFNQATLNQAVAGLKEEYLGRGKLNIQITPKVTKLARNRVD
FT                   IDITIDEGKSAKITDIEFEGNQVYSDRKLMRQMSLTEGGIWTWLTRSNQFNEQKFAQDM
FT                   EKVTDFYQNNGYFDFRILDTDIQTNEDKTKQTIKITVHEGGRFRWGKVSIEGDTNEVPK
FT                   AELEKLLTMKPGKWYERQQMTAVLGEIQNRMGSAGYAYSEISVQPLPNAETKTVDFVLH
FT                   IEPGRKIYVNEIHITGNNKTRDEVVRRELRQMESAPYDTSKLQRSKERVELLGYFDNVQ
FT                   FDAVPLAGTPDKVDLNMSLTERSTGSLDLSAGWVQDTGLVMSAGVSQDNLFGTGKSAAL
FT                   RASRSKTTLNGSLSFTDPYFTADGVSLGYDVYGKAFDPRKASTSIKQYKTTTAGAGIRM
FT                   SVPVTEYDRVNFGLVAEHLTVNTYNKAPKHYADFIKKYGKTDGTDGSFKGWLYKGTVGW
FT                   GRNKTDSALWPTRGYLTGVNAEIALPGSKLQYYSATHNQTWFFPLSKTFTLMLGGEVGI
FT                   AGGYGRTKEIPFFENFYGGGLGSVRGYESGTLGPKVYDEYGEKISYGGNKKANVSAELL
FT                   FPMPGAKDARTVRLSLFADAGSVWDGKTYDDNSSSATGGRVQNIYGAGNTHKSTFTNEL
FT                   RYSAGGAVTWLSPLGPMKFSYAYPLKKKPEDEIQRFQFQLGTTF"
FT   CDS_pept        86441..86941
FT                   /transl_table=11
FT                   /locus_tag="NMA0086"
FT                   /product="putative outer membrane protein"
FT                   /note="NMA0086, possible outer membrane protein, len: 166
FT                   aa; similar to e.g. OMPH_YEREN cationic 19 kd outer
FT                   membrane protein precursor (164 aa), fasta scores; E():
FT                   1.1e-05, 25.0% identity in 164 aa overlap, and HLPA_ECOLI
FT                   histone-like protein HLP-1 precursor (161 aa), fasta
FT                   scores; E(): 0.00038, 26.3% identity in 167 aa overlap.
FT                   Contains N-terminal signal sequence"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0086"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07405"
FT                   /db_xref="GOA:A0A0U1RGT6"
FT                   /db_xref="InterPro:IPR005632"
FT                   /db_xref="InterPro:IPR024930"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RGT6"
FT                   /protein_id="CAM07405.1"
FT                   /translation="MTRLTRAFAAALIGLCCTAGAHADTFQKIGFINTERIYLESKQAR
FT                   KIQKTLDSEFSARQDELQKLQREGLDLERQLAEGKLKDAKKAQAEEKWCGLVAAFRKKQ
FT                   AQFEEDYNLRRNEEFASLQQNANRVIVKIAKQEGYDVILQDVIYVNTQYDVTDSVIKEM
FT                   NAR"
FT   CDS_pept        86974..88017
FT                   /transl_table=11
FT                   /locus_tag="NMA0087"
FT                   /product="UDP-3-O-[3-hydroxymyristoyl] glucosamine
FT                   N-acyltransferase"
FT                   /EC_number="2.3.1.-"
FT                   /note="NMA0087, lpxD, UDP-3-O-[3-hydroxymyristoyl]
FT                   glucosamine N-acyltransferase, len: 347 aa; almost
FT                   identical to TR:P95377 (EMBL:U79481) N.m. strain MC58
FT                   UDP-3-O-(R-3-hydroxymyristoyl)-glucosamine
FT                   N-acyltransferase (348 aa), fasta scores; E(): 0, 96.8%
FT                   identity in 345 aa overlap, and similar to e.g. LPXD_ECOLI
FT                   UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
FT                   (EC 2.3.1.-) (340 aa), fasta scores; E(): 0, 38.5% identity
FT                   in 335 aa overlap. Contains 5x Pfam match to entry PF00132
FT                   hexapep, Bacterial transferase hexapeptide (four repeats),
FT                   and PS00101 Hexapeptide-repeat containing-transferases
FT                   signature"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0087"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07406"
FT                   /db_xref="GOA:Q9JX29"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR007691"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR020573"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9JX29"
FT                   /protein_id="CAM07406.1"
FT                   /translation="MIPATYTLSQITARLGGEWRGEDTSVTAVRPLADAQAEHISFLAN
FT                   PKYKAEVHDSSAGAVIVSAKAADGFEGRNLIVADDPYLYFAKVARLFSPVVKARGGIHP
FT                   TAVVEESATVPASCEIGANAYIGANTVLGEGCRILANAVVQHDCRLGDEVVLHPNAVVY
FT                   YGCTLGRRVEIHSGAVIGADGFGLAFAGDSWFKIPQTGAVTLGDDVEIGSNTNIDRGAM
FT                   SDTTVGNGTKIDNQVQIGHNCKIGSHTVIAAKTGISGSVTIGSYCIIGGGVGTVGHIEI
FT                   ADKTTIGGGTSVTHSITESGKHLAGIFPMSTHKEWARNAVYIHRLSEMNKRLKTLEQQL
FT                   SDGKDTQ"
FT   CDS_pept        88053..88502
FT                   /transl_table=11
FT                   /locus_tag="NMA0088"
FT                   /product="(3R)-hydroxymyristoyl-[acyl carrier protein]
FT                   dehydratase"
FT                   /EC_number="4.2.1.-"
FT                   /note="NMA0088, fabZ, (3R)-hydroxymyristoyl-[acyl carrier
FT                   protein] dehydratase, len: 149 aa; almost identical to
FT                   TR:P95378 (EMBL:U79481) N.m. strain MC58 FABZ (149
FT                   aa),fasta scores; E(): 0, 99.3% identity in 149 aa
FT                   overlap,ans similar to e.g. FABZ_ECOLI
FT                   (3R)-hydroxymyristoyl-[acyl carrier protein] dehydratase
FT                   (EC 4.2.1.-) (151 aa), fasta scores; E(): 5.1e-32, 55.0%
FT                   identity in 140 aa overlap. Contains Pfam match to entry
FT                   PF01377 Thioester_dehyd,Thioester dehydrase"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0088"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07407"
FT                   /db_xref="GOA:Q9JX28"
FT                   /db_xref="InterPro:IPR010084"
FT                   /db_xref="InterPro:IPR013114"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9JX28"
FT                   /protein_id="CAM07407.1"
FT                   /translation="MDVQLPIEAKDIQKLIPHRYPFLQLDRITAFEPMKTLTAIKNVTI
FT                   NEPQFQGHFPDLPVMPGVLIIEAMAQACGTLAILSEGGRKENEFFFFAGIDEARFKRQV
FT                   IPGDQLVFEVELLTSRRGIGKFNAVAKVDGQVAVEAVIMCAKRVV"
FT   CDS_pept        88813..89493
FT                   /transl_table=11
FT                   /locus_tag="NMA0089"
FT                   /product="hypothetical protein NMA0089"
FT                   /note="NMA0089, unknown, len; 226 aa"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0089"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07408"
FT                   /db_xref="InterPro:IPR011664"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RGT7"
FT                   /protein_id="CAM07408.1"
FT                   /translation="MERYKNAVGKDKAAELYLLNLSLSRELFHVVSIFEIVLRNKIDIC
FT                   LQQAFKDGNWLYNSIQPQTNPALKYQGCFLRNGTKESAELIKVALSKIQNNSGGKFDHN
FT                   QLVAGLGFGFWRYLFAGGKDAQFDATGKVLMKVFPKKPKSTPSVQHNQKWIFRELSNIN
FT                   NFRNRLAHHEPICFKGAIKDTGYARNIHQSIFELLNYMDVDTASVFSHFSDQVIAVCDE
FT                   IDKL"
FT   CDS_pept        89536..90312
FT                   /transl_table=11
FT                   /locus_tag="NMA0090"
FT                   /product="acyl-[acyl-carrier-protein]--UDP-N-acetylglucos
FT                   am O-acyltransferase"
FT                   /EC_number="2.3.1.129"
FT                   /note="NMA0090,
FT                   lpxA,acyl-[acyl-carrier-protein]--UDP-N-acetylglucosamine
FT                   O-acyltransferase, len: 258 aa; almost identical to
FT                   TR:P95379 (EMBL:U79481) N.m. strain MC58
FT                   UDP-N-acetylglucosamine acyltransferase (258 aa), fasta
FT                   scores; E(): 0, 98.8% identity in 258 aa overlap, and
FT                   similar to e.g. LPXA_ECOLI
FT                   acyl-[acyl-carrier-protein]--UDP-N-acetylglucosamine
FT                   O-acyltransferase (EC 2.3.1.129) (262 aa), fasta scores;
FT                   E(): 0, 48.0% identity in 256 aa overlap. Contains 3x Pfam
FT                   match to entry PF00132 hexapep, Bacterial transferase
FT                   hexapeptide (four repeats)"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0090"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07409"
FT                   /db_xref="GOA:Q9JX26"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR010137"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR029098"
FT                   /db_xref="InterPro:IPR037157"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9JX26"
FT                   /protein_id="CAM07409.1"
FT                   /translation="MTLIHPTAVIDPKAELDSSVKVGAYTVIGPNVQIGANTEIGPHAV
FT                   INGHTSIGENNRIFQFASLGEIPQDKKYRDEPTKLIIGNGNTIREFTTFNLGTVTGIGE
FT                   TRIGDDNWIMAYCHLAHDCVVGNHTIFANNASLAGHVTIGDYVVLGGYTLVFQFCRIGD
FT                   YAMTAFAAGVHKDVPPYFMASGYRAEPAGLNSEGMRRNGFTAEQISAVKDVYKTLYHRG
FT                   IPFEEAKADILRRAETQAELAVFRDFFAQSARGIIR"
FT   CDS_pept        90669..92060
FT                   /transl_table=11
FT                   /locus_tag="NMA0091"
FT                   /product="putative amino-acid transporter"
FT                   /note="NMA0091, probable amino-acid transporter, len: 463
FT                   aa; similar to members of the sodium:alanine symporter
FT                   family e.g. Y883_HAEIN P44917 hypothetical protein HI0883
FT                   (456 aa), fasta scores; E(): 0, 52.6% identity in 454 aa
FT                   overlap, and DAGA_ALTHA P30144 Na(+)-linked D-alanine
FT                   glycine permease (542 aa), fasta scores; E(): 0, 36.1%
FT                   identity in 540 aa overlap. Contains Pfam match to entry
FT                   PF01235 Na_Ala_symp, Sodium:alanine symporter family, and
FT                   PS00873 Sodium:alanine symporter family signature E-value
FT                   6e-162"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0091"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07410"
FT                   /db_xref="GOA:A0A0U1RGT8"
FT                   /db_xref="InterPro:IPR001463"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RGT8"
FT                   /protein_id="CAM07410.1"
FT                   /translation="MQVFLDNPKAFFETVSGWVWGPLMLMLLVGTGILLTVLLKGLQFT
FT                   MLGYALKQAFVPSKKHEDGEGHEGDISHFAALMTALSATIGTGNIAGVATAVVTGGPGA
FT                   VFWMWITAIFGMATKYGEGVLAVKYRVTNSKGEMSGGPMYYIEKGLGKNWKWMALAFAL
FT                   FGTFASFGIGSSVQSNSVAQAVQTSFGIEPAYTGITLTVLTAIVVLGGIKGIAKAASFI
FT                   VPAMAVFYVVGGISIIVINSDALMPAVNLIFSDAFSAQAVAGGAIGTVIRYGVARGVFS
FT                   NEAGMCSAPIAAAAAKTDHPVRQALVSMTGTFLDTIVVCSITGIVLVMGLLGAGGEFVK
FT                   PEVSGAALTTVTFQKMLPGIGGWIVTIGLIFFAYSTILGWCYYGEKCAVYVFGEKFAGL
FT                   YRVGYVSSVMLGTVLSLDLVWLASDTFNGLMALPNLIALLLMAKVIVNETRDFKQKITN
FT                   GELPH"
FT   CDS_pept        92139..93395
FT                   /transl_table=11
FT                   /locus_tag="NMA0092"
FT                   /product="D-amino acid dehydrogenase small subunit"
FT                   /EC_number="1.4.99.1"
FT                   /note="NMA0092, dadA, probable D-amino acid dehydrogenase
FT                   small subunit, len: 418 aa; similar to e.g. DADA_ECOLI
FT                   P29011 D-amino acid dehydrogenase small subunit (EC
FT                   1.4.99.1) (432 aa), fasta scores; E(): 0, 55.5% identity in
FT                   416 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0092"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07411"
FT                   /db_xref="GOA:Q9JX24"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR023080"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9JX24"
FT                   /protein_id="CAM07411.1"
FT                   /translation="MKVLVLGAGVAGVSSAWYLAEAGHEVTVIDRAEGVAMETSFANAG
FT                   QLSYGYTTPWAAPGIPTKALKWLFKSHPPLLFRPDGSLYQIEWLWQMLQHCTAARYQIN
FT                   KERMVRMSEYSREMFRRFEAQTGMNFEGRKKGTLQIFRQTKEVEAAKQDIAVLERYGVP
FT                   YRRLKPEECAEFEPALARVTAKIAGGLHLPADATGDCRLFTENLYKLCQEKGVRFHFNQ
FT                   TISRIDHNGLRIKTVETETGRFEADAVVCALGCFSRTVLAQVDLNLPIYPVKGYSLTLP
FT                   VTNSDGAPVSTVLDESYKVAITRFNNRIRVGGMAELSGYAIKLPEKRRETLALVVNDLF
FT                   PEGGDLNQTLFWSGLRPMTPDSTPLIGRTRFDNLFLNTGHGTLGWTMSLGSAKLTADIV
FT                   SGKDTEIRSDDLSLSRYQA"
FT   CDS_pept        93576..94385
FT                   /transl_table=11
FT                   /locus_tag="NMA0093"
FT                   /product="putative integral membrane protein"
FT                   /note="NMA0093, probable integral membrane protein, len:
FT                   269 aa; similar to hypothetical proteins e.g. YGIE_ECOLI
FT                   P24198 (257 aa), fasta scores; E(): 5.8e-28, 36.8% identity
FT                   in 261 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0093"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07412"
FT                   /db_xref="GOA:Q9JX23"
FT                   /db_xref="InterPro:IPR003689"
FT                   /db_xref="InterPro:IPR023498"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9JX23"
FT                   /protein_id="CAM07412.1"
FT                   /translation="MPDFSMSNLAVAFSITLAAGLFTVLGSGLVMFSKTPNPRVLSFGL
FT                   AFAGGAMVYVSLTEIFSKSSEAFAEIYDKDHAFAAATMAFLAGMGGIALIDRLVPNPHE
FT                   TLDAQDPSFQESKRRHIARVGMMAAFAITAHNFPEGLATFFATLENPAVGMPLALAIAI
FT                   HNIPEGISIAAPVYFATRSRKKTVWACLLSGLAEPLGAALGYLVLQPFLSPAVFGSVFG
FT                   VIAGVMVFLALDELLPAAKRYSDGHETVYGLTMGMAVIAVSLVLFHF"
FT   CDS_pept        94482..97319
FT                   /transl_table=11
FT                   /locus_tag="NMA0094"
FT                   /product="valyl-tRNA synthetase"
FT                   /note="NMA0094, valS, valyl-tRNA synthetase, len: 945 aa;
FT                   SYV_ECOLI P07118 valyl-tRNA synthetase (EC 6.1.1.9) (951
FT                   aa), fasta scores; E(): 0, 51.7% identity in 971 aa
FT                   overlap. Contains Pfam match to entry PF00133
FT                   tRNA-synt_1,tRNA synthetases class I (I, L, M and V),
FT                   PS00178 Aminoacyl-transfer RNA synthetases class-I
FT                   signature, and PS00017 ATP/GTP-binding site motif A
FT                   (P-loop)"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0094"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07413"
FT                   /db_xref="GOA:Q9JX22"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002303"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR019499"
FT                   /db_xref="InterPro:IPR033705"
FT                   /db_xref="InterPro:IPR037118"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9JX22"
FT                   /protein_id="CAM07413.1"
FT                   /translation="MLDKYSPAEIESKHYQNWEEQGYFQPDMDLTKPSFSIQLPPPNVT
FT                   GTLHMGHAFNQTIMDGLTRYYRMKGCNTAWIPGTDHAGIATQIVVERQLAAQNVSRHDL
FT                   GREKFLEKVWEWKEVSGGTITQQMRRVGCSADWTREYFTMDDVRAETVTEVFVRLYEQG
FT                   LIYRGKRLVNWDPVLGTAVSDLEVESVEEQGSMWHIRYPLADNPAEAVIVATTRPETLL
FT                   GDVAVAVNPEDERYTHLIGKELILPLTGRTIPVIADEYVEKDFGTGCVKITPAHDFNDY
FT                   EVGKRHDTRLVNVFDLEAKVLANAEVFNFKGEAQPSFALPEKYAGLDRFAARKQMVADL
FT                   QEQGFLVEIKAHTLMTPKGDRTGSVIEPMLTSQWFVAMSATPNGGEPDSEFKGLSLADK
FT                   AKKAVDSGAVRFIPENWVNTYNQWMNNIQDWCISRQLWWGHQIPAWYDNEGNVYVARNQ
FT                   EEAEKQAGKTGLTREEDVLDTWFSSALVPFSTLGWPSETDELKAFLPSNVLVTGYEIIF
FT                   FWVARMIMMTTHFTGKVPFKDVYIHGIVRDHEGKKMSKSEGNVIDPVDLIDGIDLEKLL
FT                   VKRTTGLRKPETAPKVEEASRKLFPEGIPSMGADALRFTMASYASLGRSVNFDFKRAEG
FT                   YRNFCNKIWNATNFVLMNTENQDCGYGATATEPRGYSFPDMWIVDRLNQTIEQVTQAYE
FT                   TYRFDLAAETLYSFMWNDYCDWYLELAKVQLQTGCASRQRATRHTLLRVLEAALRLLHP
FT                   IIPFITEELWQTVAPMCDAKTADSIMLARFPEADSGEIVQTAFEQMTVLQDLIGAVRNL
FT                   RGEMGIQPNVKAPLFVESTDDLADYLKYLPMMTRLTEAQQVATLPESEDAPVAVCNGAR
FT                   LMLKVEIDKATETARLSKEAEKLQKALDKLNAKLSKPGYTEKAPAHLVEKDKADLAELE
FT                   DKMAKVQTQLSKLKD"
FT   CDS_pept        97474..97629
FT                   /transl_table=11
FT                   /locus_tag="NMA0095"
FT                   /product="hypothetical protein NMA0095"
FT                   /note="NMA0095, unknown, len: 51 aa"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0095"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07414"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RGT9"
FT                   /protein_id="CAM07414.1"
FT                   /translation="MVNLLKMHTQSSACGSNAGERECGVATRDDGKRANGNPSMGNLAK
FT                   ILDFDI"
FT   CDS_pept        complement(97690..98079)
FT                   /transl_table=11
FT                   /locus_tag="NMA0096"
FT                   /product="hypothetical protein NMA0096"
FT                   /note="NMA0096, unknown, len: 129 aa; similar to
FT                   NMA1028,fasta scores; E(): 1.7e-19, 45.2% identity in 126
FT                   aa overlap, NMA1027, fasta scores; E(): 1.6e-12, 36.4%
FT                   identity in 118 aa overlap, NMA1026, fasta scores; E():
FT                   5.4e-10, 30.4% identity in 125 aa overlap, and the
FT                   N-terminus of NMA1636, fasta scores; E(): 1.4e-06, 44.3%
FT                   identity in 61 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0096"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07415"
FT                   /db_xref="InterPro:IPR007929"
FT                   /db_xref="InterPro:IPR010896"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RGU0"
FT                   /protein_id="CAM07415.1"
FT                   /translation="MRYTIKTFQTLADETFPSKNFKILSFNGVARPITIVCPTHGVQTV
FT                   SAGQAFIRSKHGCPACGLVLSTSVLASRGRSVSILDTATGETLSFPSVQAAAKALNTSY
FT                   GSIRTKLDGRSSPDNLVCNRYKVMP"
FT   CDS_pept        complement(98653..99573)
FT                   /transl_table=11
FT                   /locus_tag="NMA0098"
FT                   /product="putative hydrogen peroxide-inducible genes
FT                   activator"
FT                   /note="NMA0098, oxyR, possible hydrogen peroxide-inducible
FT                   genes activator, len: 306 aa; similar to e.g. OXYR_ECOLI
FT                   P11721 hydrogen peroxide-inducible genes activator (305
FT                   aa), fasta scores; E(): 0, 37.5% identity in 280 aa
FT                   overlap. Contains Pfam match to entry PF00126
FT                   HTH_1,Bacterial regulatory helix-turn-helix protein, lysR
FT                   family, and PS00044 Bacterial regulatory proteins, lysR
FT                   family signature"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0098"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07416"
FT                   /db_xref="GOA:A0A0U1RGU1"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RGU1"
FT                   /protein_id="CAM07416.1"
FT                   /translation="MTLTELRYIVAVAQERHFGRAARRCFVSQPTLSIAIKKLEEELAV
FT                   SLFDRSSNDIITTEAGERIVAQARKVLEEAELIRHLANEEQNELEGAFKLGLIFTVAPY
FT                   LLPKLIVSLRRTAPKMPLMLEENYTHTLTESLKRGDVDAIIVAEPFQEPGIVTEPLYDE
FT                   PFFVIVPKGHSFEELDAVSPRMLGEEQVLLLTEGNCMRDQVLSSCSELAAKQRIQGLTN
FT                   TLQGSSINTIRHMVASGLAISVLPATALTENDHMLFSIIPFEGTPPSRRVVLAYRRNFV
FT                   RPKALSAMKAAIMQSQLHGVSFIRD"
FT   CDS_pept        complement(99577..99840)
FT                   /transl_table=11
FT                   /locus_tag="NMA0099"
FT                   /product="putative cell division topological specificity
FT                   factor"
FT                   /note="NMA0099, minE, possible cell division topological
FT                   specificity factor, len: 87 aa; similar to e.g. MINE_ECOLI
FT                   P18198 cell division topological specificity factor (88
FT                   aa), fasta scores; E(): 2.7e-13, 43.2% identity in 88 aa
FT                   overlap"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0099"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07417"
FT                   /db_xref="GOA:Q9JX18"
FT                   /db_xref="InterPro:IPR005527"
FT                   /db_xref="InterPro:IPR036707"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9JX18"
FT                   /protein_id="CAM07417.1"
FT                   /translation="MSLIEFLFGRKQKTATVARDRLQIIIAQERAQEGQTPDYLPTLRK
FT                   ELMEVLSKYVNVSLDNIRISQEKQDGMDVLELNITLPEQKKV"
FT   CDS_pept        complement(99844..100659)
FT                   /transl_table=11
FT                   /locus_tag="NMA0100"
FT                   /product="septum site-determining protein"
FT                   /note="NMA0100, minD, probable septum site-determining
FT                   protein, len: 271 aa; highly similar to e.g. MIND_ECOLI
FT                   P18197 septum site-determining protein MIND (269 aa),fasta
FT                   scores; E(): 0, 73.8% identity in 271 aa overlap. Contains
FT                   Pfam match to entry PF00991 ParA, ParA family ATPase, and
FT                   PS00017 ATP/GTP-binding site motif A (P-loop) E-value
FT                   5.8e-05"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0100"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07418"
FT                   /db_xref="GOA:A0A0U1RGU2"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR010223"
FT                   /db_xref="InterPro:IPR025501"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RGU2"
FT                   /protein_id="CAM07418.1"
FT                   /translation="MAKIIVVTSGKGGVGKTTTSASIATGLALRGYKTAVIDFDVGLRN
FT                   LDLIMGCERRVVYDLINVIQGEATLNQALIKDKNCENLFILPASQTRDKDALTREGVEK
FT                   VMQELSGKKMGFEYIICDSPAGIEQGALMALYFADEAIVTTNPEVSSVRDSDRILGILQ
FT                   SKSHKAEQGGSVKEHLLITRYSPERVAKGEMLSVQDICDILHIPLLGVIPESQNVLQAS
FT                   NSGEPVIHQDSVAASEAYKDVIARLLGENREMRFLEAEKKSFFKRLFGG"
FT   CDS_pept        complement(100688..101401)
FT                   /transl_table=11
FT                   /locus_tag="NMA0101"
FT                   /product="putative cell division inhibitor"
FT                   /note="NMA0101, minC, probable cell division inhibitor,len:
FT                   237 aa; similar to e.g. MINC_ECOLI P18196 cell division
FT                   inhibitor MINC (231 aa), fasta scores; E(): 5.2e-18, 37.9%
FT                   identity in 190 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0101"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07419"
FT                   /db_xref="GOA:Q9JX17"
FT                   /db_xref="InterPro:IPR005526"
FT                   /db_xref="InterPro:IPR007874"
FT                   /db_xref="InterPro:IPR013033"
FT                   /db_xref="InterPro:IPR016098"
FT                   /db_xref="InterPro:IPR036145"
FT                   /db_xref="InterPro:IPR038061"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9JX17"
FT                   /protein_id="CAM07419.1"
FT                   /translation="MMVYIMNAFDIKSTKMDVLSISLHTSDLFDLEDVLVKLGKKFQES
FT                   GVVPFVLDVQEFDYPESLDLAALVSLFSRHGMQILGLKHSNERWAAAAMKYHLLFCLSH
FT                   SENVKELGQVEVQNTEDGQKARKTVLITSPVRTGQQVYAEDGDLIVTGAVSQGAELIAD
FT                   GNIHIYAPMRGRALAGAKGDTSARIFIHSMQAELVSVAGIYRNFEQDLPNHLHKQPVQI
FT                   LLQDNRLVISAIGSE"
FT   CDS_pept        complement(101548..101916)
FT                   /transl_table=11
FT                   /locus_tag="NMA0102"
FT                   /product="50S ribosomal protein L17"
FT                   /note="NMA0102, rplQ, 50S ribosomal protein L17, len: 122
FT                   aa; highly similar to many e.g. RL17_ECOLI P02416 50S
FT                   ribosomal protein L17 (127 aa), fasta scores; E(): 0,71.2%
FT                   identity in 118 aa overlap. Contains Pfam match to entry
FT                   PF01196 Ribosomal_L17, Ribosomal protein L17, and PS01167
FT                   Ribosomal protein L17 signature"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0102"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07420"
FT                   /db_xref="GOA:Q9JX16"
FT                   /db_xref="InterPro:IPR000456"
FT                   /db_xref="InterPro:IPR036373"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9JX16"
FT                   /protein_id="CAM07420.1"
FT                   /translation="MRHRNGNRKLNRTSSHRAAMLRNMANSLLTHETIVTTLPKAKELR
FT                   RVVEPLITLGKKPSLANRRLAFDRTRDRDVVVKLFGDLGPRFTARNGGYVRVLKYGFRK
FT                   GDNAPLALVELVDKPAAE"
FT   CDS_pept        complement(101940..102926)
FT                   /transl_table=11
FT                   /locus_tag="NMA0103"
FT                   /product="DNA-directed RNA polymerase alpha chain"
FT                   /EC_number="2.7.7.6"
FT                   /note="NMA0103, rpoA, DNA-directed RNA polymerase alpha
FT                   chain, len: 328 aa; highly similar to many e.g. RPOA_BORPE
FT                   P37368 DNA-directed RNA polymerase alpha chain (EC 2.7.7.6)
FT                   (328 aa), fasta scores; E(): 0. 70.9% identity in 327 aa
FT                   overlap. Contains Pfam match to entry PF01000
FT                   RNA_pol_A_bac, Bacterial RNA polymerase, alpha chain"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0103"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07421"
FT                   /db_xref="GOA:P66703"
FT                   /db_xref="InterPro:IPR011260"
FT                   /db_xref="InterPro:IPR011262"
FT                   /db_xref="InterPro:IPR011263"
FT                   /db_xref="InterPro:IPR011773"
FT                   /db_xref="InterPro:IPR036603"
FT                   /db_xref="InterPro:IPR036643"
FT                   /db_xref="UniProtKB/Swiss-Prot:P66703"
FT                   /protein_id="CAM07421.1"
FT                   /translation="MQNSTTEFLKPRQIDVNTFSATRAKVSMQPFERGFGHTLGNALRR
FT                   ILLSSMNGFAPTEVAIAGVLHEYSTVDGIQEDVVDILLNIKGIVFKLHGRSQVQLVLKK
FT                   SGSGVVSAGDIELPHDVEILNPGHVICHLADNGQIEMEIKVEQGRGYQSVSGRQVVRDE
FT                   NRQIGAIQLDASFSPISRVSFEVEPARVEQRTDLDKLVLDIETDGSIDPEEAVRSAARI
FT                   LIDQMSIFADLQGTPVEEVEEKAPPIDPVLLRPVDDLELTVRSANCLKAEDIYYIGDLI
FT                   QRTETELLKTPNLGRKSLNEIKEVLASKGLTLGSKLEAWPPVGLEKP"
FT   CDS_pept        complement(102952..103572)
FT                   /transl_table=11
FT                   /locus_tag="NMA0104"
FT                   /product="30S ribosomal protein S4"
FT                   /note="NMA0104, rpsD, 30S ribosomal protein S4, len: 206
FT                   aa; highly similar to many e.g. RS4_ECOLI P02354 30S
FT                   ribosomal protein S4 (205 aa), fasta scores; E(): 0, 73.2%
FT                   identity in 205 aa overlap. Contains Pfam match to entry
FT                   PF00163 Ribosomal_S4, Ribosomal protein S4/S9 N-terminal
FT                   domain, Pfam match to entry PF01479 S4, S4 domain, and
FT                   PS00632 Ribosomal protein S4 signature"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0104"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07422"
FT                   /db_xref="GOA:P66560"
FT                   /db_xref="InterPro:IPR001912"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR005709"
FT                   /db_xref="InterPro:IPR018079"
FT                   /db_xref="InterPro:IPR022801"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/Swiss-Prot:P66560"
FT                   /protein_id="CAM07422.1"
FT                   /translation="MARYIGPKCKLARREGTDLFLKSARRSLDSKCKIDSAPGQHGAKK
FT                   PRLSDYGLQLREKQKIRRIYGVLERQFRRYFAEADRRKGSTGELLLQLLESRLDNVVYR
FT                   MGFGSTRAEARQLVSHKAIVVNGQVVNIPSFQVKAGDVVSVREKAKKQVRIQEALGLAT
FT                   QIGLPGWVSVDADKLEGVFKNMPDRSELTGDINEQLVVEFYSK"
FT   CDS_pept        complement(103592..103987)
FT                   /transl_table=11
FT                   /locus_tag="NMA0105"
FT                   /product="30S ribosomal protein S11"
FT                   /note="NMA0105, rpsK, 30S ribosomal protein S11, len: 131
FT                   aa; highly similar to many e.g. RS11_ECOLI P02366 30S
FT                   ribosomal protein S11 (128 aa), fasta scores; E(): 0,74.2%
FT                   identity in 128 aa overlap. Contains Pfam match to entry
FT                   PF00411 Ribosomal_S11, Ribosomal protein S11, and PS00054
FT                   Ribosomal protein S11 signature"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0105"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07423"
FT                   /db_xref="GOA:P66354"
FT                   /db_xref="InterPro:IPR001971"
FT                   /db_xref="InterPro:IPR018102"
FT                   /db_xref="InterPro:IPR019981"
FT                   /db_xref="InterPro:IPR036967"
FT                   /db_xref="UniProtKB/Swiss-Prot:P66354"
FT                   /protein_id="CAM07423.1"
FT                   /translation="MAKANTASRVRKKVRKTVSEGIVHVHASFNNTIITITDRQGNALS
FT                   WATSGGAGFKGSRKSTPFAAQVAAEAAGKVAQEYGVKNLEVRIKGPGPGRESSVRALNA
FT                   LGFKITSITDVTPLPHNGCRPPKKRRI"
FT   CDS_pept        complement(104007..104369)
FT                   /transl_table=11
FT                   /locus_tag="NMA0106"
FT                   /product="30S ribosomal protein S13"
FT                   /note="NMA0106, rpsM, 30S ribosomal protein S13, len: 120
FT                   aa; highly similar to many e.g. RS13_ECOLI P02369 30S
FT                   ribosomal protein S13 (117 aa), fasta scores; E(): 3.9e-31,
FT                   70.4% identity in 115 aa overlap. Contains Pfam match to
FT                   entry PF00416 Ribosomal_S13, Ribosomal protein S13, and
FT                   PS00646 Ribosomal protein S13 signature"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0106"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07424"
FT                   /db_xref="GOA:P66385"
FT                   /db_xref="InterPro:IPR001892"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR018269"
FT                   /db_xref="InterPro:IPR019980"
FT                   /db_xref="InterPro:IPR027437"
FT                   /db_xref="UniProtKB/Swiss-Prot:P66385"
FT                   /protein_id="CAM07424.1"
FT                   /translation="MARIAGVNIPNNAHIVIGLQAIYGIGATRAKLICEAANIAPDTKA
FT                   KDLDETQLDALRDQVAKYEVEGDLRREVTMSIKRLMDMGCYRGFRHRRGLPCRGQRTRT
FT                   NARTRKGPRKAIAGKK"
FT   CDS_pept        complement(104435..104548)
FT                   /transl_table=11
FT                   /locus_tag="NMA0107"
FT                   /product="50S ribosomal protein L36"
FT                   /note="NMA0107, rpmJ, 50S ribosomal protein L36, len: 37
FT                   aa; highly similar to many e.g. RL36_VIBCH P78001 50S
FT                   ribosomal protein L36 (37 aa), fasta scores; E():
FT                   9.3e-13,73.0% identity in 37 aa overlap. Contains Pfam
FT                   match to entry PF00444 Ribosomal_L36, Ribosomal protein
FT                   L36, and PS00828 Ribosomal protein L36 signature"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0107"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07425"
FT                   /db_xref="GOA:P66292"
FT                   /db_xref="InterPro:IPR000473"
FT                   /db_xref="InterPro:IPR035977"
FT                   /db_xref="UniProtKB/Swiss-Prot:P66292"
FT                   /protein_id="CAM07425.1"
FT                   /translation="MRVQPSVKKICRNCKIIRRNRVVRVICTDLRHKQRQG"
FT   CDS_pept        complement(104569..104787)
FT                   /transl_table=11
FT                   /locus_tag="NMA0108"
FT                   /product="translation initiation factor IF-1"
FT                   /note="NMA0108, infA, translation initiation factor
FT                   IF-1,len: 72 aa; highly similar to many e.g. IF1_ECOLI
FT                   P02998 translation initiation factor IF-1 (71 aa), fasta
FT                   scores; E(): 3.1e-20, 71.8% identity in 71 aa overlap.
FT                   Contains Pfam match to entry PF00575 S1, S1 RNA binding
FT                   domain E-value 1.7e-08"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0108"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07426"
FT                   /db_xref="GOA:P65112"
FT                   /db_xref="InterPro:IPR004368"
FT                   /db_xref="InterPro:IPR006196"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/Swiss-Prot:P65112"
FT                   /protein_id="CAM07426.1"
FT                   /translation="MAKEDTIQMQGEILETLPNATFKVKLENDHIVLGHISGKMRMHYI
FT                   RISPGDKVTVELTPYDLTRARIVFRAR"
FT   CDS_pept        complement(104792..106102)
FT                   /transl_table=11
FT                   /locus_tag="NMA0109"
FT                   /product="preprotein translocase SECY subunit"
FT                   /note="NMA0109, secY, preprotein translocase SECY
FT                   subunit,len: 436 aa; highly similar to many e.g. SECY_ECOLI
FT                   P03844 preprotein translocase SECY subunit (443 aa), fasta
FT                   scores; E(): 0, 56.4% identity in 436 aa overlap. Contains
FT                   Pfam match to entry PF00344 secY, eubacterial secY protein,
FT                   PS00755 Protein secY signature 1, and PS00756 Protein secY
FT                   signature 2"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0109"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07427"
FT                   /db_xref="GOA:A0A0U1RGU3"
FT                   /db_xref="InterPro:IPR002208"
FT                   /db_xref="InterPro:IPR023201"
FT                   /db_xref="InterPro:IPR026593"
FT                   /db_xref="InterPro:IPR030659"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RGU3"
FT                   /protein_id="CAM07427.1"
FT                   /translation="MANQQTSSGSSKFGDLKKRLLFLFGALIVFRIGAHIPVPGVDAVA
FT                   LAKLYESAGNGILGILNMFSGGSLERFSIFAIGIMPYISASIIVQLASEILPSLKALKK
FT                   EGEAGRKVITKYTRYGTVLLAILQSLGVASFVFQQGIVVTSSFEFHVSTVVSLVTGTMF
FT                   LMWLGEQITERGIGNGISLIITAGIASGIPSGIAKLVTLTNQGSMSMLTALFIVFGALL
FT                   LIYLVVYFESAQRKIPIHYAKRQFNGRAGSQNTHMPFKLNMAGVIPPIFASSIILFPST
FT                   LLGWFGSADTNSVLHKIAGLLQHGQLLYMALFAATVIFFCYFYTALVFSPKEMAENLKK
FT                   SGAFVPGIRPGEQTSRYLEKVVLRLTLFGALYITTICLIPEFLTTVLNVPFYLGGTSLL
FT                   ILVVVTMDFSTQINSYRLTQQYDKLMTRSEMKSFSRK"
FT   CDS_pept        complement(106114..106548)
FT                   /transl_table=11
FT                   /locus_tag="NMA0110"
FT                   /product="50S ribosomal protein L15"
FT                   /note="NMA0110, rplO, 50S ribosomal protein L15, len: 144
FT                   aa; highly similar to many e.g. RL15_ACYKS P46185 50S
FT                   ribosomal protein L15 (144 aa), fasta scores; E(): 7.9e-27,
FT                   62.9% identity in 143 aa overlap. Contains Pfam match to
FT                   entry PF01305 Ribosomal_L15, Ribosomal protein L15 amino
FT                   terminal region, Pfam match to entry PF00256 L15, Ribosomal
FT                   protein L15, and PS00475 Ribosomal protein L15 signature"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0110"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07428"
FT                   /db_xref="GOA:Q9JX15"
FT                   /db_xref="InterPro:IPR001196"
FT                   /db_xref="InterPro:IPR005749"
FT                   /db_xref="InterPro:IPR021131"
FT                   /db_xref="InterPro:IPR030878"
FT                   /db_xref="InterPro:IPR036227"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9JX15"
FT                   /protein_id="CAM07428.1"
FT                   /translation="MFLNTIQPAVGATHAGRRVGRGIGSGLGKTGGRGHKGQKSRSGGF
FT                   HKVGFEGGQMPLQRRLPKRGFKSLTASANAQLRLSELESIAVNEIDILVLKQAGLIAST
FT                   VSNVKVIAFGEISKAVALKGIKVTKGARAAIEAVGGKIEM"
FT   CDS_pept        complement(106550..106735)
FT                   /transl_table=11
FT                   /locus_tag="NMA0111"
FT                   /product="50S ribosomal protein L30"
FT                   /note="NMA0111, rpmD, 50S ribosomal protein L30, len: 61
FT                   aa; highly similar to many e.g. RL30_ACYKS P46184 50S
FT                   ribosomal protein L30 (59 aa), fasta scores E(): 6.9e-11.
FT                   58.9% identity in 56 aa overlap. Contains Pfam match to
FT                   entry PF00327 Ribosomal_L30, Ribosomal protein L30"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0111"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07429"
FT                   /db_xref="GOA:Q9JQT4"
FT                   /db_xref="InterPro:IPR005996"
FT                   /db_xref="InterPro:IPR016082"
FT                   /db_xref="InterPro:IPR036919"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9JQT4"
FT                   /protein_id="CAM07429.1"
FT                   /translation="MAEQKKIRVTLVKSLIGTIESHRACARGLGLRRREHTVEVLDTPE
FT                   NRGMINKISYLLKVES"
FT   CDS_pept        complement(106728..107246)
FT                   /transl_table=11
FT                   /locus_tag="NMA0112"
FT                   /product="30S ribosomal protein S5"
FT                   /note="NMA0112, rpsE, 30S ribosomal protein S5, len; 172
FT                   aa; highly similar to many e.g. RS5_ECOLI P02356 30S
FT                   ribosomal protein S5 (166 aa), fasta scores E(): 0, 60.1%
FT                   identity in 163 aa overlap. Contains Pfam match to entry
FT                   PF00333 Ribosomal_S5, Ribosomal protein S5, and PS00585
FT                   Ribosomal protein S5 signature"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0112"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07430"
FT                   /db_xref="GOA:P66576"
FT                   /db_xref="InterPro:IPR000851"
FT                   /db_xref="InterPro:IPR005324"
FT                   /db_xref="InterPro:IPR005712"
FT                   /db_xref="InterPro:IPR013810"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018192"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/Swiss-Prot:P66576"
FT                   /protein_id="CAM07430.1"
FT                   /translation="MAKHEIEERGDGLIEKMVAVNRVTKVVKGGRIMAFSALTVVGDGD
FT                   GRIGMGKGKSKEVPVAVQKAMDQARRSMIKVPLKNGTIHHEVIGRHGATKVFMQPAKEG
FT                   SGVKAGGPMRLVFDAMGIHNISAKVHGSTNPYNIVRATLDGLSKLHTPADIAAKRGLTV
FT                   EDILGVNHG"
FT   CDS_pept        complement(107265..107618)
FT                   /transl_table=11
FT                   /locus_tag="NMA0113"
FT                   /product="50S ribosomal protein L18"
FT                   /note="NMA0113, rplR, 50S ribosomal protein L18, len: 117
FT                   aa; highly similar to many e.g. RL18_VIBPR P52863 50S
FT                   ribosomal protein L18 (117 aa), fasta scores E():
FT                   9.9e-23,58.1% identity in 117 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0113"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07431"
FT                   /db_xref="GOA:Q9JQQ6"
FT                   /db_xref="InterPro:IPR004389"
FT                   /db_xref="InterPro:IPR005484"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9JQQ6"
FT                   /protein_id="CAM07431.1"
FT                   /translation="MDKHTTRLRRARKTRARIADLKMVRLCVFRSNNHIYAQVISAEGD
FT                   KVLAQASTLEAEVRGSLKSGSNVEAAAIVGKRIAEKAKAAGVEKVAFDRSGFQYHGRVK
FT                   ALAEAARENGLSF"
FT   CDS_pept        complement(107632..108165)
FT                   /transl_table=11
FT                   /locus_tag="NMA0114"
FT                   /product="50S ribosomal protein L6"
FT                   /note="NMA0114, rplF, 50S ribosomal protein L6, len: 177
FT                   aa; highly similar to many e.g. RL6_HAEIN P44347 50S
FT                   ribosomal protein L6 (176 aa), fasta scores; E(): 0, 60.8%
FT                   identity in 176 aa overlap. Contains Pfam match to entry
FT                   PF00347 Ribosomal_L6, Ribosomal protein L6, and PS00525
FT                   Ribosomal protein L6 signature 1"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0114"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07432"
FT                   /db_xref="GOA:Q9JX14"
FT                   /db_xref="InterPro:IPR000702"
FT                   /db_xref="InterPro:IPR002358"
FT                   /db_xref="InterPro:IPR019906"
FT                   /db_xref="InterPro:IPR020040"
FT                   /db_xref="InterPro:IPR036789"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9JX14"
FT                   /protein_id="CAM07432.1"
FT                   /translation="MSRVAKNPVTVPAGVEVKFGTEALVIKGKNGELSFPLHSDVAIEF
FT                   NDGKLTFVANNSSKQANAMSGTARALVSNMVKGVSEGFEKRLQLIGVGYRAQAQGKILN
FT                   LSLGFSHPIVYEMPEGVSVQTPSQTEIVLTGSDKQVVGQVAAEIRAFRAPEPYKGKGVR
FT                   YVGEVVVMKEAKKK"
FT   CDS_pept        complement(108179..108571)
FT                   /transl_table=11
FT                   /locus_tag="NMA0115"
FT                   /product="30S ribosomal protein S8"
FT                   /note="NMA0115, rpsH, 30S ribosomal protein S8, len: 130
FT                   aa; highly similar to many e.g. RS8_ECOLI P02361 (129
FT                   aa),fasta scores E(): 0, 71.3% identity in 129 aa overlap.
FT                   Contains Pfam match to entry PF00410 Ribosomal_S8,Ribosomal
FT                   protein S8, and PS00053 Ribosomal protein S8 signature"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0115"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07433"
FT                   /db_xref="GOA:P66627"
FT                   /db_xref="InterPro:IPR000630"
FT                   /db_xref="InterPro:IPR035987"
FT                   /db_xref="UniProtKB/Swiss-Prot:P66627"
FT                   /protein_id="CAM07433.1"
FT                   /translation="MSMHDPISDMLTRIRNAQRANKAAVAMPSSKLKCAIAKVLKEEGY
FT                   IEDFAVSSDVKSILEIQLKYYAGRPVIEQIKRVSRPGLRIYKASSEIPSVMNGLGIAIV
FT                   STSKGVMTDRKARSQGVGGELLCIVA"
FT   CDS_pept        complement(108587..108892)
FT                   /transl_table=11
FT                   /locus_tag="NMA0116"
FT                   /product="30S ribosomal protein S14"
FT                   /note="NMA0116, rpsN, 30S ribosomal protein S14, len: 101
FT                   aa; highly similar to many e.g. RS14_ECOLI P02370 30S
FT                   ribosomal protein S14 (100 aa), fasta scores; E(): 3.2e-23,
FT                   60.0% identity in 100 aa overlap. Contains Pfam match to
FT                   entry PF00253 Ribosomal_S14, Ribosomal protein S14"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0116"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07434"
FT                   /db_xref="GOA:P66407"
FT                   /db_xref="InterPro:IPR001209"
FT                   /db_xref="InterPro:IPR023036"
FT                   /db_xref="UniProtKB/Swiss-Prot:P66407"
FT                   /protein_id="CAM07434.1"
FT                   /translation="MAKKALINRDLKRQALAKKYAAKRAAIKAVINDSNATEEERFEAR
FT                   LRFQSIPRNAAPVRQRRRCALTGRPRGTFRKFGLGRIKIREIAMRGEIPGVVKASW"
FT   CDS_pept        complement(108895..109434)
FT                   /transl_table=11
FT                   /locus_tag="NMA0117"
FT                   /product="50S ribosomal protein L5"
FT                   /note="NMA0117, rplE, 50S ribosomal protein L5, len: 179
FT                   aa; highly similar to many e.g. RL5_HAEIN P44346 50S
FT                   ribosomal protein L5 (178 aa), fasta scores; E(): 0, 71.2%
FT                   identity in 177 aa overlap. Contains Pfam match to entry
FT                   PF00281 Ribosomal_L5, Ribosomal protein L5, Pfam match to
FT                   entry PF00673 Ribosomal_L5_C, ribosomal L5P family
FT                   C-terminus, and PS00358 Ribosomal protein L5 signature"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0117"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07435"
FT                   /db_xref="GOA:Q9JX13"
FT                   /db_xref="InterPro:IPR002132"
FT                   /db_xref="InterPro:IPR020929"
FT                   /db_xref="InterPro:IPR020930"
FT                   /db_xref="InterPro:IPR022803"
FT                   /db_xref="InterPro:IPR031309"
FT                   /db_xref="InterPro:IPR031310"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9JX13"
FT                   /protein_id="CAM07435.1"
FT                   /translation="MARLREFYKETVVPELVKQFGYKSVMEVPRIEKITLNMGVGEAIA
FT                   DKKVMEHAVSDLEKIAGQKPVVTVARKSIAGFKIRDNYPVGCKVTLRRDQMFEFLDRLI
FT                   TIALPRVRDFRGVSGKSFDGRGNYNMGVREQIIFPEIEYDKIDALRGLNITITTTAKTD
FT                   EEAKALLSLFKFPFKG"
FT   CDS_pept        complement(109444..109767)
FT                   /transl_table=11
FT                   /locus_tag="NMA0118"
FT                   /product="50S ribosomal protein L24"
FT                   /note="NMA0118, rplX, 50S ribosomal protein L24, len: 107
FT                   aa; highly similar to many e.g. RL24_HAEIN P44362 50S
FT                   ribosomal protein L24 (103 aa), fasta scores; E(): 5.8e-18,
FT                   53.8% identity in 104 aa overlap. Contains Pfam match to
FT                   entry PF00467 Ribosomal_L24, KOW motif, and PS01108
FT                   Ribosomal protein L24 signature"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0118"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07436"
FT                   /db_xref="GOA:P60732"
FT                   /db_xref="InterPro:IPR003256"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR005825"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR041988"
FT                   /db_xref="UniProtKB/Swiss-Prot:P60732"
FT                   /protein_id="CAM07436.1"
FT                   /translation="MNKIIKGDRVVVIAGKDKGKQGQVVRVLGDKVVVEGVNVVKRHQK
FT                   PNPMRGIEGGIITKEMPLDISNIAILNPETNKADRVGIKLIENEGKVKRVRFFKSNGSI
FT                   IGA"
FT   CDS_pept        complement(109779..110147)
FT                   /transl_table=11
FT                   /locus_tag="NMA0119"
FT                   /product="50S ribosomal protein L14"
FT                   /note="NMA0119, rplN, 50S ribosomal protein L14, len: 122
FT                   aa; highly similar to many e.g. RL14_ECOLI P02411 50S
FT                   ribosomal protein L14 (123 aa), fasta scores; E(): 0,78.9%
FT                   identity in 123 aa overlap. Contains Pfam match to entry
FT                   PF00238 Ribosomal_L14, Ribosomal protein L14, and PS00049
FT                   Ribosomal protein L14 signature"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0119"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07437"
FT                   /db_xref="GOA:Q9JQY4"
FT                   /db_xref="InterPro:IPR000218"
FT                   /db_xref="InterPro:IPR005745"
FT                   /db_xref="InterPro:IPR019972"
FT                   /db_xref="InterPro:IPR036853"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9JQY4"
FT                   /protein_id="CAM07437.1"
FT                   /translation="MIQMQTILDVADNSGARRVMCIKVLGGSKRRYASVGDIIKVAVKD
FT                   AAPRGRVKKGDVYNAVVVRTAKGVRRPDGALIKFDNNAAVLLNNKLEPLGTRIFGPVTR
FT                   ELRTERFMKIVSLAPEVL"
FT   CDS_pept        complement(110369..110632)
FT                   /transl_table=11
FT                   /locus_tag="NMA0120"
FT                   /product="30S ribosomal protein S17"
FT                   /note="NMA0120, rpsQ, 30S ribosomal protein S17, len: 97
FT                   aa; highly similar to many e.g. RS17_ECOLI P02373 30S
FT                   ribosomal protein S17 (83 aa), fasta scores; E():
FT                   1.7e-21,65.4% identity in 81 aa overlap. Contains Pfam
FT                   match to entry PF00366 Ribosomal_S17, Ribosomal protein
FT                   S17, and PS00056 Ribosomal protein S17 signature"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0120"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07438"
FT                   /db_xref="GOA:Q9JQL7"
FT                   /db_xref="InterPro:IPR000266"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019979"
FT                   /db_xref="InterPro:IPR019984"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9JQL7"
FT                   /protein_id="CAM07438.1"
FT                   /translation="MSETKNVRTLQGKVVSDKMDKTVTVLVERKVKHPLYGKIIRLSTK
FT                   IHAHDENNQYGIGDVVVISESRPLSKTKSWVVSELVEKARSI"
FT   CDS_pept        complement(110632..110823)
FT                   /transl_table=11
FT                   /locus_tag="NMA0121"
FT                   /product="50S ribosomal protein L29"
FT                   /note="NMA0121, rpmC, 50S ribosomal protein L29, len: 63
FT                   aa; highly similar to many e.g. RL29_ECOLI P02429 50S
FT                   ribosomal protein L29 (63 aa), fasta scores; E():
FT                   8.7e-13,63.5% identity in 63 aa overlap. Contains Pfam
FT                   match to entry PF00831 Ribosomal_L29, Ribosomal L29
FT                   protein, and PS00579 Ribosomal protein L29 signature"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0121"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07439"
FT                   /db_xref="GOA:P66168"
FT                   /db_xref="InterPro:IPR001854"
FT                   /db_xref="InterPro:IPR018254"
FT                   /db_xref="InterPro:IPR036049"
FT                   /db_xref="UniProtKB/Swiss-Prot:P66168"
FT                   /protein_id="CAM07439.1"
FT                   /translation="MKANELKDKSVEQLNADLLDLLKAQFGLRMQNATGQLGKPSELKR
FT                   VRRDIARIKTVLTEKGAK"
FT   CDS_pept        complement(110823..111239)
FT                   /transl_table=11
FT                   /locus_tag="NMA0122"
FT                   /product="50S ribosomal protein L16"
FT                   /note="NMA0122, rplP, 50S ribosomal protein L16, len: 138
FT                   aa; highly similar to many e.g. RL16_ECOLI P02414 50S
FT                   ribosomal protein L16 (136 aa), fasta scores; E(): 0,79.4%
FT                   identity in 136 aa overlap. Contains Pfam match to entry
FT                   PF00252 Ribosomal_L16, Ribosomal protein L16"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0122"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07440"
FT                   /db_xref="GOA:Q9JR26"
FT                   /db_xref="InterPro:IPR000114"
FT                   /db_xref="InterPro:IPR016180"
FT                   /db_xref="InterPro:IPR020798"
FT                   /db_xref="InterPro:IPR036920"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9JR26"
FT                   /protein_id="CAM07440.1"
FT                   /translation="MLQPTRLKYRKQQKGRNTGIATRGNKVSFGEFGLKAVGRGRLTAR
FT                   QIEAARRAMTRHIKRGGRIWIRVFPDKPITEKPIQVRMGGGKGNVEYYIAEIKPGKVLY
FT                   EMDGVPEELAREAFELAAAKLPIPTTFVVRQVGQ"
FT   CDS_pept        complement(111223..111915)
FT                   /transl_table=11
FT                   /locus_tag="NMA0123"
FT                   /product="30S ribosomal protein S3"
FT                   /note="NMA0123, rpsC, 30S ribosomal protein S3, len: 230
FT                   aa; simlar to many e.g. RS3_ECOLI P02352 30S ribosomal
FT                   protein S3 (232 aa), fasta scores; E(): 0, 59.7% identity
FT                   in 233 aa overlap. Contains Pfam match to entry PF00417
FT                   Ribosomal_S3_N, Ribosomal protein S3, N-terminal
FT                   domain,Pfam match to entry PF00013 KH-domain, KH domain,
FT                   Pfam match to entry PF00189 Ribosomal_S3_C, Ribosomal
FT                   protein S3, C-terminal domain, and PS00548 Ribosomal
FT                   protein S3 signature"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0123"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07441"
FT                   /db_xref="GOA:P66550"
FT                   /db_xref="InterPro:IPR001351"
FT                   /db_xref="InterPro:IPR004044"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR005704"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR018280"
FT                   /db_xref="InterPro:IPR036419"
FT                   /db_xref="UniProtKB/Swiss-Prot:P66550"
FT                   /protein_id="CAM07441.1"
FT                   /translation="MGQKINPTGFRLAVTKDWASKWFAKSTDFSTVLKQDIDVRNYLRQ
FT                   KLANASVGRVVIERPAKSARITIHSARPGVVIGKKGEDIEVLKRDLQVLMGVPVHVNIE
FT                   EIRRPELDAQIIADGIAQQLEKRVQFRRAMKRAMQNAMRSGAKGIKIMTSGRLNGADIA
FT                   RSEWYREGRVPLHTLRANVDYATSEAHTTYGVLGLKVWVYTEGNIKSSKPEHESKQRKA
FT                   GRRNAAAN"
FT   CDS_pept        complement(111925..112254)
FT                   /transl_table=11
FT                   /locus_tag="NMA0124"
FT                   /product="50S ribosomal protein L22"
FT                   /note="NMA0124, rplV, 50S ribosomal protein L22, len: 109
FT                   aa; highly similar to many e.g. RL22_ACTAC P55838 50S
FT                   ribosomal protein L22 (110 aa), fasta scores; E(): 4.3e-27,
FT                   67.9% identity in 109 aa overlap. Contains Pfam match to
FT                   entry PF00237 Ribosomal_L22, Ribosomal protein L22, and
FT                   PS00464 Ribosomal protein L22 signature"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0124"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07442"
FT                   /db_xref="GOA:Q9JRD8"
FT                   /db_xref="InterPro:IPR001063"
FT                   /db_xref="InterPro:IPR005727"
FT                   /db_xref="InterPro:IPR018260"
FT                   /db_xref="InterPro:IPR036394"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9JRD8"
FT                   /protein_id="CAM07442.1"
FT                   /translation="MRVNAQHKNARISAQKARLVADLIRGKDVAQALNILAFSPKKGAE
FT                   LIKKVLESAIANAEHNNGADIDELKVVTIFVDKGPSLKRFQARAKGRGNRIEKQTCHIN
FT                   VTVGN"
FT   CDS_pept        complement(112263..112541)
FT                   /transl_table=11
FT                   /locus_tag="NMA0125"
FT                   /product="30S ribosomal protein S19"
FT                   /note="NMA0125, rpsS, 30S ribosomal protein S19, len: 92
FT                   aa; highly similar to many e.g. RS19_ECOLI P02375 30S
FT                   ribosomal protein S19 (91 aa), fasta scores; E():
FT                   3e-31,75.6% identity in 90 aa overlap. Contains Pfam match
FT                   to entry PF00203 Ribosomal_S19, Ribosomal protein S19, and
FT                   PS00323 Ribosomal protein S19 signature E-value 9.1e-51"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0125"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07443"
FT                   /db_xref="GOA:P66486"
FT                   /db_xref="InterPro:IPR002222"
FT                   /db_xref="InterPro:IPR005732"
FT                   /db_xref="InterPro:IPR020934"
FT                   /db_xref="InterPro:IPR023575"
FT                   /db_xref="UniProtKB/Swiss-Prot:P66486"
FT                   /protein_id="CAM07443.1"
FT                   /translation="MARSLKKGPYVDLHLLKKVDAARASNDKRPIKTWSRRSTILPDFI
FT                   GLTIAVHNGRTHVPVFISDNMVGHKLGEFSLTRTFKGHLADKKAKKK"
FT   CDS_pept        complement(112548..113381)
FT                   /transl_table=11
FT                   /locus_tag="NMA0126"
FT                   /product="50S ribosomal protein L2"
FT                   /note="NMA0126, rplB, 50S ribosomal protein L2, len: 277
FT                   aa; highly similar to many e.g. RL2_YERPS P11255 50S
FT                   ribosomal protein L2 (274 aa), fasta scores; E(): 0, 69.1%
FT                   identity in 272 aa overlap. Contains Pfam match to entry
FT                   PF00181 Ribosomal_L2, Ribosomal Proteins L2, and PS00467
FT                   Ribosomal protein L2 signature"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0126"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07444"
FT                   /db_xref="GOA:Q9JX12"
FT                   /db_xref="InterPro:IPR002171"
FT                   /db_xref="InterPro:IPR005880"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR014726"
FT                   /db_xref="InterPro:IPR022666"
FT                   /db_xref="InterPro:IPR022669"
FT                   /db_xref="InterPro:IPR022671"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9JX12"
FT                   /protein_id="CAM07444.1"
FT                   /translation="MAIVKMKPTSAGRRGMVRVVTEGLHKGAPYAPLLEKKNSTAGRNN
FT                   NGHITTRHKGGGHKHHYRVVDFKRNKDGIPAKVERIEYDPNRTAFIALLCYADGERRYI
FT                   IAPRGIQAGAVLVSGAEAAIKVGNTLPIRNIPVGTTIHCIEMKPGKGAQIARSAGASAV
FT                   LLAKEGAYAQVRLRSGEVRKINVNCRATIGEVGNEEQSLKKIGKAGANRWRGIRPTVRG
FT                   VVMNPVDHPHGGGEGRTGEAREPVSPWGTPAKGYRTRNNKRTDNMIVRRRYSNKG"
FT   CDS_pept        complement(113387..113707)
FT                   /transl_table=11
FT                   /locus_tag="NMA0127"
FT                   /product="50S ribosomal protein L23"
FT                   /note="NMA0127, rplW, 50S ribosomal protein L23, len: 106
FT                   aa; highly similar to many e.g. RL23_ACTAC P55839 50S
FT                   ribosomal protein L23 (100 aa), fasta scores; E(): 9.3e-16,
FT                   56.6% identity in 99 aa overlap. Contains Pfam match to
FT                   entry PF00276 Ribosomal_L23, Ribosomal protein L23 E-value
FT                   2.5e-32"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0127"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07445"
FT                   /db_xref="GOA:Q9JX11"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR012678"
FT                   /db_xref="InterPro:IPR013025"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9JX11"
FT                   /protein_id="CAM07445.1"
FT                   /translation="MGMNQQRLTQVILAPIVSEKSNVLAEKRNQMTFKVLANATKPEIK
FT                   AAVELLFGVQVASVTTVTTKGKTKRFGRTLGRRSDVKKAYVSLAAGQELDLEAAAAAAD
FT                   KE"
FT   CDS_pept        complement(113698..114318)
FT                   /transl_table=11
FT                   /locus_tag="NMA0128"
FT                   /product="50S ribosomal protein L4"
FT                   /note="NMA0128, rplD, 50S ribosomal protein L4, len: 206
FT                   aa; similar to many e.g. RL4_ACTAC P55836 50S ribosomal
FT                   protein L4 (200 aa), fasta scores; E(): 0, 54.7% identity
FT                   in 203 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0128"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07446"
FT                   /db_xref="GOA:P61056"
FT                   /db_xref="InterPro:IPR002136"
FT                   /db_xref="InterPro:IPR013005"
FT                   /db_xref="InterPro:IPR023574"
FT                   /db_xref="UniProtKB/Swiss-Prot:P61056"
FT                   /protein_id="CAM07446.1"
FT                   /translation="MELKVIDAKGQVSGSLSVSDALFAREYNEALVHQLVNAYLANARS
FT                   GNRAQKTRAEVKHSTKKPWRQKGTGRARSGMTSSPLWRKGGRAFPNKPDENFTQKVNRK
FT                   MYRAGMATILSQLTRDERLFAIEALTAETPKTKVFAEQVKNLGLEQVLFVTKQLDENVY
FT                   LASRNLPNVLVLEAQQVDPYSLLRYKKVIITKDAVAQLEEQWV"
FT   CDS_pept        complement(114318..114962)
FT                   /transl_table=11
FT                   /locus_tag="NMA0129"
FT                   /product="50S ribosomal protein L3"
FT                   /note="NMA0129, rplC, 50S ribosomal protein L3, len: 214
FT                   aa; highly similar to many e.g. RL3_ECOLI P02386 50S
FT                   ribosomal protein L3 (209 aa), fasta scores; E(): 0, 67.5%
FT                   identity in 209 aa overlap. Contains Pfam match to entry
FT                   PF00297 Ribosomal_L3, Ribosomal protein L3, and PS00474
FT                   Ribosomal protein L3 signature"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0129"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07447"
FT                   /db_xref="GOA:P60443"
FT                   /db_xref="InterPro:IPR000597"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR019926"
FT                   /db_xref="InterPro:IPR019927"
FT                   /db_xref="UniProtKB/Swiss-Prot:P60443"
FT                   /protein_id="CAM07447.1"
FT                   /translation="MTLGLVGRKVGMTRVFDEQGVSVPVTVLDMSANRVTQVKSKDTDG
FT                   YTAVQVTFGQKKANRVNKAEAGHFAKAGVEAGRGLIEFALTEEKLAELKAGDEITVSMF
FT                   EVGQLVDVTGTSKGKGFSGTIKRHNFGAQRTSHGNSRSHRVPGSIGMAQDPGRVFPGKR
FT                   MAGQYGNTKATVQKLEVVRVDAERQLLLVKGAVPGAVNSDVVVRPSVKVGA"
FT   CDS_pept        complement(115181..115864)
FT                   /transl_table=11
FT                   /locus_tag="NMA0131"
FT                   /product="hypothetical protein NMA0131"
FT                   /note="NMA0131, possible ATP/GTP binding protein, len: 227
FT                   aa; some similarity in ATP/GTP binding domain to TR:Q9ZL99
FT                   (EMBL:AE001499) Helicobacter pylori J99 hypothetical
FT                   protein (404 aa), fasta scores; E(): 0.00018, 37.3%
FT                   identity in 102 aa overlap. Contains PS00017
FT                   ATP/GTP-binding site motif A (P-loop). Also similar to
FT                   upstream gene NMA0132 (43.2% identity in 229 aa overlap)"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0131"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07448"
FT                   /db_xref="GOA:A0A0U1RGU4"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RGU4"
FT                   /protein_id="CAM07448.1"
FT                   /translation="MHRYRISEIGQKVTAAGFRHLDVLLVGATGVGKSSTLNALFGEQK
FT                   AKVGTGVDPETQLVESYMLNDVLRFWDSAGLGDGKEADRAHRQKLIDVLSKTYTHSDGQ
FT                   WGWIDLVFVILDGSSRDLGTAYDLLRDVILKMIDPDRVIVAINQADMAMKGRYWDKVLH
FT                   QPQPNLQQFLDEKAESVQKRILEATGLQISKPVYYSAYENYHLKEIMDAVINHIPVCRR
FT                   KMHTP"
FT   CDS_pept        complement(115873..116928)
FT                   /transl_table=11
FT                   /locus_tag="NMA0132"
FT                   /product="hypothetical protein NMA0132"
FT                   /note="NMA0132, possible ATP/GTP binding protein, len: 351
FT                   aa; similar to downstream gene NMA0131 (43.2% identity in
FT                   229 aa overlap). Contains PS00017 ATP/GTP-binding site
FT                   motif A (P-loop)"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0132"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07449"
FT                   /db_xref="GOA:A0A0U1RGU5"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RGU5"
FT                   /protein_id="CAM07449.1"
FT                   /translation="MMFYSQVNKGKMMSLLNVFKDILNNKELNSEERHDLERAVKILQD
FT                   THVNILITGATGCGKSSTINALFSIDQATGKSDGLVKEVAKVGVGVDPETMDIAKYELE
FT                   NMTIWDSPGLGDGEKADQKHRRNIINKLLEKDSNGNAVIDLVLVLLDGGSRDLGTSYEL
FT                   INNVIINTLKKSGEGRTDRLLVAINQCDMAMKGRNWDAEAGRPNAALENFLEEKVCSTR
FT                   KRIQEATGVTVNPIYFSAGFKSEDEEQRPYNITRLLRYIITAMPSEKRVIVAEKINVEE
FT                   IERDTSRRKQEERQEIDSSIGSALEKILGAAGGVVKDVVSTIASGVGTLIGGAAKAIGG
FT                   AISTVASFFGW"
FT   CDS_pept        complement(116903..117163)
FT                   /transl_table=11
FT                   /locus_tag="NMA0132A"
FT                   /product="hypothetical protein NMA0132A"
FT                   /note="NMA0132A, unknown, len: 86 aa; contains G(9)
FT                   homopolymeric tract"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0132A"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07450"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RGU6"
FT                   /protein_id="CAM07450.1"
FT                   /translation="MPSENMRRQTDLRQNNKIKKQCGRRNRLILCLKNFQTAFFSEQNR
FT                   IFFIHSLPKACPPPKKGRIGLGLGRSIHLILRMDDVLFSSK"
FT   CDS_pept        complement(117216..117527)
FT                   /transl_table=11
FT                   /locus_tag="NMA0133"
FT                   /product="30S ribosomal protein S10"
FT                   /note="NMA0133, rpsJ, 30S ribosomal protein S10, len: 103
FT                   aa; almost identical to RS10_NEIGO P48851 30S ribosomal
FT                   protein S10 (103 aa), fasdta scores; E(): 0, 97.1% identity
FT                   in 103 aa overlap. Contains PS00361 Ribosomal protein S10
FT                   signature, and Pfam match to entry PF00338 Ribosomal_S10,
FT                   Ribosomal protein S10p/S20e"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0133"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07451"
FT                   /db_xref="GOA:P66332"
FT                   /db_xref="InterPro:IPR001848"
FT                   /db_xref="InterPro:IPR018268"
FT                   /db_xref="InterPro:IPR027486"
FT                   /db_xref="InterPro:IPR036838"
FT                   /db_xref="UniProtKB/Swiss-Prot:P66332"
FT                   /protein_id="CAM07451.1"
FT                   /translation="MANQKIRIRLKAYDYALIDRSAQEIVETAKRTGAVVKGPIPLPTK
FT                   IERFNILRSPHVNKTSREQLEIRTHLRLMDIVDWTDKTTDALMKLDLPAGVDVEIKVQ"
FT   CDS_pept        complement(117545..118729)
FT                   /transl_table=11
FT                   /locus_tag="NMA0134"
FT                   /product="elongation factor TU"
FT                   /note="NMA0134, tufA1, elongation factor TU, len; 394 aa;
FT                   almost identical to EFTU_NEIGO P48864 elongation factor TU
FT                   (EF-TU) (394 aa), fasta scores; E(): 0, 97.7% identity in
FT                   394 aa overlap. Contains Pfam match to entry PF00009
FT                   GTP_EFTU, Elongation factor Tu family, PS00017
FT                   ATP/GTP-binding site motif A (P-loop), and PS00301
FT                   GTP-binding elongation factors signature. Identical to
FT                   tufA2, NM149"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0134"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07452"
FT                   /db_xref="GOA:P64026"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004160"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004541"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR033720"
FT                   /db_xref="InterPro:IPR041709"
FT                   /db_xref="UniProtKB/Swiss-Prot:P64026"
FT                   /protein_id="CAM07452.1"
FT                   /translation="MAKEKFERSKPHVNVGTIGHVDHGKTTLTAALTTILAKKFGGAAK
FT                   AYDQIDNAPEEKARGITINTSHVEYETETRHYAHVDCPGHADYVKNMITGAAQMDGAIL
FT                   VCSAADGPMPQTREHILLARQVGVPYIIVFMNKCDMVDDAELLELVEMEIRDLLSSYDF
FT                   PGDDCPIVQGSALKALEGDAAYEEKIFELAAALDSYIPTPERAVDKPFLLPIEDVFSIS
FT                   GRGTVVTGRVERGIIHVGDEIEIVGLKETQKTTCTGVEMFRKLLDEGQAGDNVGVLLRG
FT                   TKREDVERGQVLAKPGTITPHTKFKAEVYVLSKEEGGRHTPFFANYRPQFYFRTTDVTG
FT                   AVTLEEGVEMVMPGENVTITVELIAPIAMEEGLRFAIREGGRTVGAGVVSSVIA"
FT   CDS_pept        complement(118817..120922)
FT                   /transl_table=11
FT                   /locus_tag="NMA0135"
FT                   /product="elongation factor G"
FT                   /note="NMA0135, fusA, elongation factor G, len: 701 aa;
FT                   highly similar to many e.g. EFG_HAEIN P43925 elongation
FT                   factor G (EF-G) (699 aa), fasta scores; E(): 0, 75.1%
FT                   identity in 700 aa overlap. Contains Pfam match to entry
FT                   PF00009 GTP_EFTU, Elongation factor Tu family, Pfam match
FT                   to entry PF00679 EFG_C, Elongation factor G C-terminus and
FT                   PS00017 ATP/GTP-binding site motif A (P-loop), and PS00301
FT                   GTP-binding elongation factors signature"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0135"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07453"
FT                   /db_xref="GOA:Q9JX07"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004540"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR005517"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009022"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035649"
FT                   /db_xref="InterPro:IPR041095"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9JX07"
FT                   /protein_id="CAM07453.1"
FT                   /translation="MARKTPISLYRNIGISAHIDAGKTTTTERILFYTGLTHKLGEVHD
FT                   GAATTDYMEQEQERGITITSAAVTSYWSGMAKQFPEHRFNIIDTPGHVDFTVEVERSMR
FT                   VLDGAVMVYCAVGGVQPQSETVWRQANKYQVPRLAFVNKMDRQGANFFRVVEQMKTRLR
FT                   ANPVPIVIPVGAEDNFSGVVDLLKMKSIIWNEADKGTTFTYGDIPAELVETAEEWRQNM
FT                   IEAAAEASEELMDKYLGGDELTEEEIVGALRQRTLAGEIQPMLCGSAFKNKGVQRMLDA
FT                   VVELLPAPTDIPPVQGVNPNTEEADSRQASDEEKFSALAFKMLNDKYVGQLTFIRVYSG
FT                   VVKSGDTVLNSVKGTRERIGRLVQMTAADRTEIEEVRAGDIAAAIGLKDVTTGETLCAE
FT                   SAPIILERMEFPEPVIHIAVEPKTKADQEKMGIALNRLAKEDPSFRVRTDEESGQTIIS
FT                   GMGELHLEIIVDRMKREFGVEANIGAPQVAYRETIRKAVKAEYKHAKQSGGKGQYGHVV
FT                   IEMEPMEPGGEGYEFIDEIKGGVIPREFIPSVDKGIRDTLPNGIVAGYPVVDVRIRLVF
FT                   GSYHDVDSSQLAFELAASQAFKEGMRQASPALLEPIMAVEVETPEEYMGDVMGDLNRRR
FT                   GVVLGMDDDGIGGKKVRAEVPLAEMFGYSTDLRSATQGRATYSMEFKKYSEAPAHIAAA
FT                   VTEARKG"
FT   CDS_pept        complement(120941..121411)
FT                   /transl_table=11
FT                   /locus_tag="NMA0136"
FT                   /product="30S ribosomal protein S7"
FT                   /note="NMA0136, rpsG, 30S ribosomal protein S7, len: 156
FT                   aa; highly similar to many e.g. RS7_EIKCO P35642 30S
FT                   ribosomal protein S7 (157 aa), fasta scores; E(): 0, 92.4%
FT                   identity in 157 aa overlap. Contains Pfam match to entry
FT                   PF00177 Ribosomal_S7, Ribosomal protein S7, and PS00052
FT                   Ribosomal protein S7 signature"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0136"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07454"
FT                   /db_xref="GOA:P66613"
FT                   /db_xref="InterPro:IPR000235"
FT                   /db_xref="InterPro:IPR005717"
FT                   /db_xref="InterPro:IPR020606"
FT                   /db_xref="InterPro:IPR023798"
FT                   /db_xref="InterPro:IPR036823"
FT                   /db_xref="UniProtKB/Swiss-Prot:P66613"
FT                   /protein_id="CAM07454.1"
FT                   /translation="MPRRREVPKRDVLPDPKFGSVELTKFMNVLMIDGKKSVAERIVYG
FT                   ALEQIEKKTGKVAIEVFNEAIANAKPIVEVKSRRVGGANYQVPVEVRPSRRLALAMRWV
FT                   RDAARKRGEKSMDLRLAGELIDASEGRGGALKKREEVHRMAEANKAFSHFRF"
FT   CDS_pept        complement(121529..121900)
FT                   /transl_table=11
FT                   /locus_tag="NMA0137"
FT                   /product="30S ribosomal protein S12"
FT                   /note="NMA0137, rpsL, 30S ribosomal protein S12, len: 123
FT                   aa; highly similar to many e.g. RS12_HAEIN P44412 30S
FT                   ribosomal protein S12 (123 aa), fasta scores; E(): 0,88.4%
FT                   identity in 121 aa overlap. Pfam match to entry PF00164
FT                   Ribosomal_S12, Ribosomal protein S12, and Contains PS00055
FT                   Ribosomal protein S12 signature"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0137"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07455"
FT                   /db_xref="GOA:P66374"
FT                   /db_xref="InterPro:IPR005679"
FT                   /db_xref="InterPro:IPR006032"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/Swiss-Prot:P66374"
FT                   /protein_id="CAM07455.1"
FT                   /translation="MPTINQLVRKGRQKPVYVNKVPALEACPQKRGVCTRVYTTTPKKP
FT                   NSALRKVCKVRLTNGFEVISYIGGEGHNLQEHSVVLIRGGRVKDLPGVRYHTVRGSLDT
FT                   AGVKDRKQARSKYGAKRPK"
FT   CDS_pept        complement(122079..122228)
FT                   /transl_table=11
FT                   /locus_tag="NMA0138"
FT                   /product="hypothetical protein NMA0138"
FT                   /note="NMA0138, unknown, len: 49 aa; similar to the extreme
FT                   C-terminus of Moraxella catarrhalis TR:O85087
FT                   (EMBL:AF043131) hypothetical 60.4 kd protein (538 aa),fasta
FT                   scores; E(): 2.6e-07, 34.7% identity in 49 aa overlap. Also
FT                   similar to the C-terminus of NMA1678 (60.9% identity in 46
FT                   aa overlap), NMA0476 (43.5% identity in 46 aa overlap), and
FT                   NMA2174 (33.3% identity in 48 aa overlap)"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0138"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07456"
FT                   /db_xref="InterPro:IPR007655"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RGU7"
FT                   /protein_id="CAM07456.1"
FT                   /translation="MSAALWHKKLSWKGFTPQINFRYNKINSNMPAFYSRSSKEWFVSI
FT                   EKTY"
FT   CDS_pept        complement(122225..122482)
FT                   /transl_table=11
FT                   /locus_tag="NMA0139"
FT                   /product="putative periplasmic protein"
FT                   /note="NMA0139, possible periplasmic protein, len: 85 aa;
FT                   contains possible N-terminal signal sequence"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0139"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07457"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RGU8"
FT                   /protein_id="CAM07457.1"
FT                   /translation="MKPRNLFFAGCLLTSATFAEDIGVPVELINVGNRIAMPSEGESLA
FT                   LLPFAEDVPPVRDAMPSEVPKSAAGGDVRGDRMGMPINIG"
FT   CDS_pept        complement(122531..122680)
FT                   /transl_table=11
FT                   /locus_tag="NMA0140"
FT                   /product="hypothetical protein NMA0140"
FT                   /note="NMA0140, unknown, len: 49 aa"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0140"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07458"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RGU9"
FT                   /protein_id="CAM07458.1"
FT                   /translation="MRRVDYSLGIFGPETNEVAGVVGTSGDQNNFAKDVGFGGQKSSVL
FT                   MFSI"
FT   CDS_pept        complement(122773..126948)
FT                   /transl_table=11
FT                   /locus_tag="NMA0141"
FT                   /product="DNA-directed RNA polymerase beta' chain"
FT                   /EC_number="2.7.7.6"
FT                   /note="NMA0141, rpoC, DNA-directed RNA polymerase beta'
FT                   chain, len: 1391 aa; highly similar to many e.g. RPOC_ECOLI
FT                   P00577 DNA-directed RNA polymerase beta' chain (EC 2.7.7.6)
FT                   (1407 aa), fasta scores; E(): 0, 67.1% identity in 1388 aa
FT                   overlap. Contains Pfam match to entry PF00623 RNA_pol_A,
FT                   RNA polymerase alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0141"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07459"
FT                   /db_xref="GOA:Q9JX03"
FT                   /db_xref="InterPro:IPR000722"
FT                   /db_xref="InterPro:IPR006592"
FT                   /db_xref="InterPro:IPR007066"
FT                   /db_xref="InterPro:IPR007080"
FT                   /db_xref="InterPro:IPR007081"
FT                   /db_xref="InterPro:IPR007083"
FT                   /db_xref="InterPro:IPR012754"
FT                   /db_xref="InterPro:IPR038120"
FT                   /db_xref="InterPro:IPR042102"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9JX03"
FT                   /protein_id="CAM07459.1"
FT                   /translation="MNLLNLFNPLQTAGMEEEFDAIKIGIASPETIRSWSYGEVKKPET
FT                   INYRTFKPERDGLFCAKIFGPVKDYECLCGKYKRLKFKGVTCEKCGVEVTLSKVRRERM
FT                   GHIELAAPVAHIWFLKSLPSRLGMVLDMTLRDIERVLYFEAFVVTDPGMTPLQRRQLLT
FT                   EDDYYNKLDEYGDDFDAKMGAEGIRELLRTLNVAGEIEILRQELESTGSDTKIKKIAKR
FT                   LKVLEAFHRSGMKLEWMIMDVLPVLPPDLRPLVPLDGGRFATSDLNDLYRRVINRNNRL
FT                   KRLLELHAPDIIVRNEKRMLQEAVDSLLDNGRRGKAMTGANKRPLKSLADMIKGKGGRF
FT                   RQNLLGKRVDYSGRSVITVGPYLRLHQCGLPKKMALELFKPFIFHKLEKQGLASTVKAA
FT                   KKLVEQEVPEVWDILEEVIREHPIMLNRAPTLHRLGIQAFEPILIEGKAIQLHPLVCAA
FT                   FNADFDGDQMAVHVPLSLEAQMEARTLMLASNNVLSPANGEPIIVPSQDIVLGLYYMTR
FT                   DRINAKGEGSLFADVKEVHRAYHTKQVELGTKITVRLREWVKNEAGEFEPVVNRYETTV
FT                   GRALLSEILPKGLPFEYVNKALKKKEISKLINASFRLCGLRDTVIFADHLMYTGFGFAA
FT                   KGGISIAVDDMEIPKEKAALLAEANAEVKEIEDQYRQGLVTNGERYNKVVDIWGRAGDK
FT                   IAKAMMDNLSKQKVIDRDGNEVDQESFNSIYMMADSGARGSAAQIKQLSGMRGLMAKPD
FT                   GSIIETPITSNFREGLTVLQYFIATHGARKGLADTALKTANSGYLTRRLVDVTQDLVVV
FT                   EDDCGTSDGFVMKAVVQGGDVIEALRDRILGRVTASDVVDPSSGETLVEAGTLLTEKLV
FT                   DMIDQSGVDEVKVRTPITCKTRHGLCAHCYGRDLARGKLVNAGEAVGVIAAQSIGEPGT
FT                   QLTMRTFHIGGAASRAAAASQVEAKSNGTARFSSQMRYVANNKGELVVIGRSCEVVIHD
FT                   DIGRERERHKVPYGAILLVQDGMAIKAGQTLATWDPHTRPMITEHAGMVKFENVEEGVT
FT                   VAKQTDDVTGLSTLVVIDGKRRSSSASKLLRPTVKLLDENGVEICIPGTSTPVSMAFPV
FT                   GAVITVREGQEIGKGDVLARIPQASSKTRDITGGLPRVAELFEARVPKDAGMLAEITGT
FT                   VSFGKETKGKQRLIVTDVDGVAYETLISKEKQILVHDGQVVNRGETIVDGAVDPHDILR
FT                   LQGIEALARYIVQEVQEVYRLQGVKISDKHIEVIIRQMLRRVNIADAGETGFITGEQVE
FT                   RGDVMAANEKALEEGKEPARYENVLLGITKASLSTDSFISAASFQETTRVLTEAAIMGK
FT                   QDELRGLKENVIVGRLIPAGTGLTYHRSRHQQWQGVEQETAETQVTDE"
FT   CDS_pept        complement(127100..131278)
FT                   /transl_table=11
FT                   /locus_tag="NMA0142"
FT                   /product="DNA-directed RNA polymerase beta chain"
FT                   /EC_number="2.7.7.6"
FT                   /note="NMA0142, rpoB, DNA-directed RNA polymerase beta
FT                   chain, len: 1392 aa; almost identical to RPOB_NEIME Q59622
FT                   DNA-directed RNA polymerase beta chain (EC 2.7.7.6) (1389
FT                   aa), fasta scores; E(): 0, 95.9% identity in 1392 aa
FT                   overlap, and similar to many e.g. RPOB_ECOLI P00575
FT                   DNA-directed RNA polymerase beta chain (EC 2.7.7.6) (1342
FT                   aa), fasta scores; E(): 0, 64.5% identity in 1393 aa
FT                   overlap. Contains Pfam match to entry PF00562 RNA_pol_B,RNA
FT                   polymerase beta subunit, and PS01166 RNA polymerases beta
FT                   chain signature"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0142"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07460"
FT                   /db_xref="GOA:P57009"
FT                   /db_xref="InterPro:IPR007120"
FT                   /db_xref="InterPro:IPR007121"
FT                   /db_xref="InterPro:IPR007641"
FT                   /db_xref="InterPro:IPR007642"
FT                   /db_xref="InterPro:IPR007644"
FT                   /db_xref="InterPro:IPR007645"
FT                   /db_xref="InterPro:IPR010243"
FT                   /db_xref="InterPro:IPR014724"
FT                   /db_xref="InterPro:IPR015712"
FT                   /db_xref="InterPro:IPR019462"
FT                   /db_xref="InterPro:IPR037033"
FT                   /db_xref="InterPro:IPR037034"
FT                   /db_xref="InterPro:IPR042107"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57009"
FT                   /protein_id="CAM07460.1"
FT                   /translation="MSYSFTEKKRIRKSFAKRENVLEVPFLLATQIDSYAKFLQLENAF
FT                   DKRTDDGLQAAFNSIFPIVSHNGYARLEFVHYTLGEPLFDIPECQLRGITYAAPLRARI
FT                   RLVILDKEASKPTVKEVRENEVYMGEIPLMTPSGSFVINGTERVIVSQLHRSPGVFFEH
FT                   DKGKTHSSGKLLFSARIIPYRGSWLDFEFDPKDLLYFRIDRRRKMPVTILLKALGYNNE
FT                   QILDIFYDKETFYLSSNGVQTDLVAGRLKGETAKVDILDKEGNVLVAKGKRITAKNIRD
FT                   ITNAGLTRLDVEPESLLGKALAADLIDSETGEVLASANDEITEELLAKFDINGVKEITT
FT                   LYINELDQGAYISNTLRTDETAGRQAARVAIYRMMRPGEPPTEEAVEQLFNRLFFSEDS
FT                   YDLSRVGRMKFNTRTYEQKLSEAQQNSWYGRLLNETFAGAADKGGYVLSVEDIVASIAT
FT                   LVELRNGHGEVDDIDHLGNRRVRSVGELTENQFRSGLARVERAVKERLNQAESENLMPH
FT                   DLINAKPVSAAIKEFFGSSQLSQFMDQTNPLSEVTHKRRVSALGPGGLTRERAGFEVRD
FT                   VHPTHYGRVCPIETPEGPNIGLINSLSVYARTNDYGFLETPYRRVIDGKVTEEIDYLSA
FT                   IEEGRYVIAQANADLDSDGNLIGDLVTCREKGETIMATPDRVQYMDVATGQVVSVAASL
FT                   IPFLEHDDANRALMGANMQRQAVPCLRPEKPMVGTGIERSVAVDSATAIVARRGGVVEY
FT                   VDANRVVVRVHDDEATAGEVGVDIYNLVKFTRSNQSTNINQRPAVKAGDVLQRGDLVAD
FT                   GASTDLGELALGQNMTIAFMPWNGYNYEDSILISEKVAADDRYTSIHIEELNVVARDTK
FT                   LGAEDITRDIPNLSERMQNRLDESGIVYIGAEVEAGDVLVGKVTPKGETQLTPEEKLLR
FT                   AIFGEKASDVKDTSLRMPTGMSGTVIDVQVFTREGIQRDKRAQSIIDSELKRYRLDLND
FT                   QLRIFDNDAFDRIERMIVGQKANGGPMKLAKGSEITTEYLAGLPSRHDWFDIRLTDEDL
FT                   AKQLELIKVSLQQKREEADELYEIKKKKLTQGDELQPGVQKMVKVFIAIKRRLQAGDKM
FT                   AGRHGNKGVVSRILPVEDMPYMADGRPVDIVLNPLGVPSRMNIGQILEVHLGWAAKGIG
FT                   ERIDRMLKEQRKAGELREFLNRLYNGSGKKEDLDALTDEEIIELASNLRKGASFASPVF
FT                   DGAKESEIREMLNLAYPSDDPEVEKLGFNDSKTQITLYDGRSGEAFDRKVTVGVMHYLK
FT                   LHHLVDEKMHARSTGPYSLVTQQPLGGKAQFGGQRFGEMEVWALEAYGAAYTLQEMLTV
FT                   KSDDVNGRTKMYENIVKGEHKIDAGMPESFNVLVKEIRSLGLDIDLERY"
FT   CDS_pept        complement(131469..131840)
FT                   /transl_table=11
FT                   /locus_tag="NMA0143"
FT                   /product="50S ribosomal protein L7/L12"
FT                   /note="NMA0143, rplL, 50S ribosomal protein L7/L12, len:
FT                   123 aa; highly similar to many e.g. RL7_BACST P05392 50S
FT                   ribosomal protein L7/L12 (122 aa), fasta scores; E():
FT                   3e-23, 71.3% identity in 122 aa overlap. Contains Pfam
FT                   match to entry PF00542 Ribosomal_L12, Ribosomal protein
FT                   L7/L12 C-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0143"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07461"
FT                   /db_xref="GOA:P0A0X0"
FT                   /db_xref="InterPro:IPR000206"
FT                   /db_xref="InterPro:IPR008932"
FT                   /db_xref="InterPro:IPR013823"
FT                   /db_xref="InterPro:IPR014719"
FT                   /db_xref="InterPro:IPR036235"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0A0X0"
FT                   /protein_id="CAM07461.1"
FT                   /translation="MAITKEDILEAVGSLTVMELNDLVKAFEEKFGVSAAAVAVAGPAG
FT                   AGAADAEEKTEFDVVLASAGDQKVGVIKVVRAITGLGLKEAKDIVDGAPKTIKEGVSKA
FT                   EAEDIQKQLEEAGAKVEIK"
FT   CDS_pept        complement(131898..132398)
FT                   /transl_table=11
FT                   /locus_tag="NMA0144"
FT                   /product="50S ribosomal protein L10"
FT                   /note="NMA0144, rplJ, 50S ribosomal protein L10, len: 166
FT                   aa; similar to many e.g. RL10_ECOLI P02408 50S ribosomal
FT                   protein L10 (164 aa), fasta scores; E(): 1.7e-20, 42.9%
FT                   identity in 161 aa overlap. Contains Pfam match to entry
FT                   PF00466 Ribosomal_L10, Ribosomal protein L10"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0144"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07462"
FT                   /db_xref="GOA:P66046"
FT                   /db_xref="InterPro:IPR001790"
FT                   /db_xref="InterPro:IPR002363"
FT                   /db_xref="InterPro:IPR022973"
FT                   /db_xref="UniProtKB/Swiss-Prot:P66046"
FT                   /protein_id="CAM07462.1"
FT                   /translation="MSLNIETKKVAVEEISAAIANAQTLVVAEYRGISVSSMTELRANA
FT                   RKEGVYLRVLKNTLARRAVQGTSFAELADQMVGPLVYAASEDAVAAAKVLHQFAKKDDK
FT                   IVVKAGSYNGEVMNAAQVAELASIPSREELLSKLLFVMQAPVSGFARGLAALAEKKAGE
FT                   EAA"
FT   CDS_pept        complement(132628..133323)
FT                   /transl_table=11
FT                   /locus_tag="NMA0145"
FT                   /product="50S ribosomal protein L1"
FT                   /note="NMA0145, rplA, 50S ribosomal protein L1, len: 231
FT                   aa; similar to many e.g. RL1_HAEIN P44342 50S ribosomal
FT                   protein L1 (228 aa), fasta scores; E(): 0, 68.4% identity
FT                   in 228 aa overlap. Contains Pfam match to entry PF00687
FT                   Ribosomal_L1, L1P family of ribosomal proteins, and PS01199
FT                   Ribosomal protein L1 signature"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0145"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07463"
FT                   /db_xref="GOA:P66087"
FT                   /db_xref="InterPro:IPR002143"
FT                   /db_xref="InterPro:IPR005878"
FT                   /db_xref="InterPro:IPR016095"
FT                   /db_xref="InterPro:IPR023673"
FT                   /db_xref="InterPro:IPR023674"
FT                   /db_xref="InterPro:IPR028364"
FT                   /db_xref="UniProtKB/Swiss-Prot:P66087"
FT                   /protein_id="CAM07463.1"
FT                   /translation="MAKVSKRLKALRSSVEANKLYAIDEAIALVKKAATAKFDESVDVS
FT                   FNLGVDPRKSDQVIRGSVVLPKGTGKITRVAVFTQGANAEAAKEAGADIVGFEDLAAEI
FT                   KAGNLNFDVVIASPDAMRIVGQLGTILGPRGLMPNPKVGTVTPNVAEAVKNAKAGQVQY
FT                   RTDKAGIVHATIGRASFAEADLKENFDALLDAIVKAKPAAAKGQYLKKVAVSSTMGLGI
FT                   RVDTSSVNN"
FT   CDS_pept        complement(133323..133757)
FT                   /transl_table=11
FT                   /locus_tag="NMA0146"
FT                   /product="50S ribosomal protein L11"
FT                   /note="NMA0146, rplK, 50S ribosomal protein L11, len: 144
FT                   aa; similar to many e.g. RL11_ECOLI P02409 50S ribosomal
FT                   protein L11 (141 aa), fasta scores; E(): 0, 68.6% identity
FT                   in 140 aa overlap. Contains Pfam match to entry PF00298
FT                   Ribosomal_L11, Ribosomal protein L11, and PS00359 Ribosomal
FT                   protein L11 signature"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0146"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07464"
FT                   /db_xref="GOA:Q9JX02"
FT                   /db_xref="InterPro:IPR000911"
FT                   /db_xref="InterPro:IPR006519"
FT                   /db_xref="InterPro:IPR020783"
FT                   /db_xref="InterPro:IPR020784"
FT                   /db_xref="InterPro:IPR020785"
FT                   /db_xref="InterPro:IPR036769"
FT                   /db_xref="InterPro:IPR036796"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9JX02"
FT                   /protein_id="CAM07464.1"
FT                   /translation="MAKKIIGYIKLQIPAGKANPSPPVGPALGQRGLNIMEFCKAFNAA
FT                   TQGMEPGLPIPVVITAFADKSFTFVMKTPPASILLKKAAGLQKGSSNPLTNKVGKLTRA
FT                   QLEEIAKTKEPDLTAADLDAAVRTIAGSARSMGLDVEGVV"
FT   CDS_pept        complement(133858..134394)
FT                   /transl_table=11
FT                   /locus_tag="NMA0147"
FT                   /product="transcription antitermination protein"
FT                   /note="NMA0147, nusG, transcription antitermination
FT                   protein, len: 178 aa; similar to many e.g. NUSG_ECOLI
FT                   P16921 transcription antitermination protein NUSG (181 aa),
FT                   fasta scores; E(): 0, 61.5% identity in 174 aa overlap.
FT                   Contains PS01014 Transcription termination factor nusG
FT                   signature"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0147"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07465"
FT                   /db_xref="GOA:P65591"
FT                   /db_xref="InterPro:IPR001062"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR006645"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR015869"
FT                   /db_xref="InterPro:IPR036735"
FT                   /db_xref="UniProtKB/Swiss-Prot:P65591"
FT                   /protein_id="CAM07465.1"
FT                   /translation="MSKKWYVVQAYSGFEKNVQRILEERIAREEMGDYFGQILVPVEKV
FT                   VDIRNGRKTISERKSYPGYVLVEMEMTDDSWHLVKSTPRVSGFIGGRANRPTPISQREA
FT                   EIILQQVQTGIEKPKPKVEFEVGQQVRVNEGPFADFNGVVEEVNYERNKLRVSVQIFGR
FT                   ETPVELEFSQVEKIN"
FT   CDS_pept        complement(134396..134674)
FT                   /transl_table=11
FT                   /locus_tag="NMA0148"
FT                   /product="putative preprotein translocase SECE subunit"
FT                   /note="NMA0148, secE, probable preprotein translocase SECE
FT                   subunit, len: 92 aa; similar to e.g. SECE_HAEIN P43805
FT                   preprotein translocase SECE subunit (106 aa), fasta scores;
FT                   E(): 0.0023, 38.2% identity in 55 aa overlap. Contains Pfam
FT                   match to entry PF00584 SecE,SecE/Sec61-gamma subunits of
FT                   protein translocation complex"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0148"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07466"
FT                   /db_xref="GOA:A0A0U1RGV0"
FT                   /db_xref="InterPro:IPR001901"
FT                   /db_xref="InterPro:IPR005807"
FT                   /db_xref="InterPro:IPR038379"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RGV0"
FT                   /protein_id="CAM07466.1"
FT                   /translation="MTEHTPEKKNVKVDQLVVQDKESASNSGKEGFFAYFSNSWFEFKK
FT                   VVWPKREDAVRMTVFVIVFVAVLSIFIYAADTAISWLFFDVLLRREG"
FT   CDS_pept        complement(134871..136055)
FT                   /transl_table=11
FT                   /locus_tag="NMA0149"
FT                   /product="elongation factor TU"
FT                   /note="NMA0149, tufA2, elongation factor TU, len; 394 aa;
FT                   almost identical to EFTU_NEIGO P48864 elongation factor TU
FT                   (EF-TU) (394 aa), fasta scores; E(): 0, 97.7% identity in
FT                   394 aa overlap. Contains Pfam match to entry PF00009
FT                   GTP_EFTU, Elongation factor Tu family, PS00017
FT                   ATP/GTP-binding site motif A (P-loop), and PS00301
FT                   GTP-binding elongation factors signature. Identical to
FT                   tufA1, NM134"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0149"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07467"
FT                   /db_xref="GOA:P64026"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004160"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004541"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR033720"
FT                   /db_xref="InterPro:IPR041709"
FT                   /db_xref="UniProtKB/Swiss-Prot:P64026"
FT                   /protein_id="CAM07467.1"
FT                   /translation="MAKEKFERSKPHVNVGTIGHVDHGKTTLTAALTTILAKKFGGAAK
FT                   AYDQIDNAPEEKARGITINTSHVEYETETRHYAHVDCPGHADYVKNMITGAAQMDGAIL
FT                   VCSAADGPMPQTREHILLARQVGVPYIIVFMNKCDMVDDAELLELVEMEIRDLLSSYDF
FT                   PGDDCPIVQGSALKALEGDAAYEEKIFELAAALDSYIPTPERAVDKPFLLPIEDVFSIS
FT                   GRGTVVTGRVERGIIHVGDEIEIVGLKETQKTTCTGVEMFRKLLDEGQAGDNVGVLLRG
FT                   TKREDVERGQVLAKPGTITPHTKFKAEVYVLSKEEGGRHTPFFANYRPQFYFRTTDVTG
FT                   AVTLEEGVEMVMPGENVTITVELIAPIAMEEGLRFAIREGGRTVGAGVVSSVIA"
FT   CDS_pept        complement(136472..136723)
FT                   /transl_table=11
FT                   /locus_tag="NMA0150"
FT                   /product="putative ferredoxin"
FT                   /note="NMA0150, probable ferredoxin, len: 83 aa; similar to
FT                   e.g. FER_CHRVI fP00208 erredoxin (82 aa), fasta scores;
FT                   E(): 1.7e-20, 70.5% identity in 78 aa overlap. Contains
FT                   Pfam match to entry PF00037 fer4, 4Fe-4S ferredoxins and
FT                   related iron-sulfur cluster binding domains, and PS00198
FT                   4Fe-4S ferredoxins, iron-sulfur binding region signature"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0150"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07468"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RGV1"
FT                   /protein_id="CAM07468.1"
FT                   /translation="MSLFITDECINCDVCEPECPNDAISQGEEIYEINPNLCTQCVGHY
FT                   DEPQCQQVCPVDCILIDEEYPETHDELMAKYEKIIQFK"
FT   CDS_pept        complement(136846..137415)
FT                   /transl_table=11
FT                   /locus_tag="NMA0151"
FT                   /product="possible DNA methylase"
FT                   /note="NMA0151, possible DNA methylase, len: 189 aa;
FT                   similar to hypothetical proteins containing methylase
FT                   signatures e.g. YHHF_ECOLI P10120 (198 aa), fasta scores;
FT                   E(): 3.1e-19, 38.2% identity in 186 aa overlap. Contains
FT                   PS00017 ATP/GTP-binding site motif A (P-loop), and PS00092
FT                   N-6 Adenine-specific DNA methylases signature"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0151"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07469"
FT                   /db_xref="GOA:A0A0U1RGV2"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR004398"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RGV2"
FT                   /protein_id="CAM07469.1"
FT                   /translation="MAAGKHTKHSNRVRIIGGQCRGRKLSFTSADGLRPTPDSVREKLF
FT                   NWLGQDLTGKTVLDLFGGSGALGIEAASRNAKRVLISDNNRQTAQTLQKNSRELGLGQV
FT                   QIVCSDGIAYLKTVSEQFDVVFLDPPFAWQDWQILFDALKPCLNPRSFVYLEAGTLPDI
FT                   PDWLTEYREGKSGQSTFELRVFQVAE"
FT   CDS_pept        complement(137504..137884)
FT                   /transl_table=11
FT                   /locus_tag="NMA0153"
FT                   /product="hypothetical protein NMA0153"
FT                   /note="NMA0153, unknown, len: 126 aa; similar to TR:Q51849
FT                   (EMBL:U39043) Pasteurella haemolytica hypothetical protein
FT                   (100 aa), fasta scores; E(): 1.2e-05, 35.7% identity in 84
FT                   aa overlap. Contains Pfam match to entry PF01381
FT                   HTH_3,Helix-turn-helix"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0153"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07470"
FT                   /db_xref="GOA:A0A0U1RGV3"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RGV3"
FT                   /protein_id="CAM07470.1"
FT                   /translation="METHEKIRLMRELNKWSQEDMAEKLAMSAGGYAKIERGETQLNIP
FT                   RLEQLAQIFKIDMWDLLKSGGGGMVLQINDVDTNSGEFAIYTAQDASVKLDLLKMELKH
FT                   CKEMLEHKDKEIELLRKLTETV"
FT   CDS_pept        138003..138554
FT                   /transl_table=11
FT                   /locus_tag="NMA0154"
FT                   /product="putative integral membrane protein"
FT                   /note="NMA0154, probable integral membrane protein, len:
FT                   183 aa"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0154"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07471"
FT                   /db_xref="GOA:A0A0U1RGV4"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RGV4"
FT                   /protein_id="CAM07471.1"
FT                   /translation="MEFLSLHPWWSFFIILTIILSYIGFCAHFHIQNGAVFFYSYRDVT
FT                   IVFLTPVILIALSYLIKNKEILSACILCITLIAFSWAWIIIYRPNTKRFFLSLLIVWGK
FT                   LLLSTIVWAILAISLGLAVITGNSKRKKYERRDRHAERNEKAFIGALLVGFELSRNLLN
FT                   LCCLHKDFSTPSKNIEVNRS"
FT   CDS_pept        138574..139269
FT                   /transl_table=11
FT                   /locus_tag="NMA0155"
FT                   /product="hypothetical protein NMA0155"
FT                   /note="NMA0155, unknown, len: 231 aa"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0155"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07472"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RGV5"
FT                   /protein_id="CAM07472.1"
FT                   /translation="MMKDLNLSNSLFKGYNDKHGLMICGYEWGWSKADEAAYVAGEYKL
FT                   PENKIDHTFANKSLYFGEQAKKWRYDNTIKNWFEMWGHPLDENGLGGAFEKSLVQTNWA
FT                   ATQGNTIDNPDKFTQPEHIDNFLYHIEKLRPKVILFMGSRLADFLNNQNVLPRFEQLVG
FT                   KQTKPLETVQKEFDGTRFNVKFQSFEDCEVVCFPHPSASRGLSYDYIALFVPEMNRILS
FT                   DFKTTRGFK"
FT   CDS_pept        complement(139342..141648)
FT                   /transl_table=11
FT                   /locus_tag="NMA0156"
FT                   /product="DNA topoisomerase I"
FT                   /EC_number="5.99.1.2"
FT                   /note="NMA0156, topA, DNA topoisomerase I, len: 768 aa;
FT                   similar to many e.g. TOP1_BACSU P39814 DNA topoisomerase I
FT                   (EC 5.99.1.2) (691 aa), fasta scores; E(): 0, 44.5%
FT                   identity in 762 aa overlap. Contains Pfam match to entry
FT                   PF01131 Topoisom_bac, Prokaryotic DNA topoisomerase, 3x
FT                   Pfam match to entry PF01396 zf-C4_Topoisom, Topoisomerase
FT                   DNA binding C4 zinc finger, and PS00396 Prokaryotic DNA
FT                   topoisomerase I active site"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0156"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07473"
FT                   /db_xref="GOA:A0A0U1RGV6"
FT                   /db_xref="InterPro:IPR000380"
FT                   /db_xref="InterPro:IPR003601"
FT                   /db_xref="InterPro:IPR003602"
FT                   /db_xref="InterPro:IPR005733"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR013497"
FT                   /db_xref="InterPro:IPR013498"
FT                   /db_xref="InterPro:IPR013824"
FT                   /db_xref="InterPro:IPR013825"
FT                   /db_xref="InterPro:IPR013826"
FT                   /db_xref="InterPro:IPR023405"
FT                   /db_xref="InterPro:IPR023406"
FT                   /db_xref="InterPro:IPR028612"
FT                   /db_xref="InterPro:IPR034149"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RGV6"
FT                   /protein_id="CAM07473.1"
FT                   /translation="MAKNLLIVESPSKAKTLKKYLGGDFEILASYGHVRDLVPKSGAVD
FT                   PDNGFAMKYQLISRNGKHVDAIVAGAKEAENIYLATDPDREGEAISWHLLEILKSKRGL
FT                   KNIKPQRVVFHEITKNAVLDAVANPREIEMDLVDAQQARRALDYLVGFNLSPLLWKKIR
FT                   RGLSAGRVQSPALRLICERENEIRAFEAREYWTVHLDSHKGRSKFTAKLAQYNGAKLEQ
FT                   FDLPNEAAQADVLKELEGKEAVVTAIEKKKRSRNPAAPFTTSTMQQDAVRKLGFTTDRT
FT                   MRTAQQLYEGIDVGQGAIGLITYMRTDSVNLADEALTEIRHYIENKIGKEYLPSAAKQY
FT                   KTKSKNAQEAHEAIRPTSVYRTPESVKPFLSADQFKLYQMIWQRTVACQMTPAKFDQTT
FT                   VDITVGKGVFRVTGQVQTFAGFLSVYEESSDDEEGEDSKKLPEMSEGDKLPVDKLYGEQ
FT                   HFTTPPPRYNEATLVKALEEYGIGRPSTYASIISTLKDREYVTLEQKRFMPTDTGDIVN
FT                   KFLTEHFAQYVDYHFTAKLEDQLDEIADGKRQWIPLMDKFWKPFIKQVEEKEGIERAKF
FT                   TTQELDETCPKCGEHKLQIKFGKMGRFVACAGYPECSYTRNVNETAEEAAERIAKAEAE
FT                   QAELDGRECPKCGGRLVYKYSRTGSKFIGCANYPKCKHVEPLEKPKDTGVQCPQCKKGN
FT                   LVERKSRYGKLFYSCSTYPDCNYATWNPPVAEECPNCHWPVLTIKTTKRWGVEKVCPQK
FT                   ECGWKEQIEPPAPKE"
FT   CDS_pept        complement(141720..142181)
FT                   /transl_table=11
FT                   /locus_tag="NMA0157"
FT                   /product="hypothetical protein NMA0157"
FT                   /note="NMA0157, unknown, len: 153 aa; some similarity to
FT                   SMG_ECOLI P30853 SMG protein (157 aa), fasta scores; E():
FT                   1.1e-05, 27.3% identity in 132 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0157"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07474"
FT                   /db_xref="InterPro:IPR007456"
FT                   /db_xref="UniProtKB/Swiss-Prot:P66820"
FT                   /protein_id="CAM07474.1"
FT                   /translation="MTEVIAYLIEHFQDFDTCPPPEDLGMLLEEAGFDTMEIGNTLMMM
FT                   EVLLNSSEFSAEPADSGALRVYSKEETDNLPQEVMGLMQYLIEEKAVSCEQREIIIHAL
FT                   MHIPGDEITVDTAKVLTLLLLWANKSELPVLVGDELMSALLLDNKPTMN"
FT   CDS_pept        complement(142207..143394)
FT                   /transl_table=11
FT                   /locus_tag="NMA0158"
FT                   /product="DprA homolog"
FT                   /note="NMA0158, dprA, DprA homolog, len: 395 aa; similar to
FT                   SMF_HAEIN P43862 SMF protein (DNA processing chain A)
FT                   thought to be involved in DNA uptake (373 aa), fasta
FT                   scores; E(): 1.9e-29, 40.1% identity in 324 aa overlap, and
FT                   to hypothetical proteins e.g. SMF_ECOLI P30852 SMF protein
FT                   (374 aa), fasta scores; E(): 2.3e-27, 37.2% identity in 360
FT                   aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0158"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07475"
FT                   /db_xref="GOA:A0A0U1RGV7"
FT                   /db_xref="InterPro:IPR003488"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR041614"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RGV7"
FT                   /protein_id="CAM07475.1"
FT                   /translation="MTEDERFAWLQLAFTPYIGAESFLLLMRRFGSAQNALSAPAEQVA
FT                   ALIRHKQALEAWRNAEKRALARQAAEAALEWEMRDGCRLMLLQDEDFPEMLTQGLTAPP
FT                   VLFLRGNVRLLHKPSAAIVGSRHATPQAMRIAKDFGKSLGGQNIPVVSGMASGIDTAAH
FT                   QGALEAEGGTIAVWGTGIDRIYPPSNKNLAYEIAEKGLIVSEFPIGTRPYAGNFPRRNR
FT                   LIAALSQVTLVVEAALESGSLITAGLAAEMGREVMAVPGSIDNPHSKGCHKLIKDGAKL
FT                   VECLDDILNECPGLLQNTGASSYSINKDTPDTGRRAVQTAYAPPPAAKMPSEAAAGGTA
FT                   VGGILDKMGFDPIHPDVLAGQLAMPAADLYAALLELELDGSVAAMPSGRYQRIRT"
FT   CDS_pept        complement(143485..144762)
FT                   /transl_table=11
FT                   /locus_tag="NMA0159"
FT                   /product="putative two-component trancriptional regulator"
FT                   /note="NMA0159, probable two-component trancriptional
FT                   regulator, len: 425 aa; similar to many e.g. NTRX_AZOCA
FT                   Q04849 nitrogen assimilation regulatory protein NTRX (454
FT                   aa), fasta scores; E(): 4.5e-15, 34.9% identity in 458 aa
FT                   overlap, and HYDG_ECOLI P14375 transcriptional regulatory
FT                   protein HYDG (441 aa), fasta scores; E(): 1.6e-14, 29.0%
FT                   identity in 448 aa overlap. Contains Pfam match to entry
FT                   PF00072 response_reg, Response regulator receiver domain,
FT                   and Pfam match to entry PF00158 sigma54, Sigma-54
FT                   transcription factors"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0159"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07476"
FT                   /db_xref="GOA:A0A0U1RGV8"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RGV8"
FT                   /protein_id="CAM07476.1"
FT                   /translation="MRSSDILIVDDEIGIRDLLSEILQDEGYSVALAENAEEARKLRHQ
FT                   ARPAMVLLDIWMPDCDGITLLKEWAKNGQLNMPVVMMSGHASIDTAVEATKIGALDFLE
FT                   KPISLQKLLSAVENALKYGAAQTETGPVFDKLGNSAAIQEMNREVGAAVKCASPVLLTG
FT                   EAGSPFETVARYFHKNGTPWVSPARVEYLINMPMELLQKAEGGVLYVGDIAQYSRNIQA
FT                   GIAFIVGKAEHRRVRVVASGSRAAGSDGIACEEKLAELLSESVVRIPPLRMQHEDIPFL
FT                   IQGITCNVAESQKIAPASFSEDALAALTRYEWPGNFDQLSSVVATLLLEADGQEIGAGA
FT                   VSSLLGQNVPAEGAEDMVGGFNFNLPLRELREEVERRYFEYHIAQEGQNMSKVAQKVGL
FT                   ERTHLYRKLKQLGIGVSRRAGEKTEE"
FT   CDS_pept        complement(144755..146875)
FT                   /transl_table=11
FT                   /locus_tag="NMA0160"
FT                   /product="putative two-component sensor"
FT                   /EC_number="2.7.3.-"
FT                   /note="NMA0160, probable two-component sensor, len: 706 aa;
FT                   similar to many e.g. NTRY_AZOCA Q04850 nitrogen regulation
FT                   protein NTRY (EC 2.7.3.-) (771 aa), fasta scores; E(): 0,
FT                   29.8% identity in 721 aa overlap, and ATOS_ECOLI Q06067
FT                   sensor protein ATOS (EC 2.7.3.-) (608 aa), fasta scores;
FT                   E(): 2.4e-16, 25.3% identity in 439 aa overlap. Contains
FT                   Pfam match to entry PF00672 DUF5, Domain found in bacterial
FT                   signal proteins and Pfam match to entry PF00512 signal,
FT                   Signal carboxyl-terminal domain, and four possible
FT                   transmembrane domains"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0160"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07477"
FT                   /db_xref="GOA:A0A0U1RGV9"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR017232"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RGV9"
FT                   /protein_id="CAM07477.1"
FT                   /translation="MRRFLPIAAICAVVLLYGLTAATGSTSSLADYFWWIVAFSAMLLL
FT                   VLSAVLARYVILLLKDRRDGVFGSQIAKRLSGMFTLVAVLPGVFLFGVSAQFINGTINS
FT                   WFGNDTHEALERSLNLSKSALNLAADNALGNAIPVQIDLIGAASLPGDMGRVLEHYAGS
FT                   GFAQLALYNAASGKIEKSINPHKLDQPFPGKARWEKIQQAGSVRDLESIGGVLYAQGWL
FT                   SAGTHNGRDYALFFRQPVPKGVAEDAVLIEKARAKYAELSYSKKGLQTFFLATLLIASL
FT                   LSIFLALVMALYFARRFVEPVLSLAEGAKAVAQGDFSQTRPVLRNDEFGRLTKLFNHMT
FT                   EQLSIAKEADERNRRREEAARHYLECVLEGLTTGVVVFDEQGCLKTFNKAAEQILGMPL
FT                   TPLWGSSRHGWHGVSAQQSLLAEVFAAIGAAAGTDKPVHVKYAAPDDAKILLGKATVLP
FT                   EDNGNGVVMVIDDITVLIHAQKEAAWGEVAKRLAHEIRNPLTPIQLSAERLAWKLGGKL
FT                   DEQDAQILTRSTDTIIKQVAALKEMVEAFRNYARSPSLKLENQDLNALIGDVLALYEAG
FT                   PCRFAAELAGEPLMMAADTTAMRQVLHNIFKNAAEAAEEADVPEVRVKSEAGQDGRIVL
FT                   TVCDNGKGFGREMLHNAFEPYVTDKPAGTGLGLPVVKKIIEEHGGRISLSNQDAGGACV
FT                   RIILPKTVETYA"
FT   CDS_pept        complement(146875..147474)
FT                   /transl_table=11
FT                   /locus_tag="NMA0161"
FT                   /product="hypothetical protein NMA0161"
FT                   /note="NMA0161, unknown, len: 199 aa"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0161"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07478"
FT                   /db_xref="InterPro:IPR025500"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RGW0"
FT                   /protein_id="CAM07478.1"
FT                   /translation="MAFITRLFKSIKQWLVLLPMLSVLPDAAAEGIDVSRAEARITDGG
FT                   QLSISSRFQTELPDQLQQALRRGVPLNFTLSWQLSAPIIASYRFKLGQLIGDDDNIDYK
FT                   LSFHPLTNRYRVTVGAFSTDYDTLDAALRATGAVANWKVLNKGALSGAEAGETKAEIRL
FT                   TLSTSKLPKPFQINALTSQNWHLDSGWKPLNIIGNK"
FT   CDS_pept        complement(147440..148699)
FT                   /transl_table=11
FT                   /locus_tag="NMA0162"
FT                   /product="SUN homolog"
FT                   /note="NMA0162, SUN homolog, len: 419 aa; similar to many
FT                   e.g. SUN_ECOLI P36929 SUN protein (FMU protein) (429
FT                   aa),fasta scores; E(): 0, 41.2% identity in 427 aa overlap.
FT                   Contains Pfam match to entry PF01189
FT                   Nol1_Nop2_Sun,NOL1/NOP2/sun family. Also similar to NMA1563
FT                   (29.9% identity in 371 aa overlap)"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0162"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07479"
FT                   /db_xref="GOA:A0A0U1RGW1"
FT                   /db_xref="InterPro:IPR001678"
FT                   /db_xref="InterPro:IPR004573"
FT                   /db_xref="InterPro:IPR006027"
FT                   /db_xref="InterPro:IPR023267"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR035926"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RGW1"
FT                   /protein_id="CAM07479.1"
FT                   /translation="MSMALAQKLAADSIAAVAEGRNLQDVLAQIRTAHPDLTAQENGAL
FT                   QDIAYGCQRYLGSLKHMLAQMLKKPIGNPQLESLLLAALYQLHYTRNAPHAVVNEAVES
FT                   IAKIGRGQYRSFANAILRRFLRERDKLAASCKKDDVAKHNLPLWWVAYLKNHYPKHWHN
FT                   IAAALQSHPPMTLRVNRRHGNAESYLEKLAAEGIAAKALDEYAVTLEEAVPVNRLPGFS
FT                   DGIVSVQDFGAQQAAYLLNPKDGERILDACAAPGGKTGHILELADCRVTALDIDAGRLK
FT                   RVEDNIARLGFQTASAACADARDLAAWYDGKPFDTILADVPCTASGVARRNPDVKWLRR
FT                   PTDALKTARQQEALLDALWQTLKQGGRMLLATCSVFVEENDGQLQKFLNRHADAEPIES
FT                   RVLLPNKHQDGFYYALIQKH"
FT   CDS_pept        complement(148778..149704)
FT                   /transl_table=11
FT                   /locus_tag="NMA0163"
FT                   /product="methionyl-tRNA formyltransferase"
FT                   /EC_number="2.1.2.9"
FT                   /note="NMA0163, fmt, methionyl-tRNA formyltransferase,len:
FT                   308 aa; similar to many e.g. FMT_ECOLI P23882
FT                   methionyl-tRNA formyltransferase (EC 2.1.2.9) (314
FT                   aa),fasta scores; E(): 0, 51.5% identity in 303 aa overlap.
FT                   Contains Pfam match to entry PF00551 formyl_transf, Formyl
FT                   transferase"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0163"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07480"
FT                   /db_xref="GOA:Q9JWY9"
FT                   /db_xref="InterPro:IPR001555"
FT                   /db_xref="InterPro:IPR002376"
FT                   /db_xref="InterPro:IPR005793"
FT                   /db_xref="InterPro:IPR005794"
FT                   /db_xref="InterPro:IPR011034"
FT                   /db_xref="InterPro:IPR036477"
FT                   /db_xref="InterPro:IPR037022"
FT                   /db_xref="InterPro:IPR041711"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9JWY9"
FT                   /protein_id="CAM07480.1"
FT                   /translation="MKVIFAGTPDFAAAALKAVAAAGFEIPLVLTQPDRPKGRGMQLTA
FT                   PPVKQAALELGLRVEQPEKLRNNAEALQMLKEVEADVMVVAAYGLILPQEVLDTPKHGC
FT                   LNIHASLLPRWRGAAPIQRAIEAGDAETGVCIMQMDIGLDTGDVVSEHRYAIQPTDTAN
FT                   EVHDALMEIGAAAVVADLQQLQSKGRLNAVKQPEEGVTYAQKLSKEEARIDWSKSAAVI
FT                   ERKIRAFNPVPAAWVEYQGKPMKIRRAEVVAQQGAAGEVLSCSADGLVVACGENALKIT
FT                   ELQPAGGRRMNIAAFAAGRHIEAGTKL"
FT   CDS_pept        complement(149791..150294)
FT                   /transl_table=11
FT                   /locus_tag="NMA0164"
FT                   /product="polypeptide deformylase"
FT                   /EC_number="3.5.1.31"
FT                   /note="NMA0164, def, polypeptide deformylase, len: 167 aa;
FT                   similar to many e.g. DEF_ECOLI P27251 polypeptide
FT                   deformylase (EC 3.5.1.31) (168 aa), fasta scores; E():
FT                   0,57.5% identity in 160 aa overlap. Contains Pfam match to
FT                   entry PF01327 Pep_deformylase, Polypeptide deformylase"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0164"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07481"
FT                   /db_xref="GOA:P63915"
FT                   /db_xref="InterPro:IPR023635"
FT                   /db_xref="InterPro:IPR036821"
FT                   /db_xref="UniProtKB/Swiss-Prot:P63915"
FT                   /protein_id="CAM07481.1"
FT                   /translation="MALLNILQYPDERLHTVAKPVEQVDERIRKLIADMFETMYESRGI
FT                   GLAATQVDVHERVVVMDLTEDRSEPRVFINPVIVEKDGETTYEEGCLSVPGIYDTVTRA
FT                   ERVKVEALNEKGEKFTLEADGLLAICVQHELDHLMGIVFVERLSQLKQGRIKTKLKKRQ
FT                   KHTI"
FT   CDS_pept        150478..151695
FT                   /transl_table=11
FT                   /locus_tag="NMA0165"
FT                   /product="putative periplasmic protein"
FT                   /note="NMA0165, probable periplasmic protein, len: 405 aa;
FT                   has short segment of similarity (encompassing PFAM domain)
FT                   to TR:O51302 (EMBL:AE001138) Borrelia burgdorferi
FT                   hypothetical 44.2 kd protein BB0323 (377 aa), fasta scores;
FT                   E(): 0.0006, 46.0% identity in 50 aa overlap, and
FT                   XKDP_BACSU P54335 phage-like element PBSX protein XKDP (235
FT                   aa), fasta scores; E(): 0.0083, 50.0% identity in 40 aa
FT                   overlap. Contains Pfam match to entry PF01476 PG_binding_2,
FT                   Putative peptidoglycan binding domain and N-terminal signal
FT                   sequence"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0165"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07482"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RGW2"
FT                   /protein_id="CAM07482.1"
FT                   /translation="MQRRIITLLCAAGMAFSTQTLAANLEVRPNAPERYTVKQGDTLWG
FT                   ISGKYLYSPWQWGRLWDANRDQIHNPDLIYLDQVLVLRHVDGEPRLGLEQTDGIPVVKM
FT                   SPDKEVSGYGIPAIDVNFYRIFMRHPQIVSRKETAAAPRLLSGPEGRLLYTKGTRVYTK
FT                   GLKEPGRYLTYRINKNITDPDTGKFLGQEVAFSGIVRSLDYTDSVLEQRSKQAGERPKD
FT                   NEYHTRTHPLITPLRTPSIQPLVVETAISEIQQGDYLMKMPEDTDRFNMMPHEPSRPVQ
FT                   AKIVSVFEGTRIAGQFQTITIDKGEADGLDKGTVLSLYKRKKTMQVDLSNNFKSRDTVE
FT                   LISTPAEEVGLAMVYRTSEHLSSAIILENISDISVGDTAANPGRDLDNIPDQGRSRVKF
FT                   GFNRSE"
FT   CDS_pept        complement(151758..152423)
FT                   /transl_table=11
FT                   /locus_tag="NMA0166"
FT                   /product="putative integral membrane protein"
FT                   /note="NMA0166, probable integral membrane protein, len:
FT                   211 aa; contains two membrane spanning domains near
FT                   N-terminus"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0166"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07483"
FT                   /db_xref="GOA:A0A0U1RGW3"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RGW3"
FT                   /protein_id="CAM07483.1"
FT                   /translation="MMMHASVQSRFAPILYVLIFFAGFLTAQIWFNQKAYTEELPPLLS
FT                   ALSAVALVWLAWAFVSARSKAKAEKFYREKMIQNESIHPVLHASLQHLEHKPQMLALLV
FT                   KNHGKGMAEQVRFKAEVLPDDEDARTIAAELAKMDMFALGTDAVASGETYGRVFADIFE
FT                   LSAALEGRAFKGMLKLTAEYKNIFGDACRSETALELGALNQALQEISKTSEKSKRIFY"
FT   CDS_pept        complement(152488..152946)
FT                   /transl_table=11
FT                   /locus_tag="NMA0167"
FT                   /product="aspartate carbamoyltransferase regulatory chain"
FT                   /note="NMA0167, pyrI, probable aspartate
FT                   carbamoyltransferase regulatory chain, len: 152 aa; similar
FT                   to many e.g. PYRI_ECOLI P00478 aspartate
FT                   carbamoyltransferase regulatory chain (152 aa), fasta
FT                   scores; E(): 1e-27, 51.0% identity in 145 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0167"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07484"
FT                   /db_xref="GOA:Q9JWY6"
FT                   /db_xref="InterPro:IPR002801"
FT                   /db_xref="InterPro:IPR020542"
FT                   /db_xref="InterPro:IPR020545"
FT                   /db_xref="InterPro:IPR036792"
FT                   /db_xref="InterPro:IPR036793"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9JWY6"
FT                   /protein_id="CAM07484.1"
FT                   /translation="METPKLSVEAIEKGTVIDHIPAGRGLTILRQFKLLHYGNAVTVGF
FT                   NLPSKTQGSKDIIKIKGVCLDDKAADRLALFAPEAVVNTIDHFKVVQKRHLNLPDEIAE
FT                   VFRCPNTNCASHGEPVKSRFYVKKHNGQTRLKCHYCEKTYSRDSVAEA"
FT   CDS_pept        complement(152956..153876)
FT                   /transl_table=11
FT                   /locus_tag="NMA0168"
FT                   /product="aspartate carbamoyltransferase catalytic chain"
FT                   /EC_number="2.1.3.2"
FT                   /note="NMA0168, pyrB, aspartate carbamoyltransferase
FT                   catalytic chain, len: 306 aa; similar to many e.g.
FT                   PYRB_VIBS2 P96174 aspartate carbamoyltransferase catalytic
FT                   chain (EC 2.1.3.2) (310 aa), fasta scores; E(): 0, 63.6%
FT                   identity in 308 aa overlap. Contains Pfam match to entry
FT                   PF00185 OTCace, Aspartate/ornithine carbamoyltransferase,
FT                   and PS00097 Aspartate and ornithine carbamoyltransferases
FT                   signature"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0168"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07485"
FT                   /db_xref="GOA:P65615"
FT                   /db_xref="InterPro:IPR002082"
FT                   /db_xref="InterPro:IPR006130"
FT                   /db_xref="InterPro:IPR006131"
FT                   /db_xref="InterPro:IPR006132"
FT                   /db_xref="InterPro:IPR036901"
FT                   /db_xref="UniProtKB/Swiss-Prot:P65615"
FT                   /protein_id="CAM07485.1"
FT                   /translation="MPNPLYRQHIISISDLSREQLECLLQTALKLKAHPRGDLLEGKLI
FT                   GSCFFEPSTRTRLSFETAVQRLGGKVIGFSDGANTSAKKGETLADTARIISGYTDAIIQ
FT                   RHPKDGAARVAAEFSRVPVINAGDGTNQHPSQTLLDLVTIYETQGRLDKLKIAMAGDLK
FT                   YGRTVHSLCQALKRWNCEFAFVSPPSLAMPDYITEELDEAGCRYRILGSLEEAAEWADI
FT                   LYMTRVQRERFDEQEFAKIQGKFNLEASMLARAKPNLRVLHPLPRVDEIHPDVDATPHA
FT                   YYFEQATNGVYARMAILSLVLNEEV"
FT   CDS_pept        154112..154954
FT                   /transl_table=11
FT                   /locus_tag="NMA0169"
FT                   /product="hypothetical protein NMA0169"
FT                   /note="NMA0169, unknown, len: 280 aa; some similarity in
FT                   C-terminus to hypothetical proteins e.g. TR:O07579
FT                   (EMBL:Y14082) Bacillus subtilis hypothetical 16.4 kd
FT                   protein YHDJ (142 aa), fasta scores; E(): 4.6e-06, 29.9%
FT                   identity in 134 aa overlap, and PHNO_ECOLI P16691 PHNO
FT                   protein (144 aa), fasta scores; E(): 0.00012, 31.9%
FT                   identity in 144 aa overlap. Contains Pfam match to entry
FT                   PF00583 Acetyltransf, Acetyltransferase (GNAT) family"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0169"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07486"
FT                   /db_xref="GOA:A0A0U1RGW4"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR021969"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RGW4"
FT                   /protein_id="CAM07486.1"
FT                   /translation="MLVCNPYEVVIHGTTSSGKIFRPSDWAERLCGILSSFTKDNRLSY
FT                   SKWVRPMLVDNIRCVAVDKKLETDNPQMFRFLMDFAADNDLRVIDCKALLEEREQGGQN
FT                   DPANERVLLAQAIEEKHAAEKAQEQTVSGASYVLREIGADDTATAFAALSVLRSALTDI
FT                   NRFTEQINKIQRPAGYRLLGIFEEGKYNAVAVCGFHEACNLASGRHIHIDDIVTLPQSR
FT                   RKGYASHLLEEVRKIGAETGVTKIHLNVHVNHDRTDAHRLYFKNGFEICAYHFRCDPK"
FT   CDS_pept        154951..155109
FT                   /transl_table=11
FT                   /locus_tag="NMA0170"
FT                   /product="putative lipoprotein"
FT                   /note="NMA0170, probable lipoprotein, len: 52 aa; contains
FT                   N-terminal signal sequence and appropriately positioned
FT                   PS00013 Prokaryotic membrane lipoprotein lipid attachment
FT                   site"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0170"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07487"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RGW5"
FT                   /protein_id="CAM07487.1"
FT                   /translation="MKTPLPICTLSALAACTLSGQGGTQVYGEIKARDLCVTAPILLSA
FT                   FCLACSR"
FT   CDS_pept        155236..155955
FT                   /transl_table=11
FT                   /locus_tag="NMA0171"
FT                   /product="hypothetical protein NMA0171"
FT                   /note="NMA0171, unknown, len: 239 aa; similar in part to
FT                   NMA1084 (54.7% identity in 53 aa overlap), and NMA1073
FT                   (40.4% identity in 104 aa overlap)"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0171"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07488"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RGW6"
FT                   /protein_id="CAM07488.1"
FT                   /translation="MLAIYSINILIYNEKMFFRVTFYFVKNFVSFSKTRKSNEMMQKHK
FT                   CLIDFILTVASQIAYADLPLSLEELLTDKGKFKLESSISYINTERNQSEFANPIYVQTS
FT                   ATKIATVMAMMITPVMAQNLDSQVFDSQNVKAIQLSQAEMKETQGEFVPIIAAAAFGGA
FT                   LGAWGYHGANLYNHGKLGTAQGAATAAGIGAATGVAATGLAAAAGGGLAGNLAWRPGIH
FT                   ALGFGANAANNAVNSRK"
FT   CDS_pept        156030..156266
FT                   /transl_table=11
FT                   /locus_tag="NMA0171A"
FT                   /product="putative integral membrane protein"
FT                   /note="NMA0171A, possible integral membrane protein, len:
FT                   78 aa; contains two possible transmembrane domains"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0171A"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07489"
FT                   /db_xref="GOA:A0A0U1RGW7"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RGW7"
FT                   /protein_id="CAM07489.1"
FT                   /translation="MMMGVLIFFLIVPILGFICATINYFIINKFKLPKYMAYLLPSLSI
FT                   LFIFIHAIKLHMILFFYVSCVYSAYTYYDKKSL"
FT   CDS_pept        join(156247..156339,156339..156905)
FT                   /transl_table=11
FT                   /locus_tag="NMA0173"
FT                   /product="hypothetical protein NMA0173"
FT                   /note="NMA0173, unknown, len: 373 aa; some similarity to
FT                   TR:O53037 (EMBL:U68399) Haemophilus influenzae putative
FT                   haemocin processing protein hmcC (198 aa), fasta scores;
FT                   E(): 2.6e-11, 35.5% identity in 141 aa overlap, and the
FT                   trhe N-terminus of TR:O87239 (EMBL:AE001272) Lactococcus
FT                   lactis plasmid pMRC01 predicted cytolysin B transport
FT                   protein (708 aa), fasta scores; E(): 9.1e-05, 29.0%
FT                   identity in 138 aa overlap. Also similar to NMA1066 (70.7%
FT                   identity in 164 aa overlap), and NMA0767 (69.4% identity in
FT                   124 aa overlap). Frameshifted at (C)6 tract w.r.t NmC
FT                   sequence. Coding sequence has been spliced to give intact
FT                   translation"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0173"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07490"
FT                   /db_xref="GOA:A0A0U1RGW8"
FT                   /db_xref="InterPro:IPR005074"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RGW8"
FT                   /protein_id="CAM07490.1"
FT                   /translation="MIKNLYKLINYAALIGFAPNIVFAWPMFVDPPASYQNIHVRSWKA
FT                   RRDSGIVKQDLDFSCGAASIATLLNNFYGRHYSEAEILDKMDKTQMRASFDDMQRIMPE
FT                   LGFEAQGYALPFEQLVQLKIPVIVYLKYRKNNHFSVLNGINGETVLLADPSLGHVSMSK
FT                   SQFLSAWKTRDGEMEGKILAIVPKNTDFVRNQMFFNKNPVRQTRFTVEQIQMRQKR"
FT   CDS_pept        complement(157181..157732)
FT                   /transl_table=11
FT                   /locus_tag="NMA0174"
FT                   /product="putative integral membrane protein"
FT                   /note="NMA0174, probable integral membrane protein, len:
FT                   183 aa; contains multiple hydrophobic transmembrane
FT                   domains"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0174"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07491"
FT                   /db_xref="GOA:A0A0U1RGW9"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RGW9"
FT                   /protein_id="CAM07491.1"
FT                   /translation="MKVLNGWSDRKMWRVLSALPIGVVFFDLIYGFVLNVLQGLDLQRA
FT                   VPDSEGVLAVTPDIAFNSLQIVANGGMAAVVCFGLAVVFLLNRSVRRRQVLEIGVFRML
FT                   GLVAVLAFSAPSVWEWANALPLLLKGADVVNTGNARYVLTALCMPFPAVSCVIGLVGRF
FT                   RLQTASGRAAKSGGAGKADG"
FT   CDS_pept        complement(join(157815..158006,158005..158457))
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="NMA0175"
FT                   /product="putative transposase for IS1016 (pseudogene)"
FT                   /note="NMA0175, probable transposase for IS1016, partial
FT                   CDS, len: 63 aa; similar to many e.g. TR:Q48208
FT                   (EMBL:X58176) Haemophilus influenzae insertion sequence
FT                   IS1016(V-4) ORF2 (164 aa), fasta scores; E(): 8e-10, 72.1%
FT                   identity in 43 aa overlap, and C-terminus of TR:Q9ZIX7
FT                   (EMBL:AF007429) Haemophilus paragallinarum IS-like putative
FT                   transposase (216 aa), fasta scores; E(): 1.1e-24,91.4%
FT                   identity in 58 aa overlap"
FT                   /note="NMA0176, probable transposase for IS1016, partial
FT                   CDS, len: 151 aa; similar to many e.g. TR:Q48208
FT                   (EMBL:X58176) Haemophilus influenzae insertion sequence
FT                   IS1016(V-4) ORF1 (164 aa), fasta scores; E(): 4.4e-25,54.0%
FT                   identity in 137 aa overlap, and N-terminus of TR:Q9ZIX7
FT                   (EMBL:AF007429) Haemophilus paragallinarum IS-like putative
FT                   transposase (216 aa), fasta scores; E(): 0, 83.5% identity
FT                   in 158 aa overlap"
FT                   /db_xref="PSEUDO:CAM07492.1"
FT   CDS_pept        158717..160189
FT                   /transl_table=11
FT                   /locus_tag="NMA0177"
FT                   /product="pyruvate kinase"
FT                   /EC_number="2.7.1.40"
FT                   /note="NMA0177, pykA, pyruvate kinase, len: 490 aa; similar
FT                   to many e.g. KPY2_ECOLI P14178 pyruvate kinase II (EC
FT                   2.7.1.40) (PK-2) (479 aa), fasta scores; E(): 0, 49.9%
FT                   identity in 491 aa overlap. Contains Pfam match to entry
FT                   PF00224 PK, Pyruvate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0177"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07493"
FT                   /db_xref="GOA:A0A0U1RGX1"
FT                   /db_xref="InterPro:IPR001697"
FT                   /db_xref="InterPro:IPR011037"
FT                   /db_xref="InterPro:IPR015793"
FT                   /db_xref="InterPro:IPR015795"
FT                   /db_xref="InterPro:IPR015806"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR036918"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RGX1"
FT                   /protein_id="CAM07493.1"
FT                   /translation="MNQTSRDLTRISHNTKIVATLGPGSNNVELLEDMIRVGGLNVVRF
FT                   NFSHGTPEFHQENARIVREAAKRTGQEIAIIADLQGPKIRVGKIAGGGIELNKGETLGL
FT                   DAALEGEGTREAVGLDYRDLPDDVAAGDVLWLDDGLLTLTVESVEGSRIITRVENSHVL
FT                   KSNKGINKRGGGLSAGALTEKDFRDLKTAIAIGCDYLAISFVKSAEDLHIARAKVEEEM
FT                   KGSTAVRPGLVSKIERVEAIENLDEIILAGDGIMVARGDLAVEVGHAAVPALQKRMIRR
FT                   ARELRRFSITATQMMESMITNPVPTRAEVSDVANAVLDGTDAVMCSAETAVGAYPFETV
FT                   SQMAIICAAAEKEQDSLNGVAEQVEYPEAVSTNLAVAGGAVSVARAVHAKAIVALTESG
FT                   STAFEISRHNITLPIFALTPSVSAQRRMAMYRGVRPLILATSTDHDTALNEVETMLVEH
FT                   NILHSGDQYIITSGSQMRESGSTNTLEVLRVK"
FT   CDS_pept        160499..161893
FT                   /transl_table=11
FT                   /locus_tag="NMA0178"
FT                   /product="putative outer membrane protein"
FT                   /note="NMA0178, probable outer membrane protein, len: 464
FT                   aa; weak similarity to several e.g. TR:Q00754 (EMBL:Q00754)
FT                   Haemophilus influenzae outer membrane protein P1 precursor
FT                   (449 aa), fasta scores; E(): 1.2e-07,27.6% identity in 474
FT                   aa overlap, TR:O51857 (EMBL:AF006691) Pseudomonas putida
FT                   plasmid pRE4 outer membrane protein IPBH (492 aa), fasta
FT                   scores; E(): 1.3e-05, 22.6% identity in 487 aa overlap, and
FT                   FADL_ECOLI P10384 long-chain fatty acid transport protein
FT                   precursor (448 aa), fasta scores; E(): 0.00035, 25.2%
FT                   identity in 428 aa overlap. Contains N-terminal signal
FT                   sequence"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0178"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07494"
FT                   /db_xref="InterPro:IPR005017"
FT                   /db_xref="InterPro:IPR042117"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RGX2"
FT                   /protein_id="CAM07494.1"
FT                   /translation="MTPSALKKTVLLLGTAFAAASAQASGYHFGTQSVNAQSTANAAAA
FT                   EAADASTIFYNPAGLTKLDSSQISVNANIVLPSIHYEADSATDFTGLPVQGSKSGKITK
FT                   TTVAPHIYGAYKVNDNLTVGLGVYVPFGSATEYEKDSVLRHNINKLGLTSIAVEPVAAW
FT                   KLNERHSFGAGIIAQHTSAELRKYADWGIMEKAKALKETPPNPTKAAQIKADGHADVKG
FT                   SDWGFGYQLAWMWDINDRARVGVNYRSKVSHTLKGDAEWAADDAMAKQLWDANKLALLG
FT                   YTPSEKARVKIVTPESLSVHGMYKVSDKADLFGDVTWTRHSRFDKAELVFEKEKTIVNG
FT                   KSDRTTITPNWRNTYKVGFGGSYQISEPLQLRAGIAFDKSPVRNADYRMNSLPDGNRIW
FT                   FSAGMKYHIGKNHVVDAAYTHIHINDTSYRTAKASGNDVDSKGASSARFKNHADIIGLQ
FT                   YTYKFK"
FT   CDS_pept        complement(join(162205..162498,162520..162627))
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="NMA0179"
FT                   /product="hypothetical protein NMA0179 (pseudogene)"
FT                   /note="NMA0179, unknown, len: 97 aa"
FT   CDS_pept        complement(163021..163218)
FT                   /transl_table=11
FT                   /locus_tag="NMA0181"
FT                   /product="hypothetical protein NMA0181"
FT                   /note="NMA0181, unknown, len: 65 aa"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0181"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07496"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RGX3"
FT                   /protein_id="CAM07496.1"
FT                   /translation="MNTVPKSRIPVKPLPEKTTDEAKVEKWRQLGAEHGLSGEWAVAVR
FT                   LGENGFTEEQMENIANLFGR"
FT   CDS_pept        complement(163229..164245)
FT                   /transl_table=11
FT                   /locus_tag="NMA0182"
FT                   /product="putative lipoprotein"
FT                   /note="NMA0182, probable lipoprotein, len: 338 aa. Contains
FT                   N-terminal signal sequence and appropriately positioned
FT                   PS00013 Prokaryotic membrane lipoprotein lipid attachment
FT                   site"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0182"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07497"
FT                   /db_xref="InterPro:IPR009739"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RGX4"
FT                   /protein_id="CAM07497.1"
FT                   /translation="MYRKLIALPFALLLAACGREEPPKALECANPAVLQGIRGNIQETL
FT                   TQEARSFAREDGRQFVDADKIIAAAYGLAFSLEHASETQEGGRTFCIADLNITVPSETL
FT                   ADAKANSPLLYGETALSDIVRQKTGGNVEFKDGVLTAAVRFLPVKDGQTAFVDNTVGMA
FT                   AQTLSAALLPYGVKSIVMIDGKAVKKEDAVRILSGKAREEEPSKPTPEDILEHNAAGGD
FT                   ADVPQAGEDAPEPEILHPDDGERADTVTVSRGEVEEARVQNQRAESEITKLWGGLDTDV
FT                   QKELVGEQRKWAQEKISNCRQAAAQADRQEYAEYLKLQCDTRMTRERIQYLRGYSID"
FT   CDS_pept        complement(164344..165558)
FT                   /transl_table=11
FT                   /locus_tag="NMA0183"
FT                   /product="sodium/glutamate symport carrier protein"
FT                   /note="NMA0183, gltS, sodium/glutamate symport carrier
FT                   protein, len: 404 aa; similar to many e.g. GLTS_ECOLI
FT                   P19933 sodium/glutamate symport carrier protein (glutamate
FT                   permease) (401 aa), fasta scores; E(): 0, 50.9% identity in
FT                   393 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0183"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07498"
FT                   /db_xref="GOA:A0A0U1RGX5"
FT                   /db_xref="InterPro:IPR004445"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RGX5"
FT                   /protein_id="CAM07498.1"
FT                   /translation="MEWEFNSYYTLIAATLVLLVGKFLVQKIKFLRDFNIPEPVAGGLV
FT                   AAIILFALHEAYGVSFKFEKPLQNAFMLIFFTSIGLSADFSRLKAGGLPLVVFTAIVGG
FT                   FILVQNFVGVGLATALGLDPLIGLITGSVSLTGGHGTSGAWGPNFETQYGLVGATGLGI
FT                   ASATFGLVFGGLIGGPVARRLINKMGRKPVENKKQDQDDNADDVFEQAKRTRLITAESA
FT                   VETLAMFAACLAFAEIMDGFDKEYLFDLPKFVWCLFGGVVIRNILTAAFKVNMFDRAID
FT                   VFGNASLSLFLAMALLNLKLWELTGLAGPVTVILAVQTVVMVLYATFVTYVFMGRDYDA
FT                   AVLAAGHCGFGLGATPTAVANMQSVTHTFGASHKAFLIVPMVGAFFVDLINAAILTGFV
FT                   NFFKG"
FT   CDS_pept        complement(165776..167182)
FT                   /transl_table=11
FT                   /locus_tag="NMA0184"
FT                   /product="hypothetical protein NMA0184"
FT                   /note="NMA0184, unknown, len: 468 aa; some similarity to
FT                   hypothetical proteins e.g. YBEQ_ECOLI P77234 hypothetical
FT                   37.3 kd protein in leuS-gltL intergenic region (327
FT                   aa),fasta scores E(): 8.4e-07, 29.6% identity in 301 aa
FT                   overlap"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0184"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07499"
FT                   /db_xref="InterPro:IPR006597"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RGX6"
FT                   /protein_id="CAM07499.1"
FT                   /translation="MTAAPDILYRQAAALLEQSNTAQALPLLQQAAEQGYAEAAFVLGN
FT                   HLLQNGQPEQALSWLEAAAAQRHPKALFSLLQQREHNGTPTGQLLNDYAWLGEQGHSEA
FT                   QLILMRYHAQRNDPQSLYWAELAAARYAAPAYYHLARHHQRQGDVETAIEQYEKAAALG
FT                   VTAACWQLGQIYFYGTGVSPNHAQAEHYLEPAAQAGHIAAQTLLADLLAAQRKPEALEW
FT                   YRRAADKEQAEAQSKLAQYALTGELSERDPFQAARYAKAAAEKDHPEALKIMGDLYRYG
FT                   LGIKADNHIAHDYYHRAAALGSAAAAQKLISDAALYHPQQYEQIKTAALQQQQTETIYR
FT                   LAEAQACAIGRPADYNAARKNYMEAAGFHHKNAAAALGRIYHYGLGTAQDPRAAAHWYA
FT                   IAAEQNHPSAQYHLACFYYHGQGVGCHVPTACYWLQAAIGNGHTSAESLISLLEQWRRE
FT                   AHHAIGQKAV"
FT   CDS_pept        complement(167551..168810)
FT                   /transl_table=11
FT                   /locus_tag="NMA0185"
FT                   /product="capsule polysaccharide modification protein"
FT                   /note="NMA0185, lipB, capsule polysaccharide modification
FT                   protein, len: 419 aa; almost identical to LIPB_NEIME Q05014
FT                   capsule polysaccharide modification protein (419 aa), fasta
FT                   scores; E(): 0, 99.8% identity in 419 aa overlap, and
FT                   similar to e.g. KSS5_ECOLI P42218 capsule polysaccharide
FT                   export protein KPSS (389 aa), fasta scores; E(): 0, 38.3%
FT                   identity in 400 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0185"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07500"
FT                   /db_xref="GOA:P57038"
FT                   /db_xref="InterPro:IPR007833"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57038"
FT                   /protein_id="CAM07500.1"
FT                   /translation="MKQTVLKNNLQNLLESAENILLLQGPVGDFFLRLADWLTANGKTV
FT                   HKFNFNAGDDYFYPPTQAHTVVFNDNYDAFPEFLQEYITQHHIQAVVCFGDTRPYHVIA
FT                   KRIANENQASFWAFEEGYFRPYYITLEKDGVNAFSPLPRRADFFLEQFPKLAQQEYKAP
FT                   TPVHGGFTPMAKNAIRYYIELFRNLRKYPDYIHHRAPNAGHYLKPWSLSILKRLNYYIE
FT                   DIQIAKRVEAGKYGKFFIVPLQVFNDSQVRIHCDFPSVRSFLLHVLSSFAEHAPADTNI
FT                   IIKHHPMDRGFIDYWRDIKRFIKEHPELKGRVIYVHDVPLPVFLRHGLGMVTINSTSGL
FT                   SGLIHNMPVKVLGRAYYDIPGITDQNTLAEFWNHPTPPDKELFHAYRMYHLNVTQINGN
FT                   FYSQVFFPNKNTSDSSTPTT"
FT   CDS_pept        complement(168947..171061)
FT                   /transl_table=11
FT                   /locus_tag="NMA0186"
FT                   /product="capsule polysaccharide modification protein"
FT                   /note="NMA0186, lipA, capsule polysaccharide modification
FT                   protein, len: 704 aa; almost identical to, but longer than,
FT                   LIPA_NEIME Q05013 capsule polysaccharide modification
FT                   protein (400 aa), fasta scores; E(): 0, 97.1% identity in
FT                   383 aa overlap, and similar to e.g. KSC5_ECOLI P42217
FT                   capsule polysaccharide export protein KPSC (675 aa), fasta
FT                   scores; E(): 0, 48.9% identity in 687 aa overlap. Contains
FT                   PS00214 Cytosolic fatty-acid binding proteins signature"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0186"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07501"
FT                   /db_xref="GOA:P57037"
FT                   /db_xref="InterPro:IPR007833"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57037"
FT                   /protein_id="CAM07501.1"
FT                   /translation="MFLFSDGLQSINNNNRRKRIVKNAYIPSRGIRKIPHLSTLLPEFH
FT                   IYKDGKGAEAVVGWGLRPTTHKARAFATEHQLPFIALEDGFLRSLGLGVSGYPPYSIVY
FT                   DDIGIYYDTTRPSRLEQLILAADTMPSETLAQARQAMDFILQHHLSKYNHAPELSDDHP
FT                   LRSPSKSETVLIIDQTFGDMAIQYGGADASTFELMFQTALNENPQADIWVKTHPDVLCG
FT                   KKQGYLTQLVQQHRVHLLAEDINPISLLQNVDKVYCVTSQMGFEALLCGKPLTTFGLPW
FT                   YAGWGVSDDRHPKIGSLIQTQRRAPRNLLQLFAAAYLQYSRYLNPNTGEAGSLFDVIDY
FT                   LATVKRKNDKLRGELYCVGMSLWKRAVAKPFFNVPSCRLKFISSTQKLARVKLSDDARI
FT                   LAWGNGKEAIVRFAEQHHIPLLRMEDGFIRSVGLGSNLVPPLSLVTDDMSIYFNAETPS
FT                   RLEYILQNQNFDDQDFQTALKLQKMLTENHISKYNVGSSDFTAPSTDKTVILVPGQVED
FT                   DASIRYGSPQIYRNLDLLRTVRERNPNAYIIYKPHPDVVSGNRIGHISPDDAARYADQT
FT                   AEQADILTCLQYADEIHTMTSLTGFEALLRGKKVSCYGLPFYAGWGLTQDLLPIPRRSR
FT                   RLELWQLVAGTLIYYPDYIHPKTHQAINAETAAQILIRQKNMQKNNNGLHRGCFAKKLG
FT                   KIKQLYRSFK"
FT   CDS_pept        complement(171085..171639)
FT                   /transl_table=11
FT                   /locus_tag="NMA0187"
FT                   /product="dTDP-D-glucose 4,6-dehydratase"
FT                   /EC_number="5.1.3.13"
FT                   /note="NMA0187, rfbC2, dTDP-4-dehydrorhamnose
FT                   3,5-epimerase, len: 184 aa; almost identical to TR:Q51155
FT                   (EMBL:L09189) N. meningitidis B1940 rfbC (333 aa), fasta
FT                   scores; E(): 0, 94.5% identity in 181 aa overlap, and
FT                   similar to many e.g. RFBC_NEIGO P37763
FT                   dTDP-4-dehydrorhamnose 3,5-epimerase (EC 5.1.3.13) (328
FT                   aa), fasta scores; E(): 0, 83.5% identity in 176 aa
FT                   overlap. Contains Pfam match to entry PF00908
FT                   dTDP_sugar_isom, dTDP-4-dehydrorhamnose 3,5-epimerase. Also
FT                   highly similar to rfbC, NMA0206 (98.3% identity in 181 aa
FT                   overlap)"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0187"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07502"
FT                   /db_xref="GOA:A0A0U1RGX7"
FT                   /db_xref="InterPro:IPR000888"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RGX7"
FT                   /protein_id="CAM07502.1"
FT                   /translation="MKDKKMNIIDTAIPDVKLLEPQVFGDARGFFMETFRDEWFKTQVC
FT                   NRTFVQENHSKSGKGVLRGLHYQTENTQGKLVRVVVGEVFDVAVDMRKDSPTFGKWVGE
FT                   ILSAENKRQLWVPEGFAHGFCVLGDAAEVVYKCTDYYKPEAEQVLIWNDPTVGIGWPLQ
FT                   TAPLLSPKDLAGKVLAEAVTF"
FT   CDS_pept        complement(171678..172544)
FT                   /transl_table=11
FT                   /locus_tag="NMA0188"
FT                   /product="glucose-1-phosphate thymidylyltransferase"
FT                   /EC_number="2.7.7.24"
FT                   /note="NMA0188, rfbA2, glucose-1-phosphate
FT                   thymidylyltransferase, len: 288 aa; almost identical to
FT                   RFBA_NEIME P55255 glucose-1-phosphate thymidylyltransferase
FT                   (EC 2.7.7.24) (288 aa), fasta scores; E(): 0, 99.3%
FT                   identity in 288 aa overlap, and similar to many e.g.
FT                   RFBA_NEIGO P37762 glucose-1-phosphate thymidylyltransferase
FT                   (EC 2.7.7.24) (288 aa), fasta scores; E(): 0, 88.5%
FT                   identity in 288 aa overlap. Contains Pfam match to entry
FT                   PF00483 NTP_transferase, Nucleotidyl transferase. Identical
FT                   to rfbA, NMA0205"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0188"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07503"
FT                   /db_xref="GOA:P57040"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR005907"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57040"
FT                   /protein_id="CAM07503.1"
FT                   /translation="MKGIILAGGSGTRLYPITRGVSKQLLPVYDKPMIYYPLSVLMLAG
FT                   IRDILVITAPEDNASFKRLLGDGSDFGISISYAVQPSPDGLAQAFIIGEEFIGNDNVCL
FT                   VLGDNIFYGQSFTQTLKQAAAQTHGATVFAYQVKNPERFGVVEFNENFRAVSIEEKPQR
FT                   PKSDWAVTGLYFYDNRAVEFAKQLKPSARGELEISDLNRMYLEDGSLSVQILGRGFAWL
FT                   DTGTHESLHEAASFVQTVQNIQNLHIACLEEIAWRNGWLSDEKLEELARTMAKNQYGQY
FT                   LLRLLKK"
FT   CDS_pept        complement(172650..173675)
FT                   /transl_table=11
FT                   /locus_tag="NMA0189"
FT                   /product="dTDP-glucose 4,6-dehydratase"
FT                   /EC_number="4.2.1.46"
FT                   /note="NMA0189, rfbB2, dTDP-glucose 4,6-dehydratase, len:
FT                   341 aa; identical to TR:AAD23919 (EMBL:AF083467) N.
FT                   meningitidis MA-1 dTDP-D-glucose 4,6-dehydratase (341 aa),
FT                   and similar to e.g. RFBB_NEIGO P37761 dTDP-glucose
FT                   4,6-dehydratase (EC 4.2.1.46) (346 aa), fasta scores; E():
FT                   0, 92.4% identity in 340 aa overlap. Contains Pfam match to
FT                   entry PF01370 Epimerase, NAD dependent
FT                   epimerase/dehydratase family. Identical to rfbB, NMA0204"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0189"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07504"
FT                   /db_xref="GOA:Q9S642"
FT                   /db_xref="InterPro:IPR005888"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9S642"
FT                   /protein_id="CAM07504.1"
FT                   /translation="MRKILVTGGAGFIGSAVVRHIIRNTQDSVVNLDKLTYAGNLESLT
FT                   DIADNPRYAFEQVDICDRAELDRVFAQHRPDAVMHLAAESHVDRSIGSAGEFIQTNIVG
FT                   TFNLLEAARAYRQQMPSEKHEAFRFHHISTDEVYGDLSGTDDLFTETAPYAPSSPYSAS
FT                   KASSDHLVRAWLRTYGLPTIVTNCSNNYGPYHFPEKLIPLMILNALDGKPLPVYGDGMQ
FT                   IRDWLFVEDHARALYQVVTEGVVGETYNIGGHNEKANIEVVKTICALLEELAPEKPAGV
FT                   ARYEDLITFVQDRPGHDARYAVDTAKIRRDLGWQPLETFESGLRKTVQWYLDNKTRRQN
FT                   A"
FT   CDS_pept        complement(173791..174408)
FT                   /transl_table=11
FT                   /locus_tag="NMA0190"
FT                   /product="truncated UDP-glucose 4-epimerase"
FT                   /EC_number="5.1.3.2"
FT                   /note="NMA0190, galE2', truncated UDP-glucose
FT                   4-epimerase,len: 205 aa; almost identical to TR:Q51291
FT                   (EMBL:L20496) N. meningitidis MC58 truncated UDP-glucose
FT                   4-epimerase (galE2) (205 aa), fasta scores; E(): 0, 97.1%
FT                   identity in 205 aa overlap, and similar to the N-terminus
FT                   of many e.g. GALE_NEIGO Q05026 UDP-glucose 4-epimerase (EC
FT                   5.1.3.2) (338 aa), fasta scores; E(): 0, 87.9% identity in
FT                   206 aa overlap. Contains Pfam match to entry PF01370
FT                   Epimerase,NAD dependent epimerase/dehydratase family.
FT                   Almost identical to the C-terminus of galE, NMA0203 (95.6%
FT                   identity in 206 aa overlap)"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0190"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07505"
FT                   /db_xref="GOA:A0A0U1RGX8"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR005886"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RGX8"
FT                   /protein_id="CAM07505.1"
FT                   /translation="MPYTEDMRPGDTANPYGASKAMVERMLTDIQKADPRWSVILLRYF
FT                   NPIGAHESGLIGEQPNGIPNNLLPYICQVASGRLPQLSVFGGDYPTPDGTGMRDYIHVM
FT                   DLAEGHVAAMQAKSNVAGTHLLNLGSGRASSVLEIIRAFEAASGLTIPYEVKPRRAGDL
FT                   ACFYADPSYTKAQIGWQTQRDLAQMMEDSWRWVSNNPNGYDD"
FT   CDS_pept        complement(174490..174834)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="NMA0191"
FT                   /product="pseudogene (truncated modification methylase)"
FT                   /EC_number="2.1.1.72"
FT                   /note="NMA0191, pseudogene, probable truncated modification
FT                   methylase, len: 114 aa; similar to the N-terminus of e.g.
FT                   MTHA_HAEPH P50193 modification methylase HPHI(A) (EC
FT                   2.1.1.72) (336 aa), fasta scores; E(): 8.2e-30, 66.1%
FT                   identity in 112 aa overlap"
FT                   /db_xref="PSEUDO:CAM07506.1"
FT   CDS_pept        complement(join(174830..175045,175047..175829))
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="NMA0193"
FT                   /product="pseudogene (modification methylase)"
FT                   /EC_number="2.1.1.73"
FT                   /note="NMA0193, pseudogene, probable modification
FT                   methylase, len: 1000 bp; similar to e.g. MTHC_HAEPH P50192
FT                   modification methylase HPHI(C) (EC 2.1.1.73) (372 aa),fasta
FT                   scores (partial); E(): 0, 72.2% identity in 259 aa overlap.
FT                   Contains 2x Pfam match to entry PF00145 DNA_methylase, C-5
FT                   cytosine-specific DNA methylase,PS00094 C-5
FT                   cytosine-specific DNA methylases active site, and PS00095
FT                   C-5 cytosine-specific DNA methylases C-terminal signature.
FT                   There is a single frameshift in this CDS. Coding sequence
FT                   has been spliced to give intact translation"
FT   CDS_pept        complement(175860..178133)
FT                   /transl_table=11
FT                   /locus_tag="NMA0194"
FT                   /product="putative transcriptional accessory protein"
FT                   /note="NMA0194, possible transcriptional accessory protein,
FT                   len: 757 aa; similar to hypothetical proteins e.g.
FT                   YHGF_ECOLI P46837 hypothetical 85.1 kd protein in greB-feoA
FT                   intergenic region (773 aa), fasta scores; E(): 0, 61.7%
FT                   identity in 772 aa overlap, and to TEX_BORPE Q45388
FT                   putative transcriptional accessory protein TEX (791 aa),
FT                   fasta scores; E(): 0, 60.4% identity in 770 aa overlap.
FT                   Contains Pfam match to entry PF00575 S1, S1 RNA binding
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0194"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07508"
FT                   /db_xref="GOA:P57072"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR006641"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR018974"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR023319"
FT                   /db_xref="InterPro:IPR023323"
FT                   /db_xref="InterPro:IPR032639"
FT                   /db_xref="InterPro:IPR037027"
FT                   /db_xref="InterPro:IPR041692"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57072"
FT                   /protein_id="CAM07508.1"
FT                   /translation="MNITQILSQELSATAAQITAAVELLDDGATVPFIARYRKEATGGL
FT                   DDTQLRRLAERLQYLRELEERKAVVLKSIEEQGKLSDDLRAQIEAADNKTALEDLYLPY
FT                   KPKRRTKAQIAREHGLQPLADVLLAEQSQDVEAAAQGYLNENVPDAKAALDGARAILME
FT                   QFAEDAELIGTLRDKLWNEAEIHAQVVGGKETEGEKFSDYFDHREPIRAMPSHRALAVL
FT                   RGRNEGVLNIALKYQPDDTPITQQSEYEQIIARRFKVSDGHKWLRDTVRLTWRAKIFLS
FT                   LELEALNRLKEAADTDAITVFARNLKDLLLAAPAGRLTTLGLDPGYRNGVKCAVVDDTG
FT                   KLLDTVIVYLHQENNMLATLSRLIKQHGVKLIAIGNGTASRETDKIAGELVREMSKMGL
FT                   HKIVVSEAGASIYSASELAAREFPDLDVSLRGAVSIARRLQDPLAELVKIDPKSIGVGQ
FT                   YQHDVNQSQLAKSLDAVVEDCVNAVGVDVNTASAPLLARISGLNQTLAQNIVAYRDENG
FT                   AFDSRKKLLKVPRLGEKTFEQAAGFLRINGGKEPLDASAVHPEAYPVVAKMLAQQGISA
FT                   AELIGNRERVKQIKASDFTDERFGLPTILDILSELEKPGRDPRGEFQTASFAEGIHEIS
FT                   DLQVGMILEGVVSNVANFGAFVDIGVHQDGLVHISALSNKFVQDPREVVKAGDVVKVKV
FT                   LEVDAARKRIALTMRLDDEPGGAKHKMPSENRSRERTAGRKPQRNDRAPANSAMADAFA
FT                   KLKR"
FT   CDS_pept        complement(178197..178847)
FT                   /transl_table=11
FT                   /locus_tag="NMA0195"
FT                   /product="capsule polysaccharide export ATP-binding
FT                   protein"
FT                   /note="NMA0195, ctrD, probable capsule polysaccharide
FT                   export ATP-binding protein, len: 216 aa; almost identical
FT                   to CTRD_NEIME P32016 capsule polysaccharide export
FT                   ATP-binding protein (216 aa), fasta scores; E(): 0, 93.5%
FT                   identity in 216 aa overlap, and similar to e.g. KST5_ECOLI
FT                   P24586 polysialic acid transport ATP-binding protein KPST
FT                   (224 aa), fasta scores; E(): 0, 42.3% identity in 215 aa
FT                   overlap. Contains Pfam match to entry PF00005 ABC_tran,ABC
FT                   transporter, PS00017 ATP/GTP-binding site motif A (P-loop),
FT                   and PS00211 ABC transporters family signature"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0195"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07509"
FT                   /db_xref="GOA:P57013"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57013"
FT                   /protein_id="CAM07509.1"
FT                   /translation="MISVEHVSKRYLTRQGWRTVLHDISFKMEKGEKIGILGRNGAGKS
FT                   TLIRLISGVEPPTTGEIKRTMSISWPLAFSGAFQGSLTGMDNLRFICRIYNVDIDYVKN
FT                   FTEEFSELGQYLYEPVKRYSSGMKARLAFALSLAVEFDCYLIDEVIAVGDSRFADKCKY
FT                   ELFEKRKDRSIILVSHSHSAMKQYCDNAMVLEKGHMYQFEDMDKAYEYYNSLP"
FT   CDS_pept        complement(178844..179641)
FT                   /transl_table=11
FT                   /locus_tag="NMA0196"
FT                   /product="capsule polysaccharide export inner-membrane
FT                   protein"
FT                   /note="NMA0196, ctrC, capsule polysaccharide export
FT                   inner-membrane protein, len: 265 aa; highly similar to
FT                   CTRC_NEIME P32015 capsule polysaccharide export
FT                   inner-membrane protein CTRC (265 aa), fasta scores; E(): 0,
FT                   79.2% identity in 265 aa overlap, and similar to e.g.
FT                   BEX2_HAEIN P19391 capsule polysaccharide export
FT                   inner-membrane protein CTRC (265 aa), fasta scores; E(): 0,
FT                   67.2% identity in 265 aa overlap. Contains Pfam match to
FT                   entry PF01061 ABC2_membrane, ABC-2 type transporter, and
FT                   PS00890 ABC-2 type transport system integral membrane
FT                   proteins signature"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0196"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07510"
FT                   /db_xref="GOA:P57012"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57012"
FT                   /protein_id="CAM07510.1"
FT                   /translation="MKELHKTSFLESLLIQKRVIGALLMREIITRYGRNNIGFLWLFVE
FT                   PLLLTLVMVLMWKFFRMHNVSALNIVAFTLTGYPMMMMWRNASNHAIGSISANTSLLYH
FT                   RNVRVLDTIFARMLLEIAGATIAQVVIMFALVIIGWIDVPADIFYMLLAWLLMAMFAVG
FT                   LGLVICSVAFHFEPFGKVWSTISFVMMPLSGVFFFVHNLPQQLQHYVLMIPMVHGTEMF
FT                   RAGYFGDSVTTYENPWYILLCNLVLLLLGLAVVARFSKGVEPQ"
FT   CDS_pept        complement(179641..180804)
FT                   /transl_table=11
FT                   /locus_tag="NMA0197"
FT                   /product="capsule polysaccharide export inner-membrane
FT                   protein"
FT                   /note="NMA0197, ctrB, capsule polysaccharide export
FT                   inner-membrane protein, len: 387 aa; highly similar to
FT                   CTRB_NEIME P32014 capsule polysaccharide export
FT                   inner-membrane protein CTRB (387 aa), fasta scores; E(): 0,
FT                   84.0% identity in 387 aa overlap, and similar to e.g.
FT                   BEXC_HAEIN P22930 capsule polysaccharide export
FT                   inner-membrane protein BEXC (377 aa), fasta scores; E(): 0,
FT                   58.6% identity in 379 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0197"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07511"
FT                   /db_xref="GOA:P57034"
FT                   /db_xref="InterPro:IPR005705"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57034"
FT                   /protein_id="CAM07511.1"
FT                   /translation="MSEQLPVAVATETKAERKKPKKKSWIKKLSPLFWVTVIIPTVISL
FT                   VYFGFFASDRFTSQSSFVVRSPKSQSSLNGLGAILQGTGFARAQDDIYTVQEYMQSRSA
FT                   LDALRKKMPIRDFYEKEGDIFSRFNGFGLRGEDEAFYQYYRDKVSIHFDSVSGISNLSV
FT                   TSFNAGESQKINDALLKQGEVLINQLNERARQDTIRYAQEVVNSAEEQVKEASVQLTKF
FT                   RVSNGIFDLKAQSDVQMGLVSKLQDELIVIQTQLDQVKAVTPENPQIPGLIAREKSLRK
FT                   EISQQMKAISGGGEGSLSNQAAEYQRVYLENELAEKQLAAAMTSLESAKAEADRQQLYL
FT                   EVISQPNKPDLAYEPNRLYNIVATFVIGLIVYGIVVLLSASIREHKN"
FT   CDS_pept        complement(180819..181982)
FT                   /transl_table=11
FT                   /locus_tag="NMA0198"
FT                   /product="capsule polysaccharide export outer membrane
FT                   protein"
FT                   /note="NMA0198, ctrA, capsule polysaccharide export outer
FT                   membrane protein, len: 387 aa; almost identical to
FT                   CTR2_NEIME P32758 capsule polysaccharide export outer
FT                   membrane protein CTRA precursor (387 aa), fasta scores;
FT                   E(): 0, 99.7% identity in 387 aa overlap, and similar to
FT                   e.g. BEXD_HAEIN P22236 capsule polysaccharide export
FT                   protein BEXD (394 aa), fasta scores; E(): 0, 53.8% identity
FT                   in 385 aa overlap. Contains N-terminal signal sequence and
FT                   appropriately positioned PS00013 Prokaryotic membrane
FT                   lipoprotein lipid attachment site"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0198"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07512"
FT                   /db_xref="GOA:P32758"
FT                   /db_xref="InterPro:IPR003715"
FT                   /db_xref="UniProtKB/Swiss-Prot:P32758"
FT                   /protein_id="CAM07512.1"
FT                   /translation="MLKLKFCIVISFLILGSACSAIPSSGPSAKKVVSLGQQSEAQIPE
FT                   VELIDVNHAVAQSLYKAQVNQSFTQFGDGYASTGTLNIGDVLDIMIWEAPPAVLFGGGL
FT                   SSMGSGSAQQTKLPEQLVTARGTVSVPFVGDISVVGKTPGQVQEIIKGRLKKMANQPQV
FT                   MVRLVQNNAANVSVIRAGNSVRMPLTAAGERVLDAVAAVGGSTANVQDTNVQLTRGNVV
FT                   RTVALEDLVANPRQNILLRRGDVVTMITNPYTFTSMGAVGRTQEIGFSARGLSLSEAIG
FT                   RMGGLQDRRSDARGVFVFRYTPLVELPAERQDKWIAQGYGSEAEIPTVYRVNMADAHSL
FT                   FSMQRFPVKNKDVLYVSNAPLAEVQKFLSFVFSPVTSGANSINNLTN"
FT   CDS_pept        182201..183319
FT                   /transl_table=11
FT                   /locus_tag="NMA0199"
FT                   /product="putative UDP-N-acetyl-D-glucosamine 2-epimerase"
FT                   /EC_number="5.1.3.14"
FT                   /note="NMA0199, sacA, putative UDP-N-acetyl-D-glucosamine
FT                   2-epimerase, len: 372 aa; almost identical to TR:O68214
FT                   (EMBL:AF019760) N. meningitidis F8229 putative
FT                   UDP-N-acetyl-D-glucosamine 2-epimerase (372 aa), fasta
FT                   scores; E(): 0, 99.7% identity in 372 aa overlap, and
FT                   similar to e.g. WECB_ECOLI P27828 UDP-N-acetylglucosamine
FT                   2-epimerase (EC 5.1.3.14) (376 aa), fasta scores; E():
FT                   0,58.2% identity in 373 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0199"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07513"
FT                   /db_xref="GOA:A0A0U1RGY0"
FT                   /db_xref="InterPro:IPR003331"
FT                   /db_xref="InterPro:IPR029767"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0A0U1RGY0"
FT                   /protein_id="CAM07513.1"
FT                   /translation="MKVLTVFGTRPEAIKMAPVILELQKHNTITSKVCITAQHREMLDQ
FT                   VLSLFEIKADYDLNIMKPNQSLQEITTNIISSLTDVLEDFKPDCVLVHGDTTTTFAASL
FT                   AAFYQKIPVGHIEAGLRTYNLYSPWPEEANRRLTSVLSQWHFAPTEDSKNNLLSESIPS
FT                   DKVIVTGNTVIDALMVSLEKLKITTIKKQMEQAFPFIQDNSKVILITAHRRENHGEGIK
FT                   NIGLSILELAKKYPTFSFVIPLHLNPNVRKPIQDLLSSVHNVHLIEPQEYLPFVYLMSK
FT                   SHIILSDSGGIQEEAPSLGKPVLVLRDTTERPEAVAAGTVKLVGSETQNIIESFTQLIE
FT                   YPEYYEKMANIENPYGIGNASKIIVETLLKNR"
FT   CDS_pept        183321..184958
FT                   /transl_table=11
FT                   /locus_tag="NMA0200"
FT                   /product="putative capsule biosynthesis protein"
FT                   /note="NMA0200, sacB, putative capsule biosynthesis
FT                   protein, len: 545 aa; almost identical to TR:O68215
FT                   (EMBL:AF019760) N. meningitidis F8229 SACB (545 aa), fasta
FT                   scores; E(): 0, 99.4% identity in 545 aa overlap, and
FT                   similar to hypothetical proteins e.g. TR:O06628
FT                   (EMBL:Z95618) hypothetical 60.3 kd protein Rv0806c (532
FT                   aa), fasta scores; E(): 0, 35.0% identity in 380 aa
FT                   overlap"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0200"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07514"
FT                   /db_xref="GOA:Q9JWW8"
FT                   /db_xref="InterPro:IPR021520"
FT                   /db_xref="InterPro:IPR031356"
FT                   /db_xref="InterPro:IPR031357"
FT                   /db_xref="InterPro:IPR031358"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9JWW8"
FT                   /protein_id="CAM07514.1"
FT                   /translation="MFILNNRKWRKLKRDPSAFFRDSKFNFLRYFSAKKFAKNFKNSSH
FT                   IHKTNISKAQSNISSTLKQNRKQDMLIPINFFNFEYIVKKLNNQNAIGVYILPSNLTLK
FT                   PALCILESHKEDFLNKFLLTISSENLKLQYKFNGQIKNPKSVNEIWTDLFSIAHVDMKL
FT                   STDRTLSSSISQFWFRLEFCKEDKDFILFPTANRYSRKLWKHSIKNNQLFKEGIRNYSE
FT                   ISSLPYEEDHNFDIDLVFTWVNSEDKNWQELYKKYKPDFNSDATSTSRFLSRDELKFAL
FT                   RSWEMNGSFIRKIFIVSNCAPPAWLDLNNPKIQWVYHEEIMPQSALPTFSSHAIETSLH
FT                   HIPGISNYFIYSNDDFLLTKPLNKDNFFYSNGIAKLRLEAWGNVNGECTEGEPDYLNGA
FT                   RNANTLLEKEFKKFTTKLHTHSPQSMRTDILFEMEKKYPEEFNRTLHNKFRSLDDIAVT
FT                   GYLYHHYALLSGRALQSSDKTELVQQNHDFKKKLNNVVTLTKERNFDKLPLSVCINDGA
FT                   DSHLNEEWNVQVIKFLETLFPLPSSFEK"
FT   CDS_pept        185031..185774
FT                   /transl_table=11
FT                   /locus_tag="NMA0201"
FT                   /product="putative capsule biosynthesis protein"
FT                   /note="NMA0201, sacC, putative capsule biosynthesis
FT                   protein, len: 247 aa; identical to TR:O68216
FT                   (EMBL:AF019760) N. meningitidis F8229 SACC, (247 aa)"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0201"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07515"
FT                   /db_xref="InterPro:IPR008886"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RGY1"
FT                   /protein_id="CAM07515.1"
FT                   /translation="MLSNLKTGNNILGLPEFELNGCRFLYKKGIEKTIITFSAFPPKDI
FT                   AQKYNYIKDFLSSNYTFLAFLDTKYPEDDARGTYYITNELDNGYLQTIHCIIQLLSNTN
FT                   QEDTYLLGSSKGGVGALLLGLTYNYPNIIINAPQAKLADYIKTRSKTILSYMLGTSKRF
FT                   QDINYDYINDFLLSKIKTCDSSLKWNIHITCGKDDSYHLNELEILKNEFNIKAITIKTK
FT                   LISGGHDNEAIAHYREYFKTIIQNI"
FT   CDS_pept        185776..186639
FT                   /transl_table=11
FT                   /locus_tag="NMA0202"
FT                   /product="putative capsule biosynthesis protein"
FT                   /note="NMA0202, sacD, putative capsule biosynthesis
FT                   protein, len: 287 aa; identical to TR:O68217
FT                   (EMBL:AF019760) N. meningitidis F8229 SACD (287 aa)"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0202"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07516"
FT                   /db_xref="InterPro:IPR019290"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RGY2"
FT                   /protein_id="CAM07516.1"
FT                   /translation="MRKITFIIPIKQSLIKPDCFIRLFFNLFLLKKFSSKYGFSILVAD
FT                   NSNFLWKNIIKLITKFYKCNYISIKSHNTFYTPAKIKNAAAIYSFNTLNSNYILFLDVD
FT                   VLLSENFIQHLIKKTKTNIAFDWYPVSFLNKQFGIINFILFSYKGNLNIEESFIIQTGF
FT                   VTGLQLFNSDFFYKTAGYNESFLGYGCEDIEMIHRATLLLNIRPAFNENHQYFTDDRGY
FT                   MPSKLTGFRNYFYYLKRDEFSNLQITPKHFWHKRKNKSKYLKNRYQNDVKMIQIMKDFD
FT                   RKFLKN"
FT   CDS_pept        186684..187703
FT                   /transl_table=11
FT                   /locus_tag="NMA0203"
FT                   /product="UDP-glucose 4-epimerase"
FT                   /EC_number="5.1.3.2"
FT                   /note="NMA0203, galE, UDP-glucose 4-epimerase, len: 339 aa;
FT                   almost identical to GALE_NEIME Q59624 UDP-glucose
FT                   4-epimerase (EC 5.1.3.2) (339 aa), fasta scores; E():
FT                   0,97.6% identity in 339 aa overlap, and similar toi many
FT                   e.g. GALE_ECOLI P09147 UDP-glucose 4-epimerase (EC 5.1.3.2)
FT                   (338 aa), fasta scores; E(): 0, 56.3% identity in 336 aa
FT                   overlap. Contains Pfam match to entry PF01370 Epimerase,
FT                   NAD dependent epimerase/dehydratase family. Also similar in
FT                   C-terminus to galE2' NMA0190 (95.6% identity in 206 aa
FT                   overlap)"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0203"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07517"
FT                   /db_xref="GOA:P56997"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR005886"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:P56997"
FT                   /protein_id="CAM07517.1"
FT                   /translation="MKNILVTGGTGFIGSHTVVSLLKSGHQVVILDNLCNSSINILPRL
FT                   KTITGQEIPFYQGDIRDREILRRIFAENRIDSVIHFAGLKAVGESVAEPMKYYDNNVSG
FT                   SLVLAEEMARAGVFSIVFSSSATVYGDPGKVPYTEDMPLGDTTSPYGTSKSMVERILTD
FT                   IQKADPRWSMILLRYFNPIGAHESGLIGEQPNGIPNNLLPYICQVASGRLPQLSVFGGD
FT                   YPTPDGTGMRDYIHVMDLAEGHVAAMQAKSNVAGTHLLNLGSGRASSVLEIIRAFEAAS
FT                   GLTIPYEVKPRRAGDLACFYADPSYTKAQIGWQTQRDLAQMMEDSWRWVSNNPNGYDD"
FT   CDS_pept        187819..188844
FT                   /transl_table=11
FT                   /locus_tag="NMA0204"
FT                   /product="dTDP-glucose 4,6-dehydratase"
FT                   /EC_number="4.2.1.46"
FT                   /note="NMA0204, rfbB, dTDP-glucose 4,6-dehydratase, len:
FT                   341 aa; identical to TR:AAD23919 (EMBL:AF083467) N.
FT                   meningitidis MA-1 dTDP-D-glucose 4,6-dehydratase (341 aa),
FT                   and similar to e.g. RFBB_NEIGO P37761 dTDP-glucose
FT                   4,6-dehydratase (EC 4.2.1.46) (346 aa), fasta scores; E():
FT                   0, 92.4% identity in 340 aa overlap. Contains Pfam match to
FT                   entry PF01370 Epimerase, NAD dependent
FT                   epimerase/dehydratase family. Identical to rfbB2, NMA0189"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0204"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07518"
FT                   /db_xref="GOA:Q9S642"
FT                   /db_xref="InterPro:IPR005888"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9S642"
FT                   /protein_id="CAM07518.1"
FT                   /translation="MRKILVTGGAGFIGSAVVRHIIRNTQDSVVNLDKLTYAGNLESLT
FT                   DIADNPRYAFEQVDICDRAELDRVFAQHRPDAVMHLAAESHVDRSIGSAGEFIQTNIVG
FT                   TFNLLEAARAYRQQMPSEKHEAFRFHHISTDEVYGDLSGTDDLFTETAPYAPSSPYSAS
FT                   KASSDHLVRAWLRTYGLPTIVTNCSNNYGPYHFPEKLIPLMILNALDGKPLPVYGDGMQ
FT                   IRDWLFVEDHARALYQVVTEGVVGETYNIGGHNEKANIEVVKTICALLEELAPEKPAGV
FT                   ARYEDLITFVQDRPGHDARYAVDTAKIRRDLGWQPLETFESGLRKTVQWYLDNKTRRQN
FT                   A"
FT   CDS_pept        188950..189816
FT                   /transl_table=11
FT                   /locus_tag="NMA0205"
FT                   /product="glucose-1-phosphate thymidylyltransferase"
FT                   /EC_number="2.7.7.24"
FT                   /note="NMA0205, rfbA, glucose-1-phosphate
FT                   thymidylyltransferase, len: 288 aa; almost identical to
FT                   RFBA_NEIME P55255 glucose-1-phosphate thymidylyltransferase
FT                   (EC 2.7.7.24) (288 aa), fasta scores; E(): 0, 99.3%
FT                   identity in 288 aa overlap, and similar to many e.g.
FT                   RFBA_NEIGO P37762 glucose-1-phosphate thymidylyltransferase
FT                   (EC 2.7.7.24) (288 aa), fasta scores; E(): 0, 88.5%
FT                   identity in 288 aa overlap. Contains Pfam match to entry
FT                   PF00483 NTP_transferase, Nucleotidyl transferase. Identical
FT                   to rfbA2, NMA0188"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0205"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07519"
FT                   /db_xref="GOA:P57040"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR005907"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57040"
FT                   /protein_id="CAM07519.1"
FT                   /translation="MKGIILAGGSGTRLYPITRGVSKQLLPVYDKPMIYYPLSVLMLAG
FT                   IRDILVITAPEDNASFKRLLGDGSDFGISISYAVQPSPDGLAQAFIIGEEFIGNDNVCL
FT                   VLGDNIFYGQSFTQTLKQAAAQTHGATVFAYQVKNPERFGVVEFNENFRAVSIEEKPQR
FT                   PKSDWAVTGLYFYDNRAVEFAKQLKPSARGELEISDLNRMYLEDGSLSVQILGRGFAWL
FT                   DTGTHESLHEAASFVQTVQNIQNLHIACLEEIAWRNGWLSDEKLEELARTMAKNQYGQY
FT                   LLRLLKK"
FT   CDS_pept        189855..190427
FT                   /transl_table=11
FT                   /locus_tag="NMA0206"
FT                   /product="dTDP-4-dehydrorhamnose 3,5-epimerase"
FT                   /EC_number="5.1.3.13"
FT                   /note="NMA0206, rfbC, dTDP-4-dehydrorhamnose 3,5-epimerase,
FT                   len: 184 aa; almost identical to TR:Q51155 (EMBL:L09189) N.
FT                   meningitidis B1940 rfbC (333 aa), fasta scores; E(): 0,
FT                   93.1% identity in 189 aa overlap, and similar to many e.g.
FT                   RFBC_NEIGO P37763 dTDP-4-dehydrorhamnose 3,5-epimerase (EC
FT                   5.1.3.13) (328 aa), fasta scores; E(): 0, 84.2% identity in
FT                   184 aa overlap. Contains Pfam match to entry PF00908
FT                   dTDP_sugar_isom, dTDP-4-dehydrorhamnose 3,5-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0206"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07520"
FT                   /db_xref="GOA:A0A0U1RGY3"
FT                   /db_xref="InterPro:IPR000888"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RGY3"
FT                   /protein_id="CAM07520.1"
FT                   /translation="MKDKKMNIIDTAIPDVKLLEPQVFGDARGFFMETFRDEWFKTQVC
FT                   NRTFVQENHSKSGKGVLRGLHYQTENTQGKLVRVVVGEVFDVAVDMRKDSPTFGKWVGE
FT                   ILSAENKRQLWVPEGFAHGFCVLGDAAEVVYKCTDYYKPEAEQVLIWNDPTVGIGWPLQ
FT                   TAPLLSPKDLAGKTWAQAEKLRLPLSR"
FT   CDS_pept        complement(190470..192488)
FT                   /transl_table=11
FT                   /locus_tag="NMA0207"
FT                   /product="putative integral membrane protein"
FT                   /note="NMA0207, probable integral membrane protein, len:
FT                   672 aa; similar to several hypothetical integral membrane
FT                   proteins e.g. Y561_HAEIN P44016 hypothetical protein
FT                   HI0561/560 (633 aa), fasta scores; E(): 0, 65.0% identity
FT                   in 640 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0207"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07521"
FT                   /db_xref="GOA:A0A0U1RGY4"
FT                   /db_xref="InterPro:IPR004813"
FT                   /db_xref="InterPro:IPR004814"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RGY4"
FT                   /protein_id="CAM07521.1"
FT                   /translation="MNKSLSGSVEEYRELTLRGMILGALITVIFTASNVYLGLKVGLTF
FT                   ASSIPAAVISMAVLKFFKGSNILENNMVQTQASAAGTLSTIIFVLPGLLMAGYWSGFPF
FT                   WQTTLLCIAGGILGVIFTIPLRYAMVVKSDLPYPEGVAAAEILKVGGHEEGDNRQGGSG
FT                   IKELAAGGALAGLMSFCAGGLRVIADSASYWFKSGTAIFQLPMGFSLALLGAGYLVGLT
FT                   GGIAILLGISIAWGIAVPYFSSHIPQPSDMEMAAFAMKLWKEKVRFIGAGTIGIAAVWT
FT                   LLMLLKPMVEGMKMSFKSFGGGAPAAERAEQDLSPKAMIFWVLAMMFVLGVSFYHFIGD
FT                   SHITGGMAWLLVVVCTLLASVIGFLVAAACGYMAGLVGSSSSPISGVGIVSVVVISLVL
FT                   LLVGESGGLLADEANRKFLLALTLFCGSAVICVASISNDNLQDLKTGYLLKATPWRQQV
FT                   ALIIGCIVGALVISPVLELLYEAYGFTGAMPREGMDAAQALAAPQATLMTTIASGIFAH
FT                   NLEWVYIFTGIAIGAVLIVVDLVLKKSSGGKLALPVLAVGMGIYLPPSVNMPIVAGAVL
FT                   AAVLKHIIGKKAENREGRLKNAERIGTLFSAGLIVGESLIGVIMAFIIAFSVTNGGSDA
FT                   PLALNLQNWDAAASWLGLAFFVTGMFFFAQRVLKAGK"
FT   CDS_pept        complement(192683..193804)
FT                   /transl_table=11
FT                   /locus_tag="NMA0209"
FT                   /product="DnaJ protein"
FT                   /note="NMA0209, dnaJ, DnaJ protein, len: 373 aa; similar to
FT                   many e.g. DNAJ_ECOLI P08622 DNAJ protein (375 aa),fasta
FT                   scores; E(): 0, 60.8% identity in 375 aa overlap. Contains
FT                   Pfam match to entry PF00226 DnaJ, DnaJ domain,Pfam match to
FT                   entry PF00684 DnaJ_CXXCXGXG, DnaJ central domain (4
FT                   repeats), PS00637 CXXCXGXG dnaJ domain signature, and
FT                   PS00636 Nt-dnaJ domain signature"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0209"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07522"
FT                   /db_xref="GOA:P63968"
FT                   /db_xref="InterPro:IPR001305"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR002939"
FT                   /db_xref="InterPro:IPR008971"
FT                   /db_xref="InterPro:IPR012724"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="InterPro:IPR036410"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/Swiss-Prot:P63968"
FT                   /protein_id="CAM07522.1"
FT                   /translation="MSNQDFYATLGVARTATDDEIKKAYRKLAMKYHPDRNPDNKEAEE
FT                   KFKEVQKAYETLSDKEKRAMYDQYGHAAFEGGGQGGFGGFGGFGGAQGFDFGDIFSQMF
FT                   GGGSGRAQPDYQGEDVQVGIEITLEEAAKGVKKRINIPTYEACDVCNGSGAKPGTSPET
FT                   CPTCKGSGTVHIQQAIFRMQQTCPTCHGAGKHIKEPCVKCRGAGRNKAVKTVEVNIPAG
FT                   IDDGQRIRLSGEGGPGMHGAPAGDLYVTVRIRAHKIFQRDGLDLHCELPISFATAALGG
FT                   ELEVPTLDGKVKLTVPKETQTGRRMRVKGKGVKSLRSSATGDLYCHIVVETPVNLTDRQ
FT                   KELLEEFERISTGLENQTPRKKSFLDKLRDLFD"
FT   CDS_pept        193851..194012
FT                   /transl_table=11
FT                   /locus_tag="NMA0210"
FT                   /product="hypothetical protein NMA0210"
FT                   /note="NMA0210, unknown, len: 53 aa"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0210"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07523"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RGY5"
FT                   /protein_id="CAM07523.1"
FT                   /translation="MRKTQDKQTAIAYKLKRNTLFRQHKPMPSEIFRYARHKNLDRHKT
FT                   NRHEVFLL"
FT   CDS_pept        complement(194074..194538)
FT                   /transl_table=11
FT                   /locus_tag="NMA0211"
FT                   /product="putative DNA transport competence protein"
FT                   /note="NMA0211, possible DNA transport competence
FT                   protein,len: 154 aa; region of similarity to SW:P39694
FT                   (CME1_BACSU) ComE a late competence operon protein from
FT                   Bacillus subtilis (205 aa) fasta scores; E(): 6.2e-07,47.6%
FT                   identity in 63 aa overlap. Almost identical to TR:CAB44958
FT                   (EMBL:AJ242837) ComEA protein (fragment) from Neisseria
FT                   meningitidis serogroup A strain Z2491 (170 aa) fasta
FT                   scores; E(): 0, 98.7% identity in 154 aa overlap. Contains
FT                   Pfam match to entry PF00633 HHH,Helix-hairpin-helix motif
FT                   and possible membrane-spanning hydrophobic region.
FT                   Identical to NMA0423, and almost identical to NMA1915
FT                   (98.7% identity in 154 aa overlap), and NMA2187 (98.7%
FT                   identity in 154 aa overlap)"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0211"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07524"
FT                   /db_xref="GOA:A0A0U1RGY6"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR004509"
FT                   /db_xref="InterPro:IPR004787"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RGY6"
FT                   /protein_id="CAM07524.1"
FT                   /translation="MLCPEKMSGMAGQYPYGVRSGLRRNGLKLWDIHFRMTRFIVARCG
FT                   LLFATLKGKTMKKMFVLFCMLFSCAFSLAAVNINAASQQELEALPGIGPAKAKAIAEYR
FT                   AQNGAFKSVDDLTKVKGIGPAVLAKLKDQASVGAPAPKGPAKPVLPADKK"
FT   CDS_pept        complement(200338..200754)
FT                   /transl_table=11
FT                   /locus_tag="NMA0213"
FT                   /product="putative DnaK suppressor protein"
FT                   /note="NMA0213, dksA, putative DnaK suppressor protein,len:
FT                   138 aa; similar to e.g. DKSA_ECOLI P18274 DNAK suppressor
FT                   protein (151 aa), fasta scores; opt: 376 z-score: 466.7
FT                   E(): 1.2e-18, 44.4% identity in 124 aa overlap. Contains
FT                   Pfam match to entry PF01258 zf_dskA_traR, Prokaryotic
FT                   dksA/traR C4-type zinc finger"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0213"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07525"
FT                   /db_xref="GOA:A0A0U1RGY7"
FT                   /db_xref="InterPro:IPR000962"
FT                   /db_xref="InterPro:IPR012784"
FT                   /db_xref="InterPro:IPR037187"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RGY7"
FT                   /protein_id="CAM07525.1"
FT                   /translation="MAKLTEQDILNWNGPEDDYMNDEHLAFFRELLVKMQDELIENASA
FT                   TTGHLQEHESAPDPADRATQEEEYALELRTRDRERKLLSKIQATIRNIDEGDYGFCADT
FT                   GEPIGLKRLLARPTATLSVESQERRERMKKQFAD"
FT   CDS_pept        complement(200901..201692)
FT                   /transl_table=11
FT                   /locus_tag="NMA0215"
FT                   /product="putative pyrroline-5-carboxylate reductase"
FT                   /EC_number="1.5.1.2"
FT                   /note="NMA0215, proC, probable pyrroline-5-carboxylate
FT                   reductase, len: 263 aa; similar to many e.g. PROC_HAEIN
FT                   P00373 pyrroline-5-carboxylate reductase (EC 1.5.1.2) (271
FT                   aa), fasta scores; E(): 4.8e-32, 39.3% identity in 267 aa
FT                   overlap. Contains Pfam match to entry PF01089 P5CR, Delta
FT                   1-pyrroline-5-carboxylate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0215"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07526"
FT                   /db_xref="GOA:A0A0U1RGY8"
FT                   /db_xref="InterPro:IPR000304"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR028939"
FT                   /db_xref="InterPro:IPR029036"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RGY8"
FT                   /protein_id="CAM07526.1"
FT                   /translation="MNVYFLGGGNMAAAVAGGLVKQGGYRIHIANRGAEKRERLGKELG
FT                   VETSATLPELHSDDVLILAVKPQDMEAACKNIRTNGALVLSVAAGLSVDTLSRYLGGTR
FT                   RIVRVMPNTPGKIGLGVSGMFAEAEVSETDRRIADRIMKSVGLTVWLEDEAQMHSITGI
FT                   SGSGPAYVFYLLDALQNAAIRQGFDMAEARALSLATFKGAVALAEQTGEDFEKLQKNVT
FT                   SKGGTTHEAVEAFRRHRVAEAISEGVCACVRRSQEMERQYQ"
FT   CDS_pept        complement(201741..202148)
FT                   /transl_table=11
FT                   /locus_tag="NMA0216"
FT                   /product="putative lipoprotein"
FT                   /note="NMA0216, probable lipoprotein, len: 135 aa. Contains
FT                   N-terminal signal sequence and appropriately positioned
FT                   PS00013 Prokaryotic membrane lipoprotein lipid attachment
FT                   site"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0216"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07527"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RGY9"
FT                   /protein_id="CAM07527.1"
FT                   /translation="MEIRAIKYTAMAALLAFTVAGCRLAGWYECSSLSGWCKPRKPAAI
FT                   DFWDIGGESPPSLEDYEIPLSDGNRSVRANEYESAQQSYFYRKIGKFEACGLDWRTRDG
FT                   KPLIETFKQEGFDCLKKQGLRRNGLSERVRW"
FT   CDS_pept        complement(202148..202834)
FT                   /transl_table=11
FT                   /locus_tag="NMA0217"
FT                   /product="hypothetical protein NMA0217"
FT                   /note="NMA0217, unknown, len: 228 aa; similar to
FT                   hypothetical proteins e.g. YPT5_PSEAE P24562 (230 aa),fasta
FT                   scores; E(): 0, 51.5% identity in 227 aa overlap. Pfam
FT                   match to entry PF01168 UPF0001, Uncharacterized protein
FT                   family UPF0001"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0217"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07528"
FT                   /db_xref="GOA:A0A0U1RGZ0"
FT                   /db_xref="InterPro:IPR001608"
FT                   /db_xref="InterPro:IPR011078"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RGZ0"
FT                   /protein_id="CAM07528.1"
FT                   /translation="MTVLQERYCEVSDRIGKLVLQAGRKPHSVSLIAVGKTFPSDGIRE
FT                   VYAAGQRDFGENYIQEWYDKTEELADLTDIVWHVIGDVQSNKTKFVAERAHWVHTICRL
FT                   KTAVRLSRQRPSSMPPLQVCIEVNIAGEAVKHGVAPEEAVALAVEVAKLPNIVVRGLMC
FT                   VAKANSSETELKVQFQTMRKLLADLNTAGVKADVLSMGMSDDMPAAIECGATHVRIGSA
FT                   IFGKRG"
FT   CDS_pept        202954..203997
FT                   /transl_table=11
FT                   /locus_tag="NMA0218"
FT                   /product="putative pilus retraction protein"
FT                   /note="NMA0218, pilT, possible pilus retraction
FT                   protein,len: 347 aa; almost identical to TR:O85741
FT                   (EMBL:AF074716) Neisseria meningitidis PILT (347 aa), fasta
FT                   scores; E(): 0, 99.4% identity in 347 aa overlap, and
FT                   similar to e.g. PILT_PSEAE P24559 twitching mobility
FT                   protein (344 aa),fasta scores; E(): 0, 66.6% identity in
FT                   344 aa overlap. Contains Pfam match to entry PF00437
FT                   GSPII_E, Bacterial type II secretion system protein,
FT                   PS00017 ATP/GTP-binding site motif A (P-loop), and PS00662
FT                   Bacterial type II secretion system protein E signature.
FT                   Also similar to pilT2 NMA0979 (40.6% identity in 335 aa
FT                   overlap), and pilU NMA0219 (33.7% identity in 335 aa
FT                   overlap)"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0218"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07529"
FT                   /db_xref="GOA:A0A0U1RGZ1"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR006321"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RGZ1"
FT                   /protein_id="CAM07529.1"
FT                   /translation="MQITDLLAFGAKNKASDLHLSSGISPMIRVHGDMRRINLPEMSAE
FT                   EVGNMVTSVMNDHQRKIYQQNLEVDFSFELPNVARFRVNAFNTGRGPAAVFRTIPSTVL
FT                   SLEELKAPSIFQKIAESPRGMVLVTGPTGSGKSTTLAAMINYINETQPAHILTIEDPIE
FT                   FVHQSKKSLINQRELHQHTLSFANALSSALREDPDVILVGEMRDPETIGLALTAAETGH
FT                   LVFGTLHTTGAAKTVDRIVDVFPAGEKEMVRSMLSESLTAVISQNLLKTHDGNGRVASH
FT                   EILIANPAVRNLIRENKITQINSVLQTGQASGMQTMDQSLQSLVRQGLIAPEVARRRAQ
FT                   NSESMSF"
FT   CDS_pept        204160..205386
FT                   /transl_table=11
FT                   /locus_tag="NMA0219"
FT                   /product="pilT-like protein"
FT                   /note="NMA0219, pilU, pilT-like protein, len: 408 aa;
FT                   almost identical to TR:Q06582 (EMBL:L11719) Neisseria
FT                   gonorrhoeae twitching motility protein homolog (180
FT                   aa),fasta scores; E(): 0, 97.8% identity in 180 aa overlap,
FT                   and similar to TR:Q51532 (EMBL:L27667) Pseudomonas
FT                   aeruginosa PILU (382 aa), fasta scores; E(): 0, 44.3%
FT                   identity in 368 aa overlap. Contains 2x Pfam match to entry
FT                   PF00437 GSPII_E, Bacterial type II secretion system
FT                   protein, and PS00017 ATP/GTP-binding site motif A (P-loop).
FT                   Also similar to pilT2 NMA0979 (44.8% identity in 348 aa
FT                   overlap) and pilT NMA0218 (33.7% identity in 335 aa
FT                   overlap)"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0219"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07530"
FT                   /db_xref="GOA:A0A0U1RGZ2"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR006321"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RGZ2"
FT                   /protein_id="CAM07530.1"
FT                   /translation="MNTDNLHDILDEMVQVYSQKKQSRSETPAEIGAHFHPLLDRLCET
FT                   AEAQNASDILISKGFPPSLKINSALTPQPQKALTGEETAAIAASTMNAEQSEIFRRDGE
FT                   INYSVQSRGGTRYRANAYHSQGSAGLVLRRINHVIPQMQELGLPEKLKDLAVAPRGLLI
FT                   IVGPTGSGKSTTMATMLEHRNKTLPSHIVTIEDPIEFIYKPRRCIFTQREIGVDTINWQ
FT                   TAVQNAMRQSSDVVCIGEVRSRESMEYAMQLAQTGHLCIFTLHANTAPQSLERILNFYP
FT                   KEQHNQILIDIALNLTGIICQRLALKQDKTGRTAVVDLLINTPAIQDFILKGDLMNISK
FT                   IMETAKTDGMQTMDQNLFELYRHGIISYEEALRQSVSANNLRLHIQLHKEGKTPELLYD
FT                   RVNGLNLVS"
FT   CDS_pept        205672..207822
FT                   /transl_table=11
FT                   /locus_tag="NMA0220"
FT                   /product="putative integral membrane protein"
FT                   /note="NMA0220, probable integral membrane protein, len:
FT                   716 aa; simlar to several hypothetical proteins e.g.
FT                   YCCS_HAEIN P44289 HI1680 (718 aa), fasta scores; E():
FT                   0,48.2% identity in 709 aa overlap, and YCCS_ECOLI P75870
FT                   (720 aa), fasta scores; E(): 0, 36.2% identity in 704 aa
FT                   overlap. Highly similar in part to YOR2_NEIGO O33369 (417
FT                   aa), fasta scores; E(): 0, 81.1% identity in 355 aa
FT                   overlap. Contains two sets of six putative transmembrane
FT                   domains between aa 1-150 and aa 370-500"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0220"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07531"
FT                   /db_xref="GOA:A0A0U1RGZ3"
FT                   /db_xref="InterPro:IPR010019"
FT                   /db_xref="InterPro:IPR010020"
FT                   /db_xref="InterPro:IPR032692"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RGZ3"
FT                   /protein_id="CAM07531.1"
FT                   /translation="MKTPPLKPLLITSLPVFASVFTAASIVWQLGEPKLAMPFVLGIIA
FT                   GGLVDLDNRLTGRLKNIIATVALFTLSSLVAQSTLGTGLPFILAMTLMTFGFTIMGAVG
FT                   LKYRTFAFGALAVATYTTLTYTPETYWLTNPFMILCGTVLYSTAIILFQIILPHRPVQE
FT                   NVANAYEALGSYLEAKADFFDPDEAEWIGNRHIDLAMSNTGVITAFNQCRSALFYRLRG
FT                   KHRHPRTAKMLRYYFAAQDIHERISSAHVDYQEMSEKFKNTDIIFRIHRLLEMQGQACR
FT                   NTAQALRASKDYVYSKRLGRAIEGCRQSLRLLSDSNDNPDIRHLRRLLDNLGSVDQQFR
FT                   QLQHNGLQAENDRMGDTRIAALETGSLKNTWQAIRPQLNLESGVFRHAVRLSLVVAAAC
FT                   TIVEALNLNLGYWILLTALFVCQPNYTATKSRVRQRIAGTVLGVIVGSLVPYFTPSVET
FT                   KLWIVIASTTLFFMTRTYKYSFSTFFITIQALTSLSLAGLDVYAAMPVRIIDTIIGASL
FT                   AWAAVSYLWPDWKYLTLERTAALAVCSNGAYLEKITERLKSGETGDDVEYRATRRRAHE
FT                   HTAALSSTLSDMSSEPAKFADSLQPGFTLLKTGYALTGYISALGAYRSEMHEECSPDFT
FT                   AQFHLAAEHTAHIFQHLPETEPDDFQTALDTLRGELDTLRTHSSGTQSHILLQQLQLIA
FT                   RQLEPYYRAYRQIPHRQPQNAA"
FT   CDS_pept        complement(209578..210585)
FT                   /transl_table=11
FT                   /locus_tag="NMA0221"
FT                   /product="putative transposase for IS1106"
FT                   /note="NMA0221, probable transposase for IS1106, len: 335
FT                   aa; almost identical to many e.g. TR:CAB44967
FT                   (EMBL:AJ242841) N. meningitidis putative transposase for
FT                   IS1106A3 (335 aa), fasta scores; E(): 0, 97.0% identity in
FT                   335 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0221"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07532"
FT                   /db_xref="GOA:A0A0U1RGZ4"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR008490"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RGZ4"
FT                   /protein_id="CAM07532.1"
FT                   /translation="MSTFFQQTAQAMIAKHIDRFPLLKLDQVIDWQPIEQYLNRQKNRY
FT                   LRDHRGRPAYPLLSMFKAVLLGQWHSLSDPELEHSLITRIDFNLFCRFDELSIPDYSTL
FT                   CRYRNWLAQDDTLSELLKLINRQLTEKGLKIEKASAAVVDATIIQTAGSKQRQTIEVDE
FT                   EGQVSGQTTPSKDSDARWIKKNGLYKLGYKQHTRTDAEGYIEKLHITPANAHECKHLSP
FT                   LLEGLPEGTTVYADKGYDSAENRQHLEERQLLDGIMRKTCRNRPLSEAQTKRNRYLSKT
FT                   RYVVEQSFGTLHRKFRYARAAYFGLIKVSAQSHLKAMCLNLLKAANRLSAPVCA"
FT   CDS_pept        211062..212519
FT                   /transl_table=11
FT                   /locus_tag="NMA0222"
FT                   /product="putative peptide transporter"
FT                   /note="NMA0222, probable peptide transporter, len: 485 aa;
FT                   simlar to hypothetical proteins e.g. YCLF_BACSU P94408 (492
FT                   aa), fasta scores; E(): 0, 38.6% identity in 484 aa
FT                   overlap, and to DTPT_LACLA P36574 di-/tripeptide
FT                   transporter (463 aa), fasta scores; E(): 0, 36.7% identity
FT                   in 463 aa overlap. Contains Pfam match to entry PF00854
FT                   PTR2, Peptide transporter family, and PS01023 PTR2 family
FT                   proton/oligopeptide symporters signature 2"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0222"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07533"
FT                   /db_xref="GOA:A0A0U1RGZ5"
FT                   /db_xref="InterPro:IPR000109"
FT                   /db_xref="InterPro:IPR005279"
FT                   /db_xref="InterPro:IPR018456"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RGZ5"
FT                   /protein_id="CAM07533.1"
FT                   /translation="MSRHPARTGEKTFFGHPFQLSTLFHIELWERFSFYGMQGILLIYL
FT                   YYTADKGGLGIDKTLAGGIVGAYSGSVYLSTILGAWFADRVWGAEKTLFLSGIVVMLGH
FT                   IVLAAAPGLYGLLIGLIFIALGSGGVKSTASSMVGALYEQDEMRPLRDAGFSIFYIAIN
FT                   IGGFLGPLLTGLLQENIGFHYGFGAAAVGMAFGLWRYSLGRKNLPHPTVPHPLSKGQGK
FT                   TAAAVGIALIAALATAIKTGLVNLDNFSGILLSTVILAVIVYFTRLLTNPRVSSDNKRH
FT                   IIAYIPLFLTICMFWAVWFQIYTVATVYFDETVNRTIGSFTVPVAWKDSMQSLWVILFS
FT                   GLMAAMWTKMGRKQPKTPLKFAMAVFVTGASFLGFVPFISAGTPMPIAVFALIVLAITI
FT                   GELMISPIALSISTKIAPPLFKTQMVALNFLAFSLGFTLGGVLFEKGYQAGDEIGFYRL
FT                   LFYIGAATGFLLLLLVPKLNKMLEGTD"
FT   CDS_pept        complement(213431..214534)
FT                   /transl_table=11
FT                   /locus_tag="NMA0224"
FT                   /product="peptide chain release factor 2"
FT                   /note="NMA0224, prfB, peptide chain release factor 2, len:
FT                   367 aa; similar to many e.g. RF2_ECOLI P07012 peptide chain
FT                   release factor 2 (365 aa), fasta scores; E(): 0,64.4%
FT                   identity in 362 aa overlap. Contains Pfam match to entry
FT                   PF00472 RF-1, Prokaryotic-type class I peptide chain
FT                   release factors"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0224"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07534"
FT                   /db_xref="GOA:Q9JWV4"
FT                   /db_xref="InterPro:IPR000352"
FT                   /db_xref="InterPro:IPR004374"
FT                   /db_xref="InterPro:IPR005139"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9JWV4"
FT                   /protein_id="CAM07534.1"
FT                   /translation="MEAEVINQLNNTLNDLEKRSEDIRVYMDYQGKKDRLEEVIGLSED
FT                   PELWNDPKRAQEIGKERKILEGIVLTLDNIATGIEDNRMLIEMTVEENDEEGFAAVQED
FT                   VAGLEKQMADLEFKRMFNQPADPNNCFIDITAGAGGTEAEDWAGMLFRMYSRYAERKGF
FT                   KIEILEEDDGEIAGINRATIRVEGEYAYGLLRTETGVHRLVRYSPFDSNNKRHTSFASV
FT                   FVYPEIDDSIEIEINPADLRIDTYRASGAGGQHINKTDSAVRITHEPTGIVVQCQNDRS
FT                   QHANKAAAMEMLKSKLYELEMRKRNEEKQALEEGKSDVGWGSQIRSYVLDSSRIKDLRT
FT                   GYEVGNTKAVLDGDLDGFIEASLKQGV"
FT   CDS_pept        complement(214637..215539)
FT                   /transl_table=11
FT                   /locus_tag="NMA0225"
FT                   /product="possible lipoprotein"
FT                   /note="NMA0225, possible lipoprotein, len: 300 aa; similar
FT                   to hypothetical proteins e.g. YCHK_ECOLI (314 aa), fasta
FT                   scores; E(): 1.2e-17, 36.6% identity in 194 aa overlap.
FT                   Contains Pfam match to entry PF01173
FT                   UPF0028,Uncharacterized protein family UPF0028, possible
FT                   N-terminal signal sequence, and PS00013 Prokaryotic
FT                   membrane lipoprotein lipid attachment site"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0225"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07535"
FT                   /db_xref="GOA:A0A0U1RGZ6"
FT                   /db_xref="InterPro:IPR002641"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RGZ6"
FT                   /protein_id="CAM07535.1"
FT                   /translation="MENMVTFSKIRPLLAIAAAALLAACGTAGNNAARKPVQTAKPAAV
FT                   VGLALGGGASKGFAHVGIIKVLKENGIPVKVVTGTSAGSIVGSLFASGMSPDRLELEAE
FT                   ILGKTDLVDLTLSTSGFIKGEKLQNYINRKVGGRRIQQFPIKFAAVATDFETGKAVAFN
FT                   QGNAGQAVRASAAIPNVFQPVIIGRHTYVDGGLSQPVPVSAARRQGANFVIAVDISARP
FT                   SKNISQGFFSYLDQTLNVMSVSALQNELGQADVVIKPQVLDLGAVGGFDQKKRAIRLGE
FT                   EAARAALPEIKRKLAAYRY"
FT   CDS_pept        215872..216321
FT                   /transl_table=11
FT                   /locus_tag="NMA0226"
FT                   /product="putative integral membrane protein"
FT                   /note="NMA0226, probable integral membrane protein, len:
FT                   149 aa; similar to YG02_HAEIN P44270 HI1602 (151 aa),fasta
FT                   scores; E(): 1.5e-32, 58.8% identity in 136 aa overlap.
FT                   Also similar to NMA2196 (34.1% identity in 129 aa overlap)"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0226"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07536"
FT                   /db_xref="GOA:A0A0U1RGZ7"
FT                   /db_xref="InterPro:IPR032808"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RGZ7"
FT                   /protein_id="CAM07536.1"
FT                   /translation="MKIGTTWQTASAMLVLRLFAAYEFLESGLQKWNGENWFSEINDQF
FT                   PFPFNLLPDALNWNLAMYAELLLPVLLLLGLATRLSALGLMVVTAVAWAAVHAGSGYNV
FT                   CDNGYKMALIYIVVLIPLLFQGAGGWSLDTLLKKRFCPQCRLKQD"
FT   CDS_pept        216395..216703
FT                   /transl_table=11
FT                   /locus_tag="NMA0227"
FT                   /product="putative periplasmic protein"
FT                   /note="NMA0227, probable periplasmic protein, len: 102 aa;
FT                   similar to YG01_HAEIN P44269 HI1601 precursor (95 aa),fasta
FT                   scores; E(): 3.9e-09, 48.0% identity in 100 aa overlap.
FT                   Contains N-terminal signal sequence"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0227"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07537"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RGZ8"
FT                   /protein_id="CAM07537.1"
FT                   /translation="MNKNIAAALAGALSLSLAAGAVAANKPASNATGVHKSAHGSCGAS
FT                   KSAEGSCGAAGSKAGEGKCGEGKCGATVKKTHKHTKASKAKAKSAEGKCGEGKCGSK"
FT   CDS_pept        216819..217661
FT                   /transl_table=11
FT                   /locus_tag="NMA0228"
FT                   /product="hypothetical protein NMA0228"
FT                   /note="NMA0228, unknown, len: 280 aa; similar to YG00_HAEIN
FT                   P44268 HI1600 (317 aa), fasta scores; E(): 0,66.0% identity
FT                   in 294 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0228"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07538"
FT                   /db_xref="InterPro:IPR007801"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9JWV1"
FT                   /protein_id="CAM07538.1"
FT                   /translation="MIQHAGLGYRRDLAEDFLSLSENSPICFIEAAPENWLKMGGWARK
FT                   QFDRVAERLPLALHGLSMSLGGQAPLDTDLIDGIKEMMRRYDCTFFSDHLSYCHDGGHL
FT                   YDLLPLPFTEEMVHHTARRIREVQDRLGCRIAVENTSYYLHSPLAEMNEVEFLNAVARE
FT                   ADCGIHLDVNNIYVNAVNHGLLSPEAFLKNVDADRVCYIHIAGHDVETPELLIDTHGAA
FT                   VLPTVWDLLELAYAKLPTIPPTLLERDFNFPPFAELEAEVAKIADYQTRAGKEYRRAA"
FT   CDS_pept        217651..218397
FT                   /transl_table=11
FT                   /locus_tag="NMA0229"
FT                   /product="hypothetical protein NMA0229"
FT                   /note="NMA0229, unknown, len: 248 aa; similar to YF99_HAEIN
FT                   P44267 HI1599 (238 aa), fasta scores; E(): 1.3e-24, 36.1%
FT                   identity in 227 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0229"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07539"
FT                   /db_xref="InterPro:IPR018640"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RGZ9"
FT                   /protein_id="CAM07539.1"
FT                   /translation="MQPEISAQYQHRFAQAIREGEAADGLPQERLNVYIRLIRNNIHSF
FT                   IDRCYTETRQYFDSEEWSRLKEGFVRDAHAQTPYFQEIPGEFLQYCQSLPLLDGILALM
FT                   DFEYTQLLAEVAQIPDIPDIHYSNDSKYTPSPAAFIRQYRYDVTDDLHEAETALLIWRN
FT                   AEDDVMYQTLDGFDMMLLEIMGSSALSFDTLAQTLVEFMPEDDNWKNILLGKWSGWTEQ
FT                   RIIIPSLSAISENMEGNSPGQNHLSA"
FT   CDS_pept        218419..219006
FT                   /transl_table=11
FT                   /locus_tag="NMA0230"
FT                   /product="putative ECF-family RNA polymerase sigma factor"
FT                   /note="NMA0230, probable ECF-family RNA polymerase sigma
FT                   factor, len: 195 aa; similar to e.g. YE59_HAEIN P45215
FT                   probable RNA polymerase sigma factor HI1459 (194 aa),fasta
FT                   scores; E(): 6.3e-26, 43.7% identity in 183 aa overlap, and
FT                   SIGY_BACSU P94370 RNA polymerase sigma factor SIGY (178
FT                   aa), fasta scores; E(): 0.00056, 25.8% identity in 159 aa
FT                   overlap. Contains Pfam match to entry PF00776 Sigma70_ECF,
FT                   Sigma-70 factor (ECF subfamily), and PS01063 Sigma-70
FT                   factors ECF subfamily signature"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0230"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07540"
FT                   /db_xref="GOA:A0A0U1RH00"
FT                   /db_xref="InterPro:IPR000838"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR014289"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RH00"
FT                   /protein_id="CAM07540.1"
FT                   /translation="MPLPDLTDAELIESRKLLLHFARLQLPDHPDLAEDLVQETLLSAY
FT                   SAGDSFQGRALVNSWLFAILKNKIIDALRQIGRQRKVFTALDDELLDEAFESHFSQNGH
FT                   WTPEGQPQHWNTPEKSLNNNEFQKILQSCLYNLPENTARVFTLKEILGFSSDEIQQMCG
FT                   ISTSNYHTIMHRARESLRQCLQIKWFNQENPK"
FT   CDS_pept        219450..219872
FT                   /transl_table=11
FT                   /locus_tag="NMA0233"
FT                   /product="putative lipoprotein"
FT                   /note="NMA0233, probable lipoprotein, len: 140 aa. Contains
FT                   N-terminal signal sequence and appropriately positioned
FT                   PS00013 Prokaryotic membrane lipoprotein lipid attachment
FT                   site"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0233"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07541"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RH01"
FT                   /protein_id="CAM07541.1"
FT                   /translation="MRPIFLSFVLFPILITACSTPDKSARWENIGTISNGNIHTYINKD
FT                   SVRKNGNLMIFQDKKVVTNLKQERFANTPAYKTAIAEWEIHCNNKTYRLSSLQLFDTKN
FT                   TEISTQNYTASSLRPMSILSGTLTEKQYETVCGKKL"
FT   CDS_pept        220348..221310
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="NMA0235"
FT                   /product="pseudogene (IS1655 transposase)"
FT                   /note="NMA0235, probable transposase pseudogene for IS1655,
FT                   len: 963 bp; similar to many e.g. TRA4_BACFR P37247
FT                   transposase for insertion sequence element IS4351 (326 aa),
FT                   fasta scores; E(): 3.5e-29, 38.5% identity in 252 aa
FT                   overlap. Contains Pfam match to entry PF01460
FT                   Transposase_4, Transposase IS30 family"
FT   CDS_pept        complement(222047..222649)
FT                   /transl_table=11
FT                   /locus_tag="NMA0237"
FT                   /product="hypothetical protein NMA0237"
FT                   /note="NMA0237, unknown, len: 200 aa; similar to
FT                   hypothetical proteins e.g. YRDC_ECOLI P45748 (190 aa),fasta
FT                   scores; E(): 4.4e-20, 41.7% identity in 168 aa overlap.
FT                   Contains Pfam match to entry PF01300 Sua5_yciO_yrdC,
FT                   SUA5/yciO/yrdC family, PS01147 SUA5/yciO/yrdC family
FT                   signature, and PS00599 Aminotransferases class-II
FT                   pyridoxal-phosphate attachment site"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0237"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07543"
FT                   /db_xref="GOA:A1IP83"
FT                   /db_xref="InterPro:IPR006070"
FT                   /db_xref="InterPro:IPR017945"
FT                   /db_xref="InterPro:IPR023535"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1IP83"
FT                   /protein_id="CAM07543.1"
FT                   /translation="MTDVLQTVFYIMLFPRIIAASAQRKLSVYLKKGGLVAYPTESCYG
FT                   LGCLPTLAKALGKLAHLKKRPQHKGMIVIGNQFEQLQPLLQMPSENLQDMLRKEWPAPK
FT                   TFLLSAKSCVLPELRGKQRSKLAVRVPAHVGARRLCQALQTPLVSTSCNRAGKRACRTE
FT                   REVRRQFGRDVWIVGGRIGRQKSPSQIIDGETGKRLR"
FT   CDS_pept        complement(222683..223954)
FT                   /transl_table=11
FT                   /locus_tag="NMA0238"
FT                   /product="phosphoribosylamine--glycine ligase"
FT                   /EC_number="6.3.4.13"
FT                   /note="NMA0238, purD, phosphoribosylamine--glycine
FT                   ligase,len: 423 aa; highly similar to many e.g. PUR2_ECOLI
FT                   P15640 phosphoribosylamine--glycine ligase (EC 6.3.4.13)
FT                   (429 aa), fasta scores; E(): 0, 64.6% identity in 426 aa
FT                   overlap. Contains Pfam match to entry PF01071
FT                   GARS,Phosphoribosylglycinamide synthetase (GARS), and
FT                   PS00184 Phosphoribosylglycinamide synthetase signature"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0238"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07544"
FT                   /db_xref="GOA:Q9JWU6"
FT                   /db_xref="InterPro:IPR000115"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR020559"
FT                   /db_xref="InterPro:IPR020560"
FT                   /db_xref="InterPro:IPR020561"
FT                   /db_xref="InterPro:IPR020562"
FT                   /db_xref="InterPro:IPR037123"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9JWU6"
FT                   /protein_id="CAM07544.1"
FT                   /translation="MKLLVIGNGGREHALAWKLAQSPKVETVFVAPGNAGTAIEPKLQN
FT                   IDLTAHQDLIEFCRKENIVFTVVGPEAPLAAGVVDDFRAAGLKIFGPTQYAAQLESSKD
FT                   FAKAFMAKYNIPTAQYQTFENADAAHDYVNQKGAPIVIKADGLAAGKGVIVAMTLDEAH
FT                   AAIDDMLLDNKMGNAGARVVIEDFLQGEEASFIVMVDGNNVLPMATSQDHKRLLDGDKG
FT                   LNTGGMGAYSPAPVVTPVVYERAMNEIILPTVAGMKAEGHEFTGFLYAGLMIDQSGAPH
FT                   TIEFNCRFGDPETQPIMSRLNSDLSDLVEAAIDGKLDSVTAEWSPQTAVGVVLAAQNYP
FT                   ETPKKGDVISGLDAANQVGKVFHAGTTANEKGDVLTNGGRVLCVVGLGDNVAQAKAKAY
FT                   GALEKISFDGMQYRKDIADKAINR"
FT   CDS_pept        224111..224428
FT                   /transl_table=11
FT                   /locus_tag="NMA0239"
FT                   /product="hypothetical protein NMA0239"
FT                   /note="NMA0239, unknowwn, len: 105 aa"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0239"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07545"
FT                   /db_xref="InterPro:IPR025384"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RH02"
FT                   /protein_id="CAM07545.1"
FT                   /translation="MQKRIDEIQSKYREWCHLLPQLEEDIRRWKYVVTLIRDMDNFYTH
FT                   EYQACHQAIEDGVELDLSTEGEYSIMSEDALWNALGEFHQLAWLYLRSSVDALDKYTQE
FT                   D"
FT   CDS_pept        complement(224480..225091)
FT                   /transl_table=11
FT                   /locus_tag="NMA0240"
FT                   /product="hypothetical protein NMA0240"
FT                   /note="NMA0240, unknown, len: 203 aa; similar to
FT                   hypothetical proteins e.g. YIGZ_ECOLI P27862 (205 aa),fasta
FT                   scores; E(): 6.5e-16, 36.3% identity in 160 aa overlap.
FT                   Contains Pfam match to entry PF01205
FT                   UPF0029,Uncharacterized protein family UPF0029, and PS00910
FT                   Uncharacterized protein family UPF0029 signature"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0240"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07546"
FT                   /db_xref="InterPro:IPR001498"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020569"
FT                   /db_xref="InterPro:IPR023582"
FT                   /db_xref="InterPro:IPR036956"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RH03"
FT                   /protein_id="CAM07546.1"
FT                   /translation="MITTYKTITSSTQAEFKDKGSRFIAFAYPIRTLADVKKYLDPLKE
FT                   EHHKARHWCYAYRLGVDGMQFRANDDGEPSGSAGRPILGQIDSVGITDVLVVVVRYFGG
FT                   TLLGVPGLIHAYKEATAQALAVAEVVEKNIEKTVWLKCEYPFLNEAIRIAKQYQADILE
FT                   RDLQLDCRLTVSLSLVNYEACVAAWKNTRQIEVNTEKPFE"
FT   CDS_pept        complement(225154..226089)
FT                   /transl_table=11
FT                   /locus_tag="NMA0241"
FT                   /product="electron transfer flavoprotein alpha-subunit"
FT                   /note="NMA0241, etfA, electron transfer flavoprotein
FT                   alpha-subunit, len: 311 aa; highly similar to many e.g.
FT                   ETFA_BRAJA P53573 electron transfer flavoprotein
FT                   alpha-subunit (314 aa), fasta scores; E(): 0, 59.4%
FT                   identity in 310 aa overlap, and ETFA_HUMAN P13804 electron
FT                   transfer flavoprotein alpha-subunit (333 aa), fasta scores;
FT                   E(): 0, 55.1% identity in 312 aa overlap. Contains Pfam
FT                   match to entry PF00766 ETF_alpha, Electron transfer
FT                   flavoprotein alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0241"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07547"
FT                   /db_xref="GOA:A0A0U1RH04"
FT                   /db_xref="InterPro:IPR001308"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014730"
FT                   /db_xref="InterPro:IPR014731"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR033947"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RH04"
FT                   /protein_id="CAM07547.1"
FT                   /translation="MSVLIIVEHDNKQLNPTTLHAVTAAAKLGKVDLLVAGSGASAVVE
FT                   SAKQVAGVEKVLVADAAHYAEGLAEELAPLVVKLAADYRYVAATATTFGKNLLPRVAAL
FT                   LDVPQISDLTEIVDNTIFVRPIYAGNAFETVQVDSEKLVLTFRATAFDAAPVQGGHAEV
FT                   INVEATPAQNLSRFVNRQLSHSDRPELTQAKVIVSGGRALGSAEKFNEVLTPLADVLGA
FT                   AIGASRAAVDAEYAPNDAQVGQTGKVVAPQLYFAIGISGAIQHVAGMQDSKVIVAINKD
FT                   ADAPIFNVADYGLVGDLFEIVPQLTEALKN"
FT   CDS_pept        complement(226100..226849)
FT                   /transl_table=11
FT                   /locus_tag="NMA0242"
FT                   /product="electron transfer flavoprotein beta-subunit"
FT                   /note="NMA0242, etfB, flaX, electron transfer flavoprotein
FT                   beta-subunit, len: 249 aa; almost identical to TR:Q51129
FT                   (EMBL:U40862) N. meningitidis FLAX (249 aa), fasta scores;
FT                   E(): 0,97.2% identity in 249 aa overlap, and highly similar
FT                   to e.g. ETFB_BRAJA P53575 electron transfer flavoprotein
FT                   beta-subunit (249 aa), fasta scores; E(): 0,62.7% identity
FT                   in 249 aa overlap, and ETFB_HUMAN P38117 electron transfer
FT                   flavoprotein beta-subunit (255 aa),fasta scores; E(): 0,
FT                   55.6% identity in 252 aa overlap. Contains Pfam match to
FT                   entry PF01012 ETF_beta, Electron transfer flavoprotein beta
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0242"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07548"
FT                   /db_xref="GOA:A0A0U1RH05"
FT                   /db_xref="InterPro:IPR000049"
FT                   /db_xref="InterPro:IPR012255"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014730"
FT                   /db_xref="InterPro:IPR033948"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RH05"
FT                   /protein_id="CAM07548.1"
FT                   /translation="MKALVAVKRVVDYNVKVRVKADGSDVDIGNVKMSMNPFDEIAVEE
FT                   AVRLKEAGKVSEIVAVSLGEKKCEETLRTALAMGADRAIHVETDTKLESLAVAKLLKAV
FT                   ADKENPQIFFLGKQAIDDDANQVAQMLAALLNAAQGTFASKVHIEGGEVQIVREIDGGE
FT                   ETIALKLPAVISADLRLNEPRFVKLPNIMAAKKKPLEKLAPADLATDILPRLKTVKFAE
FT                   PKARQAGVKVASVAELVEKLKNEAKVI"
FT   CDS_pept        complement(227075..228043)
FT                   /transl_table=11
FT                   /locus_tag="NMA0243"
FT                   /product="lipopolysaccharide heptosyltransferase I"
FT                   /note="NMA0243, rfaC, lipopolysaccharide
FT                   heptosyltransferase I, len: 322 aa; almost identical to
FT                   TR:Q51122 (EMBL:U35454) N. meningitidis heptosyltransferase
FT                   I (322 aa), fasta scores; E(): 0,97.8% identity in 322 aa
FT                   overlap, and similar to e.g. RFAC_ECOLI P24173
FT                   lipopolysaccharide heptosyltransferase-1 (319 aa), fasta
FT                   scores; E(): 0, 40.8% identity in 287 aa overlap. Contains
FT                   Pfam match to entry PF01075 Heptosyltranf,
FT                   Heptosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0243"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07549"
FT                   /db_xref="GOA:A0A0U1RH06"
FT                   /db_xref="InterPro:IPR002201"
FT                   /db_xref="InterPro:IPR011908"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RH06"
FT                   /protein_id="CAM07549.1"
FT                   /translation="MKILLVRLSSMGDLIHTLPAIEDLARQCPDVELHWLCEAGFADIA
FT                   RLHPFVKKIHVMKWRQWRKHLFQAETWREMGHLKQTLRQEAFNFVLDSQGLIKSACFAK
FT                   MAKSPIYGLDKNSAREGLAALAYAKTYAVPKGKNAVWRNRELFAQVFGYAMPETQVFGL
FT                   TVPEAGRLKNLAQPYYAALHATSRDSKLWPVENWRSLLQKLNEEQQCNIYLPWGNEDEK
FT                   TRAKQIADGLPFAIVCDKMNLLQAAYLLKHAVGIVGVDTGLLHLANALEKPVVGIYTDT
FT                   DPIKTGVQVSPIAKNLGNIGQIPTADLVYQTLMDCVAADKG"
FT   CDS_pept        complement(228080..228715)
FT                   /transl_table=11
FT                   /locus_tag="NMA0244"
FT                   /product="putative nicotinamidase"
FT                   /EC_number="3.5.1.19"
FT                   /note="NMA0244, pncA, probable nicotinamidase, len: 211 aa;
FT                   similar to e.g. PNCA_ECOLI P21369
FT                   pyrazinamidase/nicotinamidase [includes: pyrazinamidase (EC
FT                   3.5.1.-) (PZASE); nicotinamidase (EC 3.5.1.19) (nicotine
FT                   deamidase)] (213 aa), fasta scores; E(): 7e-09,32.5%
FT                   identity in 212 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0244"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07550"
FT                   /db_xref="GOA:A0A0U1RH07"
FT                   /db_xref="InterPro:IPR000868"
FT                   /db_xref="InterPro:IPR036380"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RH07"
FT                   /protein_id="CAM07550.1"
FT                   /translation="MIVSIDVDAQKTFTPLCPKELPVNEGHLIVEELNAQAALADLRVM
FT                   TKDAHYMVAKWLVDNPVDMLKPTGLPDADLTWVAHAMVGTRGYELLDGLPSAKEYDYCV
FT                   WKGVDPELHPYGACFHDIEEKLSTGLIEWLRCQNTDMVIVGGLATDYCVKTTVLQLLKG
FT                   SNWQVIVNEAACRGIAPDTIETAWQEMRSAGAVILKNAEEIKKYINNQ"
FT   CDS_pept        228830..229510
FT                   /transl_table=11
FT                   /locus_tag="NMA0245"
FT                   /product="hypothetical protein NMA0245"
FT                   /note="NMA0245, unknown, len: 226 aa; similar to
FT                   hypothetical proteins e.g. YAEB_ECOLI P28634 (235 aa),fasta
FT                   scores; opt: 578 z-score: 695.1 E(): 2.3e-31 41.8% identity
FT                   in 232 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0245"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07551"
FT                   /db_xref="InterPro:IPR023368"
FT                   /db_xref="InterPro:IPR023370"
FT                   /db_xref="InterPro:IPR036413"
FT                   /db_xref="InterPro:IPR036414"
FT                   /db_xref="InterPro:IPR040372"
FT                   /db_xref="InterPro:IPR041369"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RH08"
FT                   /protein_id="CAM07551.1"
FT                   /translation="MTYTIVPIATARSPYKQKFGIARQPGLVSAAEVCIELNPEFTADS
FT                   VRGLEDFDYVWISFIFHGVLDEGWAQMVRPPRLGGKQKMGVFATRSPHRPNHLGLSLLK
FT                   LNRIETGKPVRLYCSGADLLDGTPIVDIKPYIPFVESKPDAASGFVSGKPVELEVVWQE
FT                   NIGAENLSANTKNLISQSIAQDPRPAYQNIPERIYVMNIADYEIRFQIEENRATVIDLS
FT                   PTPL"
FT   CDS_pept        complement(229768..230772)
FT                   /transl_table=11
FT                   /locus_tag="NMA0246"
FT                   /product="glyceraldehyde 3-phosphate dehydrogenase C"
FT                   /EC_number="1.2.1.12"
FT                   /note="NMA0246, gapC, glyceraldehyde 3-phosphate
FT                   dehydrogenase C, len: 334 aa; highly similar to many e.g.
FT                   G3P_CLOPA Q59309 glyceraldehyde 3-phosphate dehydrogenase
FT                   (EC 1.2.1.12) (334 aa), fasta scores; E(): 0, 75.9%
FT                   identity in 328 aa overlap, and G3P3_ECOLI P33898
FT                   glyceraldehyde 3-phosphate dehydrogenase C (EC 1.2.1.12)
FT                   (332 aa), fasta scores; E(): 0, 57.1% identity in 331 aa
FT                   overlap. Contains Pfam match to entry PF00044
FT                   gpdh,glyceraldehyde 3-phosphate dehydrogenases, and PS00071
FT                   Glyceraldehyde 3-phosphate dehydrogenase active site. Also
FT                   similar to gapA, NMA0062 (50.7% identity in 341 aa
FT                   overlap)"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0246"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07552"
FT                   /db_xref="GOA:A0A0U1RH09"
FT                   /db_xref="InterPro:IPR006424"
FT                   /db_xref="InterPro:IPR020828"
FT                   /db_xref="InterPro:IPR020829"
FT                   /db_xref="InterPro:IPR020830"
FT                   /db_xref="InterPro:IPR020831"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RH09"
FT                   /protein_id="CAM07552.1"
FT                   /translation="MSIKVAINGFGRIGRLALRQIEKAHGIEVVAVNDLTPAEMLLHLF
FT                   KYDSTQGRFQGTAELKDDAIVVNGKEIKVFANPNPEELPWGELGVDVVLECTGFFTNKT
FT                   KAEAHIRAGARKVVISAPGGNDVKTVVYGVNQDILDGSETVISAASCTTNCLAPMAAVL
FT                   QKEFGVVEGLMTTIHAYTGDQNTLDAPHRKGDLRRARAAALNIVPNSTGAAKAIGLVIP
FT                   ELNGKLDGSAQRVPVATGSLTELVSVLERPVTKEEINAAMKAAASESYGYNEDQIVSSD
FT                   VVGIEYGSLFDATQTRVMTVGGKQLVKTVAWYDNEMSYTCQLVRTLEYFAGKI"
FT   CDS_pept        231216..233810
FT                   /transl_table=11
FT                   /locus_tag="NMA0247"
FT                   /product="DNA mismatch repair protein"
FT                   /note="NMA0247, mutS, DNA mismatch repair protein, len: 864
FT                   aa; similar to many e.g. MUTS_ECOLI P23909 DNA mismatch
FT                   repair protein MUTS (853 aa), fasta scores; E(): 0, 49.7%
FT                   identity in 866 aa overlap. Contains Pfam match to entry
FT                   PF00488 mutS, DNA mismatch repair proteins, mutS family,
FT                   PS00017 ATP/GTP-binding site motif A (P-loop), and PS00486
FT                   DNA mismatch repair proteins mutS family signature"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0247"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07553"
FT                   /db_xref="GOA:Q9JWT7"
FT                   /db_xref="InterPro:IPR000432"
FT                   /db_xref="InterPro:IPR005748"
FT                   /db_xref="InterPro:IPR007695"
FT                   /db_xref="InterPro:IPR007696"
FT                   /db_xref="InterPro:IPR007860"
FT                   /db_xref="InterPro:IPR007861"
FT                   /db_xref="InterPro:IPR016151"
FT                   /db_xref="InterPro:IPR017261"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036187"
FT                   /db_xref="InterPro:IPR036678"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9JWT7"
FT                   /protein_id="CAM07553.1"
FT                   /translation="MSKSAVSPMMQQYLGIKAQHTDKLVFYRMGDFYEMFFDDAVEAAK
FT                   LLDITLTTRGQVDGEPVKMAGVPFHAAEQYLARLVKLGKSVAICEQVGEVGAGKGPVER
FT                   KVVRIVTPGTLTDSALLEDKETNRIVAVSPDKKYIGLAWASLQSGEFKTKLTTVDKLDD
FT                   ELARLQAAEILLPDSKNAPQLQTASGVTRLNAWQFAADAGEKLLTEYFGCQDLRGFGLD
FT                   GKEHAVAIGAAGALLNYIRLTQNLMPQHLDGLSLETDSQYIGMDAATRRNLEITQTLSG
FT                   KKSPTLMSTLDLCATHMGSRLLALWLHHPLRNRAHIRARQEAVAALESQYKPLQCRLKN
FT                   IADIERIAARIAVGNARPRDLASLRDSLFELAQIDLSANGSSLLETLKAVFPENLSTAE
FT                   QLRQAILPEPSVWLKDGNVINHGFHPELDELRRIQNHGDEFLLDLEAKERERTGLSTLK
FT                   VEFNRVHGFYIELSKTQAEQAPADYQRRQTLKNAERFITPELKAFEDKVLTAQEQALAL
FT                   EKQLFDGVLKNLQTALPQLQKAAKAAAALDVLSTFSALAKERNFVRPEFADYPAIHIEN
FT                   GRHPVVEQQVRHFTANHTNLDHKHRLMLLTGPNMGGKSTYMRQVALIVLLAHTGCFVPA
FT                   DAATIGPIDQIFTRIGASDDLASNRSTFMVEMSETAYILHHATEQSLVLMDEVGRGTST
FT                   FDGLALAHAVAEHLLQKNKSFSLFATHYFELTYLPEAHAAAVNMHLSALEQGQDIVFLH
FT                   QIQPGPAGKSYGIAVAKLAGLPVRALKSAQKHLNGLENQAAANRPQLDIFSTMPSEKGD
FT                   EPNVGNFVDKAEEKHFEGILAAALEKLDPDSLTPREALSELYRLKDLCKSVS"
FT   CDS_pept        complement(233934..234425)
FT                   /transl_table=11
FT                   /locus_tag="NMA0248"
FT                   /product="putative acetyltransferase"
FT                   /note="NMA0248, possible acetyltransferase, len: 163 aa;
FT                   contains weak similarity to predicted acetyltransferases
FT                   e.g. TR:Q50708 (EMBL:Z77165) M. tuberculosis putative
FT                   ribosomal-protein-alanine acetyltransferase (158 aa),fasta
FT                   scores; E(): 0.00045, 30.5% identity in 154 aa overlap.
FT                   Contains Pfam match to entry PF00583 Acetyltransf,
FT                   Acetyltransferase (GNAT) family"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0248"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07554"
FT                   /db_xref="GOA:A0A0U1RH10"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RH10"
FT                   /protein_id="CAM07554.1"
FT                   /translation="MNSLFVDNTVFITRLKAGHIGRLVQALFEEWHGFEPWSSVDKIRA
FT                   YYGRCLKDDELPLAFAAVDDFGTLLGSAAVKRHDMKSFPQYEYWLGDVFVLPEYRGKGI
FT                   GRRLVAHCIGAARSLGIKFLYLYTPDVQIFYESFGWAVVGRHFHNGEWVTVMRLDMDKV
FT                   "
FT   CDS_pept        complement(234429..234770)
FT                   /transl_table=11
FT                   /locus_tag="NMA0249"
FT                   /product="putative periplasmic protein"
FT                   /note="NMA0249, probable periplasmic protein, len: 113 aa;
FT                   contains probable N-terminal signal sequence and
FT                   coiled-coil domain around aa 50"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0249"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07555"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RH11"
FT                   /protein_id="CAM07555.1"
FT                   /translation="MKKILYFLMVVFSTSVWAGDAEDNLLSIQSGYRALLQKQNNLDGK
FT                   IIGMQSDLEDARRRLQAAQADIARLEAEIPAAMAQKARQAEELRQIGVRLDHAWNAVYG
FT                   AGGTKASGN"
FT   CDS_pept        complement(234845..236239)
FT                   /transl_table=11
FT                   /locus_tag="NMA0250"
FT                   /product="glutamyl-tRNA synthetase"
FT                   /EC_number="6.1.1.17"
FT                   /note="NMA0250, gltX, glutamyl-tRNA synthetase, len: 464
FT                   aa; similar to many e.g. SYE_ECOLI P04805 glutamyl-tRNA
FT                   synthetase (EC 6.1.1.17) (471 aa), fasta scores; E():
FT                   0,48.1% identity in 464 aa overlap. Contains Pfam match to
FT                   entry PF00749 tRNA-synt_1c, tRNA synthetases class I (E and
FT                   Q), and PS00178 Aminoacyl-transfer RNA synthetases class-I
FT                   signature"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0250"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07556"
FT                   /db_xref="GOA:Q9JWT4"
FT                   /db_xref="InterPro:IPR000924"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR004527"
FT                   /db_xref="InterPro:IPR008925"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020058"
FT                   /db_xref="InterPro:IPR020751"
FT                   /db_xref="InterPro:IPR020752"
FT                   /db_xref="InterPro:IPR033910"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9JWT4"
FT                   /protein_id="CAM07556.1"
FT                   /translation="MTVKTRFAPSPTGYLHIGGVRTALFSWAFARHHKGEFLLRIEDTD
FT                   LARSTAESVNIILDGMKWVGLNYDNADNVVYQTRRFDRYKEVIAELLEKGHAYYCYCSK
FT                   EELEAMREKAEKEGTATYDRRWRPEAGKTLPEIPAGVQPVVRFKTPLDGVTRWADLVKG
FT                   EISIPNEALDDLIIARSDGSPTYNFCVVVDDYDMGVTHVIRGDDHVNNTPKQINILKAI
FT                   GATLPEYGHLPMILNEQGKKISKRSGDTVAITDFGAMGILPEAMLNYLARLGWAHGDDE
FT                   FFTMEQFIEWFDLKDVSPSPSRMDLKKLYWINGEHIKITPNGKLAELVKPRLALRDIHE
FT                   TEKPALEDVLALVKDRAQDLNTLADECLYFYVKQTPTEADVQKHWDDEAAARMLRFAER
FT                   LEGLEDWNAEAIHDLFKPFCDEEGIKMGKLGMPLRLAVCGTAKTPSVDAVLALIGKEEV
FT                   LKRIRA"
FT   CDS_pept        complement(236355..237011)
FT                   /transl_table=11
FT                   /locus_tag="NMA0251"
FT                   /product="putative periplasmic protein"
FT                   /note="NMA0251, probable periplasmic protein, len: 218 aa;
FT                   some similarity to e.g. TR:O07474 (EMBL:U61158)
FT                   Staphylococcus gallinarum GDMH protein involved in
FT                   antibiotic gallidermin secretion (330 aa), fasta scores;
FT                   E(): 1.5e-06, 29.5% identity in 129 aa overlap, and
FT                   SANA_ECOLI P33017 SANA protein involved in the barrier
FT                   function of the cell envelope (239 aa), fasta scores; E():
FT                   0.00013, 23.6% identity in 212 aa overlap. Contains
FT                   N-terminal signal sequence"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0251"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07557"
FT                   /db_xref="GOA:A0A0U1RH12"
FT                   /db_xref="InterPro:IPR003848"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RH12"
FT                   /protein_id="CAM07557.1"
FT                   /translation="MNKRLFCSRNGLRYYLLGGFCLSVFPFLLVFASSVWAVYRTGGQV
FT                   LPPYVRADAALVLGAAAWDKHPSPVFRERINHAIALYQSRRVGKIVFTGGRTKKGYMTE
FT                   AEVGRRYALKQGVPARNILFENTSRNTYENLNNIRPVLRANGIASVVIVSDPYHLARAA
FT                   EMAEDLGVRVYMSATPTTRFDAGNKKKIFMLQEGYALSLYRLEKWGSRFLGWLSD"
FT   CDS_pept        complement(237008..237361)
FT                   /transl_table=11
FT                   /locus_tag="NMA0252"
FT                   /product="putative oxidoreductase"
FT                   /note="NMA0252, probable oxidoreductase, len: 117 aa;
FT                   similar to YFGD_ECOLI P76569 hypothetical protein (119 aa),
FT                   fasta scores; E(): 1.2e-23, 53.9% identity in 115 aa
FT                   overlap, and to e.g. ARC2_ECOLI P52147 arsenate reductase
FT                   (141 aa), fasta scores; E(): 8.3e-12, 35.9% identity in 117
FT                   aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0252"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07558"
FT                   /db_xref="GOA:P63621"
FT                   /db_xref="InterPro:IPR006659"
FT                   /db_xref="InterPro:IPR006660"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/Swiss-Prot:P63621"
FT                   /protein_id="CAM07558.1"
FT                   /translation="MPEIKIFHNPRCSKSRAALSLLEERGIAAEVVKYLDTPPDLSELK
FT                   DIFNKLGLASARGMMRVKDDLYKELGLDNPNLDNDALLRAIADHPALLERPIVLANGKA
FT                   AVGRPLENIEAVL"
FT   CDS_pept        237485..237967
FT                   /transl_table=11
FT                   /locus_tag="NMA0253"
FT                   /product="putative periplasmic thiredoxin"
FT                   /note="NMA0253, probable periplasmic thiredoxin, len: 160
FT                   aa; similar to e.g. TLPA_BRAJA P43221 thiol:disulfide
FT                   interchange protein TLPA (221 aa), fasta scores; E():
FT                   7.4e-08, 30.7% identity in 153 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0253"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07559"
FT                   /db_xref="GOA:A0A0U1RH13"
FT                   /db_xref="InterPro:IPR013740"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RH13"
FT                   /protein_id="CAM07559.1"
FT                   /translation="MKYLNLAAITLAATFAAHTASADELAGWKDNTPQSLQSLKAPVRI
FT                   VNLWATWCGPCQKEMPAMSKWYKAQKKGSVDMVGIALDTSDNIGNFLKQTPVSYPIWRY
FT                   TEANSRNFMKSYGNNVGVLPFTVVEAPKCGYKQTITGEVNEKSLTEAVKLAHSKCR"
FT   CDS_pept        238162..238812
FT                   /transl_table=11
FT                   /locus_tag="NMA0254"
FT                   /product="ABC transporter ATP-binding protein"
FT                   /note="NMA0254, ftsE, probable ABC transporter ATP-binding
FT                   protein, len: 305 aa; similar to e.g. FTSE_ECOLI P10115
FT                   cell division ATP-binding protein FTSE (222 aa), fasta
FT                   scores; E(): 0, 50.2% identity in 215 aa overlap. Contains
FT                   Pfam match to entry PF00005 ABC_tran, ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0254"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07560"
FT                   /db_xref="GOA:A0A0U1RH14"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005286"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RH14"
FT                   /protein_id="CAM07560.1"
FT                   /translation="MIRFEQVSKTYPGGFEALKNVSFQINKGEMIFIAGHSGSGKSTVL
FT                   KLISGITKPSRGKILFNGQDLGTLSDNQIGFMRQHIGIVFQDHKILYDRNVLQNVILPL
FT                   RIIGYPPRKAEERARIAIEKVGLKGRELDDPVTLSGGEQQRLCIARAVVHQPSLLIADE
FT                   PSANLDRAYALDIMELFKTFHEAGTTVIVAAHDETLMADYGHRILRLSKGRLA"
FT   CDS_pept        238809..239726
FT                   /transl_table=11
FT                   /locus_tag="NMA0255"
FT                   /product="putative ABC transporter integral membrane
FT                   protein"
FT                   /note="NMA0255, ftsX, probable ABC transporter integral
FT                   membrane protein, len: 305 aa; similar to e.g. FTSX_ECOLI
FT                   P10122 cell division protein FTSX (352 aa), fasta scores;
FT                   E(): 2.6e-20, 29.5% identity in 288 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0255"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07561"
FT                   /db_xref="GOA:A0A0U1RH15"
FT                   /db_xref="InterPro:IPR004513"
FT                   /db_xref="InterPro:IPR040690"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RH15"
FT                   /protein_id="CAM07561.1"
FT                   /translation="MSIIHYLSLHVESARTALKQLLRQPFGTLLTLIMLAVAMTLPLFM
FT                   YLGIQSGQSVLGKLNESPQITVYMETAAAQSDSDTVRSLLVRDKRLDNIRFISKEDGLE
FT                   ELQSNLDQNLISMLDGNPLPDVFIVTPDPATTPAQMQAIYRDITKLPMVESANMDTEWV
FT                   QTLYQINEFIRKILWFLSLTLGMAFVLVAHNTIRLQILSRKEEIEITKLLGAPASFIRR
FT                   PFLYQAMWQSILSAAVSLGLCGWLLSAVRPLVDAIFKPYGLNIGWRFFYPGEIALVFGF
FT                   VIALGIFGAWLATTQHLLGFKAKK"
FT   CDS_pept        239818..240066
FT                   /transl_table=11
FT                   /locus_tag="NMA0256"
FT                   /product="hypothetical protein NMA0256"
FT                   /note="NMA0256, unknown, len: 82 aa; similar to
FT                   hypothetical proteins e.g. YV22_SYNY3 P73055 SSR3122 (85
FT                   aa), fasta scores; E(): 1.5e-06, 35.7% identity in 84 aa
FT                   overlap, and YRBA_ECOLI P43781 (84 aa), fasta scores; E():
FT                   6e-06, 31.5% identity in 73 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0256"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07562"
FT                   /db_xref="InterPro:IPR002634"
FT                   /db_xref="InterPro:IPR036065"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RH16"
FT                   /protein_id="CAM07562.1"
FT                   /translation="MLTPEQVKALIAGVAKCEHIEVEGDGHHFFAVIVSSEFEGKARLA
FT                   RHRLIKDGLKAQLESNELHALSISVAATPAEWAAKAQ"
FT   CDS_pept        complement(240133..241311)
FT                   /transl_table=11
FT                   /locus_tag="NMA0257"
FT                   /product="phosphoglycerate kinase"
FT                   /EC_number="2.7.2.3"
FT                   /note="NMA0257, pgk, phosphoglycerate kinase, len: 392 aa;
FT                   similar to many e.g. PGKP_ALCEU P50320 phosphoglycerate
FT                   kinase, plasmid (EC 2.7.2.3) (412 aa), fasta scores; E():
FT                   0, 65.3% identity in 389 aa overlap. Contains Pfam match to
FT                   entry PF00162 PGK, Phosphoglycerate kinases, and PS00111
FT                   Phosphoglycerate kinase signature"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0257"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07563"
FT                   /db_xref="GOA:Q9JWS8"
FT                   /db_xref="InterPro:IPR001576"
FT                   /db_xref="InterPro:IPR015824"
FT                   /db_xref="InterPro:IPR015911"
FT                   /db_xref="InterPro:IPR036043"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9JWS8"
FT                   /protein_id="CAM07563.1"
FT                   /translation="MAFLKLTEQNVQGKTVLIRADMNVPFKDGKISDDTRIRASIASVK
FT                   YCVDNGASVIVMTHLGRPTEGEFHPEDDVAPVAAHLGSLLGKDVKVLNDWRENKPALNA
FT                   GDVVMLQNVRINKGEKKNDLELGKAYASLCDVFVNDAFGTAHRAQASTEAVAQAAPVAC
FT                   AGVLMAGELDALGKALKQPARPMVAIVAGSKVSTKLTILESLADKVDQLIVGGGIANTF
FT                   LLAEGKAIGKSLAEHDLVEESKKIMAKMAAKGGSVPLPTDVVVAKAFAADAEAVVKDIA
FT                   DVAEDDMILDIGPKSAAALADLLKAADTVVWNGPVGVFEFDQFAGGTKALAEAIAQSKA
FT                   FSIAGGGDTLAAIAKFGVTEQIGYISTGGGAFLEFLEGKELPAVAALEKRGA"
FT   CDS_pept        complement(241392..242645)
FT                   /transl_table=11
FT                   /locus_tag="NMA0258"
FT                   /product="UDP-N-acetylglucosamine
FT                   1-carboxyvinyltransferase"
FT                   /EC_number="2.5.1.7"
FT                   /note="NMA0258, murA, UDP-N-acetylglucosamine
FT                   1-carboxyvinyltransferase, len: 417 aa; similar to many
FT                   e.g. MURA_ACICA P33986 UDP-N-acetylglucosamine
FT                   1-carboxyvinyltransferase (EC 2.5.1.7) (419 aa), fasta
FT                   sacores; E(): 0, 60.9% identity in 419 aa overlap. Contains
FT                   Pfam match to entry PF00275 EPSP_syntase, EPSP synthase
FT                   (3-phosphoshikimate 1-carboxyvinyltransferase)"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0258"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07564"
FT                   /db_xref="GOA:Q9JWS7"
FT                   /db_xref="InterPro:IPR001986"
FT                   /db_xref="InterPro:IPR005750"
FT                   /db_xref="InterPro:IPR013792"
FT                   /db_xref="InterPro:IPR036968"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9JWS7"
FT                   /protein_id="CAM07564.1"
FT                   /translation="MDKLKISANGPLNGEITVSGAKNAALPLMCAGLLTSGTLRLKNVP
FT                   MLADVKTTQKLLQGMGARVLTDNISEFEINGGTVNNTCAPYELVRTMRASILVLGPTLA
FT                   RFGEAQVSLPGGCAIGSRPVDQHLKGLEAMGAEIVIEHGYVKAKGKLKGTRVAMDVVTV
FT                   GGTENLLMAATLAEGTTVLENCAIEPEVVDLAECLVKMGAKISGIGTSTMIVEGVDELH
FT                   GCEHSVVPDRIEAGTFLCAVAITGGRVVLRNAAPKTMEVVLDKLVEAGAVIEAGDDWIA
FT                   IDMRQRPKAVDIRTVVHPGFPTDMQAQFMALNAVAEGSCRVVETIFENRFMHVPELNRM
FT                   GANITTEGNTAFVQGVERLSGAVVKATDLRASASLVIAGLAARGETVVEQIYHLDRGYE
FT                   NIEKKLGSVGAKIERVSG"
FT   CDS_pept        complement(243161..244135)
FT                   /transl_table=11
FT                   /locus_tag="NMA0259"
FT                   /product="putative transmembrane transport protein"
FT                   /note="NMA0259, probable transmembrane transport
FT                   protein,len: 324 aa; similar to hypothetical membrane
FT                   proteins e.g. YGJT_ECOLI P42601 (321 aa), fasta scores;
FT                   E(): 0,55.5% identity in 301 aa overlap, and to TERC_ALCSP
FT                   P18780 tellurium resistance protein TERC (346 aa), fasta
FT                   scores; E(): 1.4e-11, 34.8% identity in 345 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0259"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07565"
FT                   /db_xref="GOA:A0A0U1RH17"
FT                   /db_xref="InterPro:IPR005496"
FT                   /db_xref="InterPro:IPR022369"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RH17"
FT                   /protein_id="CAM07565.1"
FT                   /translation="MTEYPGIGSPLFYGVFFAAVLVMIALDMFSLKKNGSHKVGVKEAL
FT                   AWSGLWVAVSCLFAGWLYFELAGNLGYGAAVAKEKVLEFFTGYILEKSLAVDNIFVFLM
FT                   IFGYFKVAPQFQHRVLLYGVLGALVLRTVMIFVGAALVRQFEWILYLFGAFLLYTGIHM
FT                   MKPEGDEKEDLANSRLLNAVKKVVPVGTEFHGEKFFTVENGKKIATPLFLVLVMIELSD
FT                   VVFAVDSIPAVFAVTTDPFIVLTSNIFAILGLRAMYFLLADVAERFIFLKYGLAFVLSF
FT                   IGVKMLVMHWVHIPISVSLSVVFGALGASILTSLIYTKKQPDK"
FT   CDS_pept        complement(244168..244617)
FT                   /transl_table=11
FT                   /locus_tag="NMA0260"
FT                   /product="putative integral membrane protein"
FT                   /note="NMA0260, probable integral membrane protein, len:
FT                   149 aa; similar to TR:O26032 (EMBL:AE000648) Helicabacter
FT                   pylori HP1502 (145 aa), fasta scores; E(): 2.3e-09, 29.5%
FT                   identity in 149 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0260"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07566"
FT                   /db_xref="GOA:A0A0U1RH18"
FT                   /db_xref="InterPro:IPR007418"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RH18"
FT                   /protein_id="CAM07566.1"
FT                   /translation="MSIYAVAHIVHLYCAIAFVGGVFFEVLVLSVLHTGRVSCEARREV
FT                   EKAMSYRAVRVMPFVVGLLFASGIVMAANRYLSILGEPFATSFGTMLTLKILLAFSVLA
FT                   HFAIAVVKMARSTLTVGWSKYIHTVVFTHMLLIVFLAKAMFYISW"
FT   CDS_pept        complement(244658..245929)
FT                   /transl_table=11
FT                   /locus_tag="NMA0261"
FT                   /product="3-deoxy-D-manno-octulosonic-acid transferase"
FT                   /EC_number="2.-.-.-"
FT                   /note="NMA0261, kdtA, probable
FT                   3-deoxy-D-manno-octulosonic-acid transferase, len: 423 aa;
FT                   similar to many e.g. KDTA_ECOLI P23282
FT                   3-deoxy-D-manno-octulosonic-acid transferase (EC 2.-.-.-)
FT                   (KDO transferase) (425 aa), fasta scores; E(): 0, 39.0%
FT                   identity in 420 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0261"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07567"
FT                   /db_xref="GOA:A0A0U1RH19"
FT                   /db_xref="InterPro:IPR007507"
FT                   /db_xref="InterPro:IPR038107"
FT                   /db_xref="InterPro:IPR039901"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RH19"
FT                   /protein_id="CAM07567.1"
FT                   /translation="MFQWLYDVLWLLAPIWIRRYLDKRSGSAPAYRAHRGERFGKPYPN
FT                   PVTGAVWIHAVSVGETRAAQPLIRELRQRFPDAPLLMTQMTPTGRETAQVLFPDAQCRY
FT                   LPYDKKTWVRQFLREHRPMFGILMETEIWPNLMKECRRTGVPLFLANARLSEKSLNGYL
FT                   KVRSLIRPAAASLTGCLAQTEADAARLAKLGAASVQVCGNTKYDLMPSEQMKTLAGQFE
FT                   KRIGDRQVAVCGSTRVYRGEDEAEKLLAAWQQYRGDALLVVVPRHPEHFQTVFETVKRF
FT                   GFKVQRRSDGLPVEPDTQVWIGDSMGELYAYYLCADVAFVGGSLVDSGCQNIIEPLSCG
FT                   VPTIFGFSTYNFSEACRHALASGAAVQVESADAWREAVEKNLSSEEGGMQMQARADGFI
FT                   AQHRGAGARIAEAVREAVCGHRGR"
FT   CDS_pept        complement(245992..247440)
FT                   /transl_table=11
FT                   /locus_tag="NMA0262"
FT                   /product="6-phosphogluconate dehydrogenase,decarboxylating"
FT                   /EC_number="1.1.1.44"
FT                   /note="NMA0262, gnd, 6-phosphogluconate
FT                   dehydrogenase,decarboxylating, len: 482 aa; highly similar
FT                   to many e.g. 6PGD_HAEIN P43774 6-phosphogluconate
FT                   dehydrogenase,decarboxylating (EC 1.1.1.44) (484 aa), fasta
FT                   scores; E(): 0, 81.1% identity in 482 aa overlap. Contains
FT                   Pfam match to entry PF00393 6PGD, 6-phosphogluconate
FT                   dehydrogenases, and PS00461 6-phosphogluconate
FT                   dehydrogenase signature"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0262"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07568"
FT                   /db_xref="GOA:A0A0U1RH20"
FT                   /db_xref="InterPro:IPR006113"
FT                   /db_xref="InterPro:IPR006114"
FT                   /db_xref="InterPro:IPR006115"
FT                   /db_xref="InterPro:IPR006183"
FT                   /db_xref="InterPro:IPR006184"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RH20"
FT                   /protein_id="CAM07568.1"
FT                   /translation="MKGDIGVIGLAVMGQNLILNMNDCGFKVVAYNRTIGKVDEFLNGA
FT                   AKGTGIIGAYSLQDLVDKLAKPRKIMMMVRAGSVVDDFIEQLLPLLEEGDIIIDGGNAN
FT                   YSDTTRRTHYLAGKGILFVGAGVSGGEEGARRGPSIMPGGDKRAWEAVKPIFQAIAAKT
FT                   PQGEPCCDWVGRDGAGHFVKMVHNGIEYGDMQLICEAYQFMKDGLGLSYDEMHRVFAEW
FT                   NKTELDSYLIEITAAILGYKDEGGEPLVEKILDTAGQKGTGKWTGINALDLGIPLTLIS
FT                   EAVFARCVSSFKEQRVQTGKLFARTVTPVEGGKQEWVEALRQTLLASKIISYAQGFMLI
FT                   REAGESYGWDLDYGNTALLWREGCIIRSAFLSNIRDAYENNPDLVFLGTDPYFKNILEN
FT                   CLPAWRKVVAKAVECGIPMPCMASAITFLDGYTTERLPANLLQAQRDYFGAHTYERTDK
FT                   PRGEFFHTNWTGKGGDTASTTYDI"
FT   CDS_pept        complement(248626..249549)
FT                   /transl_table=11
FT                   /locus_tag="NMA0263"
FT                   /product="UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosmine
FT                   deacetylase"
FT                   /EC_number="3.5.1.-"
FT                   /note="NMA0263, lpxC, UDP-3-O-[3-hydroxymyristoyl]
FT                   N-acetylglucosmine deacetylase, len: 307 aa; similar to
FT                   e.g. LPXC_HAEIN P45070 UDP-3-O-[3-hydroxymyristoyl]
FT                   N-acetylglucosmine deacetylase (EC 3.5.1.-) (305 aa),fasta
FT                   scores; E(): 0, 50.7% identity in 296 aa overlap. Contains
FT                   PS00599 Aminotransferases class-II pyridoxal-phosphate
FT                   attachment site"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0263"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07569"
FT                   /db_xref="GOA:Q9JWS2"
FT                   /db_xref="InterPro:IPR004463"
FT                   /db_xref="InterPro:IPR011334"
FT                   /db_xref="InterPro:IPR015870"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9JWS2"
FT                   /protein_id="CAM07569.1"
FT                   /translation="MLQRTLAKSISVTGVGLHSGERVALTLHPAPENSGISFRRTDLDG
FT                   EMGEQIKLTPYLINDTRLSSTIVTDKGVRVGTIEHIMSALSAYGIDNALIELNAPEIPI
FT                   MDGSSLPFIYLLQDAGVVDQKAQKRFLKILKPVEIKEAGKWVRFTPYDGFKVTLTIEFD
FT                   HPVFNRSSPTFEIDFAGKSYIDEIARARTFGFMHEVEMMRAHNLGLGGNLNNAIVIDDT
FT                   DVLNPEGLRYPDEFVRHKILDAIGDLYIVGHPIIGAFEGYKSGHAINNALLRAVLADET
FT                   AYDRVEFADSDDLPDAFHELNIRTCG"
FT   CDS_pept        complement(250476..250988)
FT                   /transl_table=11
FT                   /locus_tag="NMA0264"
FT                   /product="fimbrial protein precursor (pilin)"
FT                   /note="NMA0264, pilE, fimbrial protein precursor
FT                   (pilin),len: 170 aa; highly similar to e.g. FMM1_NEIME
FT                   P05431 fimbrial protein precursor (pilin) (167 aa), fasta
FT                   scores; E(): 0, 85.2% identity in 169 aa overlap. Contains
FT                   Pfam match to entry PF00114 pilin, and PS00409 Prokaryotic
FT                   N-terminal methylation site"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0264"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07570"
FT                   /db_xref="GOA:P57039"
FT                   /db_xref="InterPro:IPR001082"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57039"
FT                   /protein_id="CAM07570.1"
FT                   /translation="MNTLQKGFTLIELMIVIAIVGILAAVALPAYQDYTARAQVSEAIL
FT                   LAEGQKSAVTEYYLNHGEWPSNNTSAGVASSTDIKGKYVQSVEVKNGVVTATMASSNVN
FT                   NEIKGKKLSLWAKRQDGSVKWFCGQPVKRNDTATTNDDVKADTAANGKQIDTKHLPSTC
FT                   RDAASAG"
FT   CDS_pept        complement(252156..252542)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="NMA0265"
FT                   /product="pilin (fragment)"
FT                   /note="NMA0265, pilS1, pilin, partial CDS, len: 128 aa;
FT                   highly similar to e.g. FMM1_NEIME P05431 fimbrial protein
FT                   precursor (pilin) (167 aa), fasta scores; E(): 0, 81.5%
FT                   identity in 119 aa overlap"
FT                   /db_xref="PSEUDO:CAM07571.1"
FT   CDS_pept        complement(252682..253107)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="NMA0266"
FT                   /product="pilin (fragment)"
FT                   /note="NMA0266, pilS2, pilin, partial CDS, len: 141 aa;
FT                   highly similar to e.g. FMM1_NEIME P05431 fimbrial protein
FT                   precursor (pilin) (167 aa), fasta scores; E(): 0, 74.0%
FT                   identity in 127 aa overlap. Contains Pfam match to entry
FT                   PF00114 pilin, Pilins (bacterial filaments)"
FT                   /db_xref="PSEUDO:CAM07572.1"
FT   CDS_pept        complement(253273..253647)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="NMA0267"
FT                   /product="pilin (fragment)"
FT                   /note="NMA0267, pilS3, pilin, partial CDS, len: 124 aa;
FT                   highly similar to e.g. FMM1_NEIME P05431 fimbrial protein
FT                   precursor (pilin) (167 aa), fasta scores; E(): 0, 79.7%
FT                   identity in 118 aa overlap"
FT                   /db_xref="PSEUDO:CAM07573.1"
FT   CDS_pept        complement(254404..254811)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="NMA0268"
FT                   /product="pilin (fragment)"
FT                   /note="NMA0268, pilS4, pilin, partial CDS, len: 135 aa;
FT                   highly similar to e.g. FMM1_NEIME P05431 fimbrial protein
FT                   precursor (pilin) (167 aa), fasta scores; E(): 0, 81.0%
FT                   identity in 121 aa overlap. Contains Pfam match to entry
FT                   PF00114 pilin, Pilins (bacterial filaments)"
FT                   /db_xref="PSEUDO:CAM07574.1"
FT   CDS_pept        complement(255227..255643)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="NMA0269"
FT                   /product="pilin (fragment)"
FT                   /note="NMA0269, pilS5, pilin, partial CDS, len: 138 aa;
FT                   highly similar to e.g. FMM1_NEIME P05431 fimbrial protein
FT                   precursor (pilin) (167 aa), fasta scores; E(): 0, 77.4%
FT                   identity in 124 aa overlap. Contains Pfam match to entry
FT                   PF00114 pilin, Pilins (bacterial filaments)"
FT                   /db_xref="PSEUDO:CAM07575.1"
FT   CDS_pept        complement(255766..256107)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="NMA0270"
FT                   /product="pilin (fragment)"
FT                   /note="NMA0270, pilS6, pilin, partial CDS, len: 113 aa;
FT                   highly similar to e.g. FMD3_NEIGO Q00046 fimbrial protein
FT                   MS11-D3A precursor (L-pilin) (180 aa), fasta scores; E():
FT                   2e-29, 71.7% identity in 113 aa overlap"
FT   CDS_pept        complement(256171..256470)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="NMA0271"
FT                   /product="pilin (fragment)"
FT                   /note="NMA0271, pilS7, pilin, partial CDS, len: 113 aa;
FT                   highly similar to e.g. FMM1_NEIME P05431 fimbrial protein
FT                   precursor (pilin) (167 aa), fasta scores; E():
FT                   9.2e-21,68.5% identity in 89 aa overlap"
FT   CDS_pept        complement(256488..256850)
FT                   /transl_table=11
FT                   /locus_tag="NMA0272"
FT                   /product="truncated pilin"
FT                   /note="NMA0272, pilS8, pilin, partial CDS, len: 113 aa;
FT                   highly similar to e.g. FMD3_NEIGO Q00046 fimbrial protein
FT                   MS11-D3A precursor (L-pilin) (180 aa), fasta scores; E():
FT                   1.3e-16, 63.0% identity in 81 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0272"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07578"
FT                   /db_xref="GOA:A0A0U1RH26"
FT                   /db_xref="InterPro:IPR001082"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RH26"
FT                   /protein_id="CAM07578.1"
FT                   /translation="MASSNVNNEIKDKKLSLWAKRQDGSVKWFCGQPVKRDAATDADVT
FT                   ADSGNEIDTKHLPSTCRDAASAVCTKTPEYYPNHGEWPKNFVIPAQAGIQVCRHGNLSG
FT                   KKVSPVLSSRFPLSWE"
FT   CDS_pept        complement(256879..257208)
FT                   /transl_table=11
FT                   /locus_tag="NMA0273"
FT                   /product="peptidyl-prolyl cis-trans isomerase"
FT                   /EC_number="5.2.1.8"
FT                   /note="NMA0273, fbp, peptidyl-prolyl cis-trans
FT                   isomerase,len: 109aa; almost identical to FKBP_NEIME P25138
FT                   FK506-binding protein (peptidyl-prolyl cis-trans isomerase)
FT                   (PPIASE) (EC 5.2.1.8) (109 aa), fasta scores; E(): 0, 97.2%
FT                   identity in 109 aa overlap. Contains Pfam match to entry
FT                   PF00254 FKBP, FKBP-type peptidyl-prolyl cis-trans
FT                   isomerases, PS00453 FKBP-type peptidyl-prolyl cis-trans
FT                   isomerase signature 1, and PS00454 FKBP-type
FT                   peptidyl-prolyl cis-trans isomerase signature 2. Also
FT                   similar to NMA1756 (45.9% identity in 98 aa overlap)"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0273"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07579"
FT                   /db_xref="GOA:P56989"
FT                   /db_xref="InterPro:IPR001179"
FT                   /db_xref="UniProtKB/Swiss-Prot:P56989"
FT                   /protein_id="CAM07579.1"
FT                   /translation="MGSLIIEDLQEGFGKEAVKGKEITVHYTGWLENGTKFDSSLDRRQ
FT                   PLTITLGVGQVIKGWDEGFGGMKEGGKRKLTIPSEMGYGARGAGGVIPPHATLIFEVEL
FT                   LKVYE"
FT   CDS_pept        complement(join(257289..257369,257523..257657))
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="NMA0273A"
FT                   /product="putative membrane protein (pseudogene)"
FT                   /note="Pseudogene. Similar to Neisseria meningitidis
FT                   hypothetical protein Nmb0028 nmb0028 SWALL:Q9K1Q2
FT                   (EMBL:AE002361) (72 aa) fasta scores: E(): 5.1e-26, 93.05%
FT                   id in 72 aa. Conserved intact in Neisseria meningitidis
FT                   serogroup C and Neisseria meningitidis serogroup B."
FT                   /note="fasta; SWALL:Q9K1Q2 (EMBL:AE002361); Neisseria
FT                   meningitidis; hypothetical protein Nmb0028; nmb0028; length
FT                   72 aa; id=93.05%; ungapped id=93.05%; E()=5.1e-26; ; 72 aa
FT                   overlap; query 1-72 aa; subject 1-72 aa"
FT   CDS_pept        257779..258732
FT                   /transl_table=11
FT                   /locus_tag="NMA0274"
FT                   /product="putative glycerate dehydrogenase"
FT                   /EC_number="1.1.1.29"
FT                   /note="NMA0274, possible glycerate dehydrogenase, len: 322
FT                   aa; similar to DHGY_METEX Q59516 glycerate dehydrogenase
FT                   (EC 1.1.1.29) (313 aa), fasta scores; E(): 0, 47.8%
FT                   identity in 316 aa overlap, and to e.g. SERA_RAT O08651
FT                   D-3-phosphoglycerate dehydrogenase (EC 1.1.1.95) (533
FT                   aa),fasta scores; E(): 2.4e-26, 31.4% identity in 322 aa
FT                   overlap. Contains Pfam match to entry PF00389
FT                   2-Hacid_DH,D-isomer specific 2-hydroxyacid dehydrogenases,
FT                   PS00670 D-isomer specific 2-hydroxyacid dehydrogenases
FT                   signature 2, and PS00671 D-isomer specific 2-hydroxyacid
FT                   dehydrogenases signature 3"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0274"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07581"
FT                   /db_xref="GOA:A0A0U1RH27"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR029753"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RH27"
FT                   /protein_id="CAM07581.1"
FT                   /translation="MNHKKIVVLDADTLPGRVFHFDFPHELAVYGTTGADETAERVRDA
FT                   HIVITNKVMISADIIAANPQLELIAVSATGVNNVDIGAAKAAGVAVCNVRAYGNESVAE
FT                   HAFMLMIALMRNLPAYQRDVAAGLWEKSPFFCHYGAPIRDLNGKTLAVFGRGNIGRTLA
FT                   RYAQAFGMRVVFAEHKHAHAVREGYVSFEDAVQTADVLSLHCPLNAQTENMIGENELRQ
FT                   MKPGAVLINCGRGGLVDENALLAALKYGQIGGAGVDVLTEEPPRGGNPLLNARLPNLIV
FT                   TPHTAWASREALDRLFDILLANIHSFVKGEAQNRVV"
FT   CDS_pept        complement(258807..260864)
FT                   /transl_table=11
FT                   /locus_tag="NMA0275"
FT                   /product="methionyl-tRNA synthetase"
FT                   /EC_number="6.1.1.10"
FT                   /note="NMA0275, metG, methionyl-tRNA synthetase, len: 685
FT                   aa; highly similar to e.g. SYM_ECOLI P00959 methionyl-tRNA
FT                   synthetase (EC 6.1.1.10) (676 aa), fasta scores; E():
FT                   0,57.0% identity in 688 aa overlap. Contains Pfam match to
FT                   entry PF0013 tRNA-synt_1, tRNA synthetases class I (I, L,M
FT                   and V), and PS00178 Aminoacyl-transfer RNA synthetases
FT                   class-I signature"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0275"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07582"
FT                   /db_xref="GOA:Q9JWP0"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002547"
FT                   /db_xref="InterPro:IPR004495"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014758"
FT                   /db_xref="InterPro:IPR015413"
FT                   /db_xref="InterPro:IPR023458"
FT                   /db_xref="InterPro:IPR029038"
FT                   /db_xref="InterPro:IPR033911"
FT                   /db_xref="InterPro:IPR041872"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9JWP0"
FT                   /protein_id="CAM07582.1"
FT                   /translation="MTRKILVTSALPYANGSIHLGHMVEHIQTDVWVRFQKLRGNECHY
FT                   CCADDTHGTPVMLAAQKQGIAPEDMIAKVREEHLADFTGFFIGYDNYYSTHSPENKQFS
FT                   QDIYRALKANGKIESRVIEQLFDPEKQMFLPDRFVKGECPKCHAQDQYGDNCEVCGTTY
FT                   SPTELINPYSAVSGAKPELRESEHFFFKLGECADFLKAWTSGNNPHDGKPHLQAEALNK
FT                   MKEWLGEGEETTLSDWDISRDAPYFGFEIPDAPGKYFYVWLDAPVGYMASFKNLCDRIG
FT                   VDFDEYFKADSQTEMYHFIGKDILYFHALFWPAMLHFSGHRAPTGVYAHGFLTVDGQKM
FT                   SKSRGTFITAKSYLEQGLNPEWMRYYIAAKLNSKIEDIDLNLQDFISRVNSDLVGKYVN
FT                   IAARASGFIAKRFEGRLKDVADSELLAKLTAQSEAIAECYESREYARALRDIMALADIV
FT                   NEYVDANKPWELAKQEGQDARLHEVCSELINAFTMLTAYLAPVLPQTAANAAKFLNLEA
FT                   ITWANTRETLGKHAINKYEHLMQRVEQKQVDDLIEANKQSIQTTPAPAAEESQYEKVAE
FT                   QASFDDFMKIDMRVAKVLNCEAVEGSTKLLKFDLDFGFEKRIIFSGIAASYPNPAELNG
FT                   RMVIAVANFAPRKMAKFGVSEGMILSAATADGKLKLLDVDAGAQPGDKVG"
FT   CDS_pept        complement(260980..262818)
FT                   /transl_table=11
FT                   /locus_tag="NMA0276"
FT                   /product="glucosamine--fructose-6-phosphate
FT                   aminotransferase [isomerizing]"
FT                   /EC_number="2.6.1.16"
FT                   /note="NMA0276, glmS, glucosamine--fructose-6-phosphate
FT                   aminotransferase [isomerizing], len: 612 aa; similar to
FT                   many e.g. GLMS_THIFE Q56275
FT                   glucosamine--fructose-6-phosphate aminotransferase
FT                   [isomerizing] (EC 2.6.1.16) (610 aa), fasta scores; E(): 0,
FT                   62.4% identity in 614 aa overlap. Contains Pfam match to
FT                   entry PF00310 GATase_2, Glutamine amidotransferases
FT                   class-II, and 2x Pfam match to entry PF01380 SIS, SIS
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0276"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07583"
FT                   /db_xref="GOA:Q9JWN9"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR005855"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR035466"
FT                   /db_xref="InterPro:IPR035490"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9JWN9"
FT                   /protein_id="CAM07583.1"
FT                   /translation="MCGIVGAIRAHHNVVDFLTDGLKRLEYRGYDSSGIAVNTDGKIKR
FT                   VRRVGRVQLMEDAAREKGISGGIGIGHTRWATHGGVTEPNAHPHISGGMIAVVHNGIIE
FT                   NFESERKRLEGLGYRFESQTDTEVIAHSINHEYAQNGGKLFEAVQEAVKRFHGAYAIAV
FT                   IAQDKPDELVVARMGCPLLVALGDDETFIASDVSAVIAFTRRVAYLEDGDIALLASDGI
FT                   KRLTDKSGLPAERKVKVSELSLASLELGPYSHFMQKEIHEQPRAIADTAEVFLDGGFIP
FT                   ENFGKNAKSVFESIRSVKILACGTSYYAALTAKYWLESIAKIPSDVEIASEYRYRSVIA
FT                   DPDQLVITISQSGETLDTMEALKYAKSLGHRHSLSICNVMESALPRESSLVLYTRAGAE
FT                   IGVASTKAFTTQLVALFGLAVTLAKVRGLVSEEDEARYTEELRQLPGSVQHALNLEPQI
FT                   AAWAQQFAKKTSALFLGRGIHYPIALEGALKLKEITYIHAEAYPAGELKHGPLALVDEN
FT                   MPVVVIAPNDSLLDKVKANMQEVGARGGELFVFADLDSNFNATEGVHVIRAPRHVGELS
FT                   PVVHTIPVQLLSYHVALARGTDVDKPRNLAKSVTVE"
FT   CDS_pept        263100..263618
FT                   /transl_table=11
FT                   /locus_tag="NMA0277"
FT                   /product="putative lipoprotein"
FT                   /note="NMA0277, probable lipoprotein, len: 172 aa. Contains
FT                   N-terminal signal sequence, and appropriately positioned
FT                   PS00013 Prokaryotic membrane lipoprotein lipid attachment
FT                   site"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0277"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07584"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RH28"
FT                   /protein_id="CAM07584.1"
FT                   /translation="MKQMLLAVGVVAVLAGCGKDAGGYEGYWREKSDKKEGMIAVKKEK
FT                   GNYFLNKINVFTGKEESMLLSEKDGALSINTGIGEIPIKLSDDGKELYVERRQYVKTDA
FT                   AMKDKIIAHQKKCGQTAQAYLDARNALPSNQTYQQHQAAIEQLKRRFEAEFDELEKEIK
FT                   CNGKPTLLF"
FT   CDS_pept        complement(264036..265361)
FT                   /transl_table=11
FT                   /locus_tag="NMA0279"
FT                   /product="putative membrane-bound lytic murein
FT                   transglycosylase"
FT                   /EC_number="3.2.1.-"
FT                   /note="NMA0279, probable membrane-bound lytic murein
FT                   transglycosylase, len: 441 aa; similar to MLTA_ECOLI P46885
FT                   membrane-bound lytic murein transglycosylase A precursor
FT                   (EC 3.2.1.-) (365 aa), fasta scores; E(): 1.4e-16, 27.7%
FT                   identity in 441 aa overlap. Contains N-terminal signal
FT                   sequence, and appropriately positioned PS00013 Prokaryotic
FT                   membrane lipoprotein lipid attachment site"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0279"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07585"
FT                   /db_xref="GOA:A0A0U1RH29"
FT                   /db_xref="InterPro:IPR005300"
FT                   /db_xref="InterPro:IPR010611"
FT                   /db_xref="InterPro:IPR026044"
FT                   /db_xref="InterPro:IPR034654"
FT                   /db_xref="InterPro:IPR036908"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RH29"
FT                   /protein_id="CAM07585.1"
FT                   /translation="MKKYLFRAALCGIAAAILAACQSKSIQTFPQPDTSVINGPDRPVG
FT                   IPDPAGTTVGGGGAVYTVVPHLSLPHWAAQDFAKSLQSFRLGCANLKNRQGWQDVCAQA
FT                   FQTPVHSVQAKQFFERYFTPWQVAGNGSLAGTVTGYYEPVLKGDDRRTAQARFPIYGIP
FT                   DDFISVPLPAGLRSGKALVRIRQTGKNSGTIDNTGGTHTADLSQFPITARTTAIKGRFE
FT                   GSRFLPYHTRNQINGGALDGKAPILGYAEDPVELFFMHIQGSGRLKTPSGKYIRIGYAD
FT                   KNEHPYVSIGRYMADKGYLKLGQTSMQGIKAYMQQNPQRLAEVLGQNPSYIFFRELTGS
FT                   SNDGPVGALGTPLMGEYAGAVDRHYITLGAPLFVATAHPVTRKALNRLIMAQDTGSAIK
FT                   GAVRVDYFWGYGDEAGELAGKQKTTGYVWQLLPNGMKPEYRP"
FT   CDS_pept        265572..266411
FT                   /transl_table=11
FT                   /locus_tag="NMA0280"
FT                   /product="putative integral membrane protein"
FT                   /note="NMA0280, probable integral membrane protein, len:
FT                   279 aa; similar to hypothetical membrane proteins e.g.
FT                   YCDN_ECOLI P75901 (276 aa), fasta scores; E(): 0, 51.5%
FT                   identity in 274 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0280"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07586"
FT                   /db_xref="GOA:A0A0U1RH30"
FT                   /db_xref="InterPro:IPR004923"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RH30"
FT                   /protein_id="CAM07586.1"
FT                   /translation="MLVAFLIMLREGIEAALIVGIVAGFLKQSGHSKLMPKVWFGVVLA
FT                   SLMCLGLGYGIHSATGEIPQKQQEFVVGIIGLVAVAMLTYMILWMKKAARSMKQQLQDS
FT                   VQAALNRGSGQGWALVGMAFLAVAREGLESVFFLLAVFKQSPTWQMPAGAVAGVLAAAV
FT                   IGALIYQGGMRLNLAKFFRWTGAFLIVVAAGLLAGSLRALHEAGIWNALQDIVFDSSKY
FT                   LHEDSPLGVLLGGFFGYTDHPTQGEALVWLLYLIPVMTWFLCGSRPSETLTRKEELK"
FT   CDS_pept        266408..267574
FT                   /transl_table=11
FT                   /locus_tag="NMA0281"
FT                   /product="putative lipoprotein"
FT                   /note="NMA0281, probable lipoprotein, len: 388 aa; similar
FT                   to hypothetical proteins e.g. YCDO_ECOLI P75902 (375
FT                   aa),fasta scores; E(): 0, 62.8% identity in 360 aa overlap.
FT                   Contains N-terminal signals sequence and appropriately
FT                   positioned PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0281"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07587"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR018976"
FT                   /db_xref="InterPro:IPR028096"
FT                   /db_xref="InterPro:IPR034981"
FT                   /db_xref="InterPro:IPR038352"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RH31"
FT                   /protein_id="CAM07587.1"
FT                   /translation="MRKFNLTALSVMLALGLTACQPPEAEKAAPAASGEAQTANEGGSV
FT                   SIAVNDNACEPMELTVPSGQVVFNIKNNSGRKLEWEILKGVMVVDERENIAPGLSDKMT
FT                   VTLLPGEYEMTCGLLTNPRGKLVVTDSGFKDTANEADLEKLSQPLADYKAYVQGEVKEL
FT                   VAKTKTFTEAVKAGDIEKAKSLFADTRVHYERIEPIAELFSELDPVIDAREDDFKDGAK
FT                   DAGFTGFHRIEYALWVEKDVSGVKEIAAKLMTDVEALQKEIDALAFPPGKVVGGASELI
FT                   EEVAGSKISGEEDRYSHTDLSDFQANVDGSKKIVDLFRPLIETKNKALLEKTDTNFKQV
FT                   NEILAKYRTKDGFETYDKLGEADRKALQASINALAEDLAQLRGILGLK"
FT   CDS_pept        267838..269103
FT                   /transl_table=11
FT                   /locus_tag="NMA0282"
FT                   /product="possible periplasmic protein"
FT                   /note="NMA0282, possible periplasmic protein, len: 421 aa;
FT                   similar to e.g. YCDB_ECOLI P31545 hypothetical lipoprotein
FT                   (423 aa), fasta scores; E(): 0, 49.5% identity in 424 aa
FT                   overlap. Contains possible N-terminal signal sequence"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0282"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07588"
FT                   /db_xref="GOA:A0A0U1RH32"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR006313"
FT                   /db_xref="InterPro:IPR006314"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RH32"
FT                   /protein_id="CAM07588.1"
FT                   /translation="MSKNQPAQPTRRTLFKTAIAAGAVGAIGGYLGGKKRGETAERTAE
FT                   SQHSPQAYPCYGEHQAGIVTPQQAFSIMCAFDVTAQSAKQLENLFRTLTARIEFLTQGG
FT                   EYQDGDDKLPPAGSGILGKAFNPDGLTVTVGVGSSLFDGRFGLKDKKPIHLQEMRDFSN
FT                   DKLQKSWCDGDLSLQICAFTPETCQAALRDIIKHTVQTAVIRWSIDGWQPKSEPGAMAA
FT                   RNLLGFRDGTGNPKVSDPKTADEVLWTGVAANSLDEPEWAKNGSYQAVRLIRHFVEFWD
FT                   RTPLQEQTDIFGRRKYSGAPMDGKKEADQPDFAKDPEGNTTPKDSHIRLANPRDPEFLK
FT                   KHRLFRRAYSYSRGLASSGQLDVGLVFVCYQANLADGFIFVQNLLNGEPLEEYISPFGG
FT                   GYFFVLPGVEKGGFLGQGLLGV"
FT   CDS_pept        complement(269175..269504)
FT                   /transl_table=11
FT                   /locus_tag="NMA0283"
FT                   /product="PhnA protein NMB_orthologue"
FT                   /note="NMA0283, phnA, PhnA protein NMB_orthologue, len: 109
FT                   aa; similar to many e.g. PHNA_ECOLI P16680 PHNA protein
FT                   (111 aa), fasta scores; E(): 4.7e-25, 68.2% identity in 110
FT                   aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0283"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07589"
FT                   /db_xref="InterPro:IPR004624"
FT                   /db_xref="InterPro:IPR013987"
FT                   /db_xref="InterPro:IPR013988"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RH33"
FT                   /protein_id="CAM07589.1"
FT                   /translation="MSLPPCPQCASEYTYEDGGQYICPECAHEWNETESAADLAAQVRD
FT                   ANGAALQNGDTVILIKDLKVKGSSMVIKQGTKVKGIRLQEGDHNISCKIDGSAMNLKSE
FT                   FVKKA"
FT   CDS_pept        complement(269581..270951)
FT                   /transl_table=11
FT                   /locus_tag="NMA0284"
FT                   /product="UDP-N-acetylglucosamine pyrophosphorylase"
FT                   /EC_number="2.7.7.23"
FT                   /note="NMA0284, glmU, UDP-N-acetylglucosamine
FT                   pyrophosphorylase, len: 456 aa; similar to amny e.g.
FT                   GLMU_NEIGO Q50986 UDP-N-acetylglucosamine pyrophosphorylase
FT                   (EC 2.7.7.23) (456 aa), fasta scores; E(): 0, 91.7%
FT                   identity in 456 aa overlap. Contains Pfam match to entry
FT                   PF00483 NTP_transferase, Nucleotidyl transferase, and 2x
FT                   Pfam match to entry PF00132 hexapep,Bacterial transferase
FT                   hexapeptide (four repeats)"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0284"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07590"
FT                   /db_xref="GOA:Q9JWN3"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005882"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR025877"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR038009"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9JWN3"
FT                   /protein_id="CAM07590.1"
FT                   /translation="MPQNTLNIVILAAGKGTRMYSKMPKVLHEIGGETMLGRVIDTAAA
FT                   LNPQNICVVVGHGKEQVLDTVKRDVVWVEQTEQLGTGHAVKTALPHLAAEGRTLVLYGD
FT                   VPLIDVETLETLLEAAGNEVGLLTDVPADPSGLGRIIRDSSGSVTAIVEEKDADAAQKA
FT                   VKEINTGILVLPNAKLEAWLNSLSSNNAQGEYYLTDLIAKAVADGIKIHPVQVRSSHLA
FT                   AGVNNKLQLAELERIFQTEQAQELLKAGVTLRDPARFDLRGRLKHGQDVVIDVNCIFEG
FT                   KIELGDNVEIGANCVIKNAKIGANSKIAPFSHLEGCEVGENNQIGPYARLRPQAKLADD
FT                   VHVGNFVEIKNAAIGKGTKANHLTYIGDAEVGSKTNFGAGTIIANYDGVHKHKTVIGDE
FT                   VRIGSNCVLVSPVKIGNKVTTGAGSTITRNVEDGKLALARSRQTIIDGWVRPEKNKQ"
FT   CDS_pept        complement(join(271006..271278,271254..271985))
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="NMA0285"
FT                   /product="possible lipoprotein hydrolase (pseudogene)"
FT                   /note="NMA0285, probable lipoprotein, len: 90 aa; contains
FT                   N-terminal signal sequence and appropriately positioned
FT                   PS00013 Prokaryotic membrane lipoprotein lipid attachment
FT                   site"
FT                   /note="NMA0286, possible hydrolase, len: 243 aa; similar to
FT                   hypothetical proteins e.g. YAI5_SCHPO Q09893
FT                   Schizosaccharomyces pombe SPAC24B11.05 (226 aa), fasta
FT                   scores; E(): 2.4e-10, 26.8% identity in 224 aa overlap.
FT                   Contains Pfam match to entry PF00702 Hydrolase, haloacid
FT                   dehalogenase-like hydrolase"
FT   CDS_pept        272044..273045
FT                   /transl_table=11
FT                   /locus_tag="NMA0287"
FT                   /product="putative thiamin-binding periplasmic protein"
FT                   /note="NMA0287, tbpA, probable thiamin-binding periplasmic
FT                   protein, len: 333 aa; similar to e.g. TBPA_ECOLI P31550
FT                   thiamin-binding periplasmic protein precursor (327
FT                   aa),fasta scores; E(): 3.3e-21, 30.9% identity in 333 aa
FT                   overlap. Contains N-terminal signal sequence"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0287"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07592"
FT                   /db_xref="GOA:A0A0U1RH34"
FT                   /db_xref="InterPro:IPR005948"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RH34"
FT                   /protein_id="CAM07592.1"
FT                   /translation="MKRKIWLLPLLAVSAYLQAQTEVRLAVHKSFSLPKGLIARFERAN
FT                   DAKVSIIQAGGANEMLNKLILSRANPIADAVYGLDNANIGKAREMGILAAAQPESAPVA
FT                   VGLPSALAVDYGYVSINYDKKWFEGKKLPLPQTLQDLTRPEYKNLLVVPSPATSSPGLG
FT                   FLMANISGLGEEGAFKWWAQMRQNGVKVAKGWSEAYYTDFSHNGGAYPLVVGYAASPAA
FT                   EVYFSKGKYSEPPTGNLFLKGGVFRQVEGAAVLKGAKQPKLAAKLVQWLQSREVQQAVP
FT                   SEMWVYPAVKNTRLPDVFRFAQAPTHTTAPAQRDIDANQRGWVSRWIRTVLK"
FT   CDS_pept        273139..273987
FT                   /transl_table=11
FT                   /locus_tag="NMA0288"
FT                   /product="putative integral membrane protein"
FT                   /note="NMA0288, probable integral membrane protein, len:
FT                   282 aa; similar to hypothetical integral membrane proteins
FT                   e.g. YGGB_ECOLI P11666 (286 aa), fasta scores; E():
FT                   7.2e-31, 34.3% identity in 268 aa overlap. Contains Pfam
FT                   match to entry PF00924 UPF0003, Uncharacterized protein
FT                   family UPF0003"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0288"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07593"
FT                   /db_xref="GOA:A0A0U1RH35"
FT                   /db_xref="InterPro:IPR006685"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR011014"
FT                   /db_xref="InterPro:IPR011066"
FT                   /db_xref="InterPro:IPR023408"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RH35"
FT                   /protein_id="CAM07593.1"
FT                   /translation="MDFKQFDFLHLISASGWEHLAEKAWAFGLNLAAALLIFLVGKWAA
FT                   KRIVAVMRAAMTRAQVDATLISFLCNVANIGLLILVIIAALGRLGVSTTSVTALIGGAG
FT                   LAVALSLKDQLSNFAAGALIILFRPFKVGDFIRVGGFEGYVREIKMVQTSLRTTDNEEV
FT                   VLPNSVVMGNSIVNRSTLPLCRAQVIVGVDYNCDLKVAKEAVLKAAVEHPLSVQNEERQ
FT                   AAAYITALGDNAIEITLWAWANEADRWTLQCDLNEQVVENLRKVNINIPFPQRDIHIIN
FT                   S"
FT   CDS_pept        274013..274498
FT                   /transl_table=11
FT                   /locus_tag="NMA0289"
FT                   /product="hypothetical protein NMA0289"
FT                   /note="NMA0289, unknown, len: 161 aa; similar to
FT                   hypothetical proteins e.g. YGAD_ENTAG P51967 (164 aa),fasta
FT                   scores; E(): 3.4e-26, 55.9% identity in 152 aa overlap, and
FT                   to the C-terminus of CINA_STRPN P54184 putative
FT                   competence-damage protein (418 aa), fasta scores; E():
FT                   7e-11, 37.1% identity in 151 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0289"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07594"
FT                   /db_xref="InterPro:IPR008136"
FT                   /db_xref="InterPro:IPR036653"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RH36"
FT                   /protein_id="CAM07594.1"
FT                   /translation="MDALHTIARNLTKKRQTVSCAESCTGGMLAAAFTSVAGSSQWFDQ
FT                   SFVTYSNKAKEDRLGVLPETLLEHGAVSRQTVYEMARGAKAVAQADYAVGISGIAGPGG
FT                   GSESKPVGTVWFGFAFPGGSCEAMRRFDGNRESVRAQAVAFALERLAGLIENGGDAV"
FT   CDS_pept        complement(274600..276168)
FT                   /transl_table=11
FT                   /locus_tag="NMA0290"
FT                   /product="peptide methionine sulfoxide reductase"
FT                   /note="NMA0290, pilB, probable peptide methionine sulfoxide
FT                   reductase, len: 522 aa; almost identical to PMSR_NEIGO
FT                   P14930 peptide methionine sulfoxide reductase (521 aa),
FT                   fasta scores; E(): 0, 88.0% identity in 527 aa overlap, and
FT                   similar in C-terminus to e.g. PMSR_STRPN P35593 peptide
FT                   methionine sulfoxide reductase (312 aa),fasta scores; E():
FT                   4.9e-31, 51.7% identity in 317 aa overlap, and in
FT                   N-terminus to e.g. THIO_STRCO P52230 thioredoxin (110 aa),
FT                   blastp scores; Expect = 0.0028, 30% identity in 107 aa
FT                   overlap"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0290"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07595"
FT                   /db_xref="GOA:Q9JWM8"
FT                   /db_xref="InterPro:IPR002569"
FT                   /db_xref="InterPro:IPR002579"
FT                   /db_xref="InterPro:IPR011057"
FT                   /db_xref="InterPro:IPR013740"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR028427"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036509"
FT                   /db_xref="PDB:2FY6"
FT                   /db_xref="PDB:2JZR"
FT                   /db_xref="PDB:2JZS"
FT                   /db_xref="PDB:2K9F"
FT                   /db_xref="PDB:3BQE"
FT                   /db_xref="PDB:3BQF"
FT                   /db_xref="PDB:3BQG"
FT                   /db_xref="PDB:3BQH"
FT                   /db_xref="PDB:3HCG"
FT                   /db_xref="PDB:3HCH"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9JWM8"
FT                   /protein_id="CAM07595.1"
FT                   /translation="MKHRTFFSLCAKFGCLLALGACSPKIVDAGAATVPHTLSTLKTAD
FT                   NRPASVYLKKDKPTLIKFWASWCPLCLSELGQTEKWAQDAKFSSANLITVASPGFLHEK
FT                   KDGDFQKWYAGLNYPKLPVVTDNGGTIAQSLNISVYPSWALIGKDGDVQRIVKGSINEA
FT                   QALALIRDPNADLGSLKHSFYKPDTQKKDSKIMNTRTIYLAGGCFWGLEAYFQRIDGVV
FT                   DAVSGYANGNTKNPSYEDVSYRHTGHAETVKVTYDADKLSLDDILQYFFRVVDPTSLNK
FT                   QGNDTGTQYRSGVYYTDPAEKAVIAAALKREQQKYQLPLVVENEPLKNFYDAEEYHQDY
FT                   LIKNPNGYCHIDIRKADEPLPGKTKTAPQGKGFDAATYKKPSDAELKRTLTEEQYQVTQ
FT                   NSATEYAFSHEYDHLFKPGIYVDVVSGEPLFSSADKYDSGCGWPSFTRPIDAKSVTEHD
FT                   DFSYNMRRTEVRSHAADSHLGHVFPDGPRDKGGLRYCINGASLKFIPLEQMDAAGYGAL
FT                   KSKVK"
FT   CDS_pept        276314..277579
FT                   /transl_table=11
FT                   /locus_tag="NMA0291"
FT                   /product="probable signal recognition particle protein"
FT                   /note="NMA0291, pilA, ftsY, probable signal recognition
FT                   particle protein, len: 421 aa; almost identical to
FT                   PILA_NEIME O30391 probable signal recognition particle
FT                   protein (421 aa), fasta scores; E(): 0, 97.9% identity in
FT                   421 aa overlap, and highly similar to e.g. FTSY_ECOLI
FT                   P10121 cell division protein FTSY (497 aa), fasta scores;
FT                   E(): 0, 47.6% identity in 412 aa overlap. Contains Pfam
FT                   match to entry PF00448 SRP54, SRP54-type protein, PS00017
FT                   ATP/GTP-binding site motif A (P-loop), and PS00300
FT                   SRP54-type proteins GTP-binding domain signature"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0291"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07596"
FT                   /db_xref="GOA:P57010"
FT                   /db_xref="InterPro:IPR000897"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004390"
FT                   /db_xref="InterPro:IPR013822"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036225"
FT                   /db_xref="InterPro:IPR042101"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57010"
FT                   /protein_id="CAM07596.1"
FT                   /translation="MFSFFRRKKKQETPALEEAQIQETAAKAESETAQVIENIKEDAES
FT                   LAESVKGQVESAVETVSGAVEQVKEAVAEMLSEAEEAAEKAAEQVEAAKEAIAETVGEA
FT                   VGQVQEAVATTEEHKLGWAARLKQGLTKSRDKMAKSLAGVFGGGQIDEDLYEELETVLI
FT                   TSDMGMEATEYLMKDVRDRVSLKGLKDGNELRGALKEALYDLIKPLEKPLVLPETKEPF
FT                   VIMLAGINGAGKTTSIGKLAKYFQAQGKSVLLAAGDTFRAAAREQLQAWGERNNVTVIS
FT                   QTTGDSAAVCFDAVQAAKARGIDIVLADTAGRLPTQLHLMEEIKKVKRVLQKAMPDAPH
FT                   EIIVVLDANIGQNAVNQVKAFDDALGLTGLIVTKLDGTAKGGILAALASDRPVPVRYIG
FT                   VGEGIDDLRPFDARAFVDALLD"
FT   CDS_pept        278168..278452
FT                   /transl_table=11
FT                   /locus_tag="NMA0292"
FT                   /product="hypothetical protein NMA0292"
FT                   /note="NMA0292, unknown, len: aa; almost identical to
FT                   TR:O33368 (EMBL:AJ002423) N. gonorrhoeae hypothetical 11.4
FT                   kd protein (94 aa), fasta scores; E(): 0, 96.8% identity in
FT                   94 aa overlap. Also similar to NMA0011, fasta scores; E():
FT                   5.4e-19; 54.2% identity in 83 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0292"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07597"
FT                   /db_xref="InterPro:IPR000305"
FT                   /db_xref="InterPro:IPR035901"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RH37"
FT                   /protein_id="CAM07597.1"
FT                   /translation="MQPAVYILASQRNGTLYIGVTSDLVQRIYQHREHLIEGFTLRYNV
FT                   TMLVWYELHPTMESAITREKQLKKWNRAWKLQLIEENNVSWQDLWFDII"
FT   CDS_pept        join(279084..279167,279167..282250)
FT                   /transl_table=11
FT                   /locus_tag="NMA0293"
FT                   /product="pseudogene (pilus-associated protein)"
FT                   /note="NMA0293, pilC2, pilus-associated protein,pseudogene,
FT                   len: 30 aa; N-terminus identical to the N-terminus of
FT                   TR:O05925 (EMBL:Y13021) N. meningitidis FAM20 pilC2 (1048
FT                   aa). C-terminus highly similar to the C-terminus of
FT                   TR:O05925 (EMBL:Y13021) N. meningitidis FAM20 pilC2 (6248
FT                   bp), fasta scores; E(): 0, 75.2% identity in 1036 aa
FT                   overlap. Contains a (g)11 tract at aa 27 that, if variable,
FT                   would allow translation as an intact CDS. Also similar to
FT                   NMA0609, pilC1 (intact) (90% identity in 30 aa overlap and
FT                   82.8% identity in 1050 aa overlap). Contains PS00017
FT                   ATP/GTP-binding site motif A (P-loop). Coding sequence has
FT                   been spliced to give intact translation"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0293"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07598"
FT                   /protein_id="CAM07598.1"
FT                   /translation="MNKTWKRQVFRHTALYTAILMFSHTGGGGGQAQAQTQTHKYAIVM
FT                   NAQNLPEVKWGDQYQSLTHKSNEREVIHTSGFGLTKKSISFSFNNTDEVVAEKKDTVVF
FT                   GAATYLPPYGKVSGFDTAKLTERKNALDQIGTTKTGLVGYSYEGSTCSSGGCPTVAYRT
FT                   QFTFGNSSLAKKTNGGGLDIYEDKSRDNSPIYKLKDHPWLGVSFNLGGESSFKPKRQGS
FT                   LVSSFSEDVTQQNGAGSQHKDKNLVYTTDDYKSQNNKNHQDKHHAVAFYLNAKLHLLDK
FT                   KHIKNIVQGKTVNLGILKTRIEPTEAWKRRNSNFFNGSWTYEEKGTVSVKLKLPEVKAG
FT                   RCINKPNPNNNTKVPSPALTAPALWFGPVQNGKAEMYSASVSTYPDSSSSRIFLQNLKR
FT                   KTDTSRPGRYSLATLNKSDIESREPSFTSRQTVIRLDGGVQQIKLDRNNTEVTGFNGND
FT                   GKNDTFGIVSEGSFMPDASEWKKVLLPWTVRAFNDDGRFNTVNKEENNGKPKYSQKYRS
FT                   RNNGKHERNLGDIVNSPIVAVGEYLATSANDGMVHIFKQSGGDKRSYNLKLSYIPGTMP
FT                   RKDIESKDSTLAKELRAFAEKGYVGDRYGVDGGFVLRRITDDQDKQKHFFMFGAMGLGG
FT                   RGAYALDLTKADDNDPTKASLFDVKDNGNNGNNGNNRVELGYTVGTPQIGKTHNGKYAA
FT                   FLASGYATKQIDSGENKTALYVYDLESNNGTLIRKIEVTDGKGGLSSPTLVDKDLDGTV
FT                   DIAYAGDRGGKMYRFDLSGNNPNSWTVRTIFQGTKPITSAPAISQLKDKRVVIFGTGSD
FT                   LSEDDVLSTDEQHIYGIFDNDTNTGTAQEGLGKGLLEQKLSEENKTLFLTDYKRSDGSG
FT                   DKGWVVKLKDGQRVTVKPTVVLRTAFVTIHKYTGNDKCGAETAILGINTADGGKLTKKS
FT                   ARPIVPAANSKVAQYSGDKKTSSGKSIPIGCMEKDGGTVCPNGYVYDKPVNVRYLDEKK
FT                   TDGFSTTADGDAGGSGTFKEGKKPARNNRCFSGKGVRTLLMNDLDSLDITGPTCGMKRI
FT                   SWREIFY"
FT   CDS_pept        complement(283684..287799)
FT                   /transl_table=11
FT                   /locus_tag="NMA0295"
FT                   /product="putative periplasmic protein"
FT                   /note="NMA0295, probable periplasmic protein, len: 1371 aa;
FT                   some similarity to YTFN_ECOLI P39321 hypothetical 136.8 kd
FT                   protein (1259 aa), fasta scores; E(): 2.2e-17,21.6%
FT                   identity in 1403 aa overlap. Contains N-terminal signal
FT                   sequence"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0295"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07599"
FT                   /db_xref="GOA:A0A0U1RH39"
FT                   /db_xref="InterPro:IPR007452"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RH39"
FT                   /protein_id="CAM07599.1"
FT                   /translation="MPSEHRPTPPAKKRRPLLKLSAALLSVLILAVCFLGWLAGTEAGL
FT                   RFGLYQIPSWFGVNISSQNLKGTLLDGFDGDNWSIETEGADLKISRFRFAWKPSELMRR
FT                   SLHITEISAGDIAIVTKPTPPKEERPPLSLPDSIDLPAAVYLDRFETGKISMGKAFDKQ
FT                   TVYLERLDASYRYDRKGHRLDLKAADTPWSSSSGSASVGLKKPFALDTAIYTKGGLEGK
FT                   TIHSTARLSGSLKDVRAELAIDGGNIRLSGKSVIHPFAESLDKTLEEVLVKGFNINPSA
FT                   FVPSLPDAGLNFDLTAIPSFSDGIALEGSLDLENTKAGFADRNGIPVRQVLGSFVIRQD
FT                   GTVHIGNTSVALLGRGGIRLSGKIDTEKDILDLNIGINSVGAEDVLQTAFKGRLDGSIG
FT                   IGGTTASPKISWQLGIGTARTDGSLAIASDPANGQRKLVLDTVNIAAGQGSLTAQGYLE
FT                   LFKDRLLKLDIRSRAFDPSRIDPQLPAGNINGSINLAGELAKEKFTGKMRFLPGTFNGV
FT                   PIAGSADIVYESRHLPRAAVDLRLGRNIIKTDGGFGKKGDRLNLNITAPDLSRFGFGLA
FT                   GSLNVRGHLSGDLDGGIRTFETDLSGAARNLHIGKAADIRSLDFTLKGSPDTSRPIRAD
FT                   IKGSRLSLSGGAEVVDTADLMLDGTGVQHRIRTHAAMTLDGKPFKFDLDASGGINRELT
FT                   RWKGSIGILDIGGAFNLKLQNRMTLEAGAERVAASAANWQAMGGSLNLQHFSWDKKTGI
FT                   SAKGGAHGLHIAELHNFFKPPFEHNLVLNGDWDVAYGRNARGYLNISRQSGDAVLPGGQ
FT                   ALGLNAFSLKTRFQNDRIGILLDGGARFGRINADLDIGNAFGGNMANAPLGGRITASLP
FT                   DLGTLKPFLPAAAQNITGSLNAAAQIGGRVGSPSVNAAVNGSSNYGKINGNITVGQSRS
FT                   FDTAPLGGRLNLTVADAEVFRNFLPVGQTVKGSLNAAVTLGGSIADPHLGGSINGDKLY
FT                   YRNQTQGIILDNGSLRSHIAGRKWVIDSLKFRHEGTAELSGTVGMENSGPDVDIGAVFD
FT                   KYRILSRPNRRLTVSGNTRLRYSPQKGISVTGMIKTDQGLFGSQKSSMPSVGDDVVVLG
FT                   EVKKEAAAPLPVNMNLTLDLNDGIRFAGYGADVTIGGKLTLTAQSGGSVRGVGTVRVIK
FT                   GRYKAYGQDLDITKGTVSFVGPLNDPNLNIRAERRLSPVGAGVEILGSLNSPRITLTAN
FT                   EPMSEKDKLSWLILNRAGSGSSGDNAALSAAAGALLAGQINDRIGLVDDLGFTSKRSRN
FT                   AQTGELNPAEQVLTVGKQLTGKLYIGYEYSISSAEQSVKLIYRLTRAIQAVARIGSRSS
FT                   GGELTYTIRFDRFSGSDKKDSAGNSKGK"
FT   CDS_pept        complement(287908..289755)
FT                   /transl_table=11
FT                   /locus_tag="NMA0296"
FT                   /product="putative outer membrane protein"
FT                   /note="NMA0296, probable outer membrane protein, len: 615
FT                   aa; some similarity to e.g. YTFM_ECOLI P39320 hypothetical
FT                   protein (577 aa), fasta scores; E(): 2.3e-20, 23.4%
FT                   identity in 569 aa overlap, and to TR:P95359 (EMBL:U81959)
FT                   N. gonorrhoeae outer membrane protein omp85 (792 aa),fasta
FT                   scores; E(): 0.0031, 23.2% identity in 595 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0296"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07600"
FT                   /db_xref="GOA:A0A0U1RH40"
FT                   /db_xref="InterPro:IPR000184"
FT                   /db_xref="InterPro:IPR010827"
FT                   /db_xref="InterPro:IPR023707"
FT                   /db_xref="InterPro:IPR035243"
FT                   /db_xref="InterPro:IPR039910"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RH40"
FT                   /protein_id="CAM07600.1"
FT                   /translation="MHDTRTMMIKPTALLLPALFFFPHAYAPAADLSENKAAGFALFKN
FT                   KSPDTESVKLKPKFPVRIDTQDSEIKDMVEEHLPLITQQQEEVLDKEQTGFLAEEAPDN
FT                   VKTMLRSKGYFSSKVSLTEKDGAYTVHITPGPRTKIANVGVAILGDILSDGNLAEYYRN
FT                   ALENWQQPVGSDFDQDSWENSKTSVLGAVTRKAYPLAKLGNTRAAVNPDTATADLNVVV
FT                   DSGRPIAFGDFEITGTQRYPEQIVSGLARFQPGTPYDLDLLLDFQQALEQNGHYSGASV
FT                   QADFDRLQGDRVPVKVSVTEVKRHKLETGIRLDSEYGLGGKIAYDYYNLFNKGYIGSVV
FT                   WDMDKYETTLAAGISQPRNYRGNYWTSNVSYNRSTTQNLEKRAFSGGIWYVRDRAGIDA
FT                   RLGAEFLAEGRKIPGSDIDLGNSHATMLTASWKRQLLNNVLHPENGHYLDGKIGTTLGA
FT                   FLSSTALIRTSARAGYFFTPENKKLGTFIIRGQAGYTVARDNANVPSGLMFRSGGASSV
FT                   RGYELDSIGLAGPNGSVLPERALLVGSLEYQLPFTRTLSGAVFHDMGDAAANFKRMKLK
FT                   HGSGLGVRWFSPLAPFSFDIAYGHSDKKIRWHISLGTRF"
FT   CDS_pept        290320..291549
FT                   /transl_table=11
FT                   /locus_tag="NMA0298"
FT                   /product="putative symport protein"
FT                   /note="NMA0298, probable symport protein, len: aa; similar
FT                   to e.g. YGJU_ECOLI P42602 (414 aa), fasta scores; E():
FT                   0,68.0% identity in 394 aa overlap, and SATT_MOUSE O35874
FT                   neutral amino acid transporter A (532 aa), fasta scores;
FT                   E(): 2.1e-16, 26.2% identity in 412 aa overlap. Contains
FT                   Pfam match to entry PF00375 SDF, Sodium:dicarboxylate
FT                   symporter family"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0298"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07601"
FT                   /db_xref="GOA:A1IPD7"
FT                   /db_xref="InterPro:IPR001991"
FT                   /db_xref="InterPro:IPR023025"
FT                   /db_xref="InterPro:IPR036458"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1IPD7"
FT                   /protein_id="CAM07601.1"
FT                   /translation="MAFGKSLFHAIGRVSLVRQIAAGLALGIVIGSVSPQLGLAAGLFG
FT                   SLFVGALKAVAPVLVFILVAATIAQHQKGNKAHIRPIIVLYLIGTFSAALTAVIAGMVF
FT                   PTHIVLAGAGDVSAAPPSGIVEVLKSLLMNLVANPINAIANANYIGILAWALVLGAALR
FT                   NHGSDVTRQVVADLAEAVSTVVKWIIRFAPLGIFGLVSSTIAETGFGALAGYAKLLAVL
FT                   LGCMVFIALVVNPAIVWWKIRRNPYPLVFTCLRESGVYAFFTRSSAANIPVNMALAKKL
FT                   GLHEDTYSISIPLGATVNMGGAAITITVLAMAAAYTQGIQVDFATALLLSLVATVSACG
FT                   ASGVAGGSLLLIPLACSLFGISNDVAMQVVAVGFIIGVIQDSAETALNSSTDVLFTAAA
FT                   DLGRQRNRAE"
FT   CDS_pept        291661..293154
FT                   /transl_table=11
FT                   /locus_tag="NMA0299"
FT                   /product="putative periplasmic protein"
FT                   /note="NMA0299, probable periplasmic protein, len: 497 aa;
FT                   contains N-terminal signal sequence"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0299"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07602"
FT                   /db_xref="InterPro:IPR001677"
FT                   /db_xref="InterPro:IPR011250"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RH41"
FT                   /protein_id="CAM07602.1"
FT                   /translation="MFKRSVIAMACIVALSACGGGGGGSPDVKSADTLSKPAAPVVTED
FT                   VGEEVLPKEKKDEEAVSGAPQADTQDATAGKGGQDMAAVSAENTGNGGAATTDNPENKD
FT                   EGPQNDMPQNAADTDSSTPNHTPAPNMPTRDMGNQAPDAGESAQPANQPDMANAADGMQ
FT                   GDDPSAGENAGNTADQAANQAENNQVGGSQNPASSTNPNATNGGSDFGRINVANGIKLD
FT                   SGSENVTLTHCKDKVCDRDFLDEEAPPKSEFEKLSDEEKINKYKKDEQRENFVGLVADR
FT                   VEKNGTNKYVIIYKDKSASSSSARFRRSARSRRSLPAEMPLIPVNQADTLIVDGEAVSL
FT                   TGHSGNIFAPEGNYRYLTYGAEKLSGGSYALSVQGEPAKGEMLAGTAVYNGEVLHFHME
FT                   NGRPSPSGGRFAAKVDFGSKSVDGIIDSGDDLHMGTQKFKAVIDGNGFKGTWTENGGGD
FT                   VSGRFYGPAGEEVAGKYSYRPTDAEKGGFGVFAGKKEQD"
FT   CDS_pept        complement(293229..293444)
FT                   /transl_table=11
FT                   /locus_tag="NMA0300"
FT                   /product="putative integral membrane protein"
FT                   /note="NMA0300, probable integral membrane protein, len: 71
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0300"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07603"
FT                   /db_xref="GOA:A0A0U1RH42"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RH42"
FT                   /protein_id="CAM07603.1"
FT                   /translation="MFKLGVYACLGLFAGWVLLLIVQLWFSFLKAELFFKITLTMAGLF
FT                   VIILAALLVFGQYFSEKKMKDDGFIN"
FT   CDS_pept        complement(293437..293652)
FT                   /transl_table=11
FT                   /locus_tag="NMA0301"
FT                   /product="hypothetical protein NMA0301"
FT                   /note="NMA0301, unknonwn, len: 71 aa"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0301"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07604"
FT                   /db_xref="InterPro:IPR025234"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RH43"
FT                   /protein_id="CAM07604.1"
FT                   /translation="MKEYKVIIYQESLLSSLFFGAAKVNPIKFSEFLNKQTPEGWRVVT
FT                   MEKDLRRMLLFFKREAYVVILERDRV"
FT   CDS_pept        complement(293859..295202)
FT                   /transl_table=11
FT                   /locus_tag="NMA0303"
FT                   /product="argininosuccinate synthase"
FT                   /EC_number="6.3.4.5"
FT                   /note="NMA0303, argG, argininosuccinate synthase, len: 447
FT                   aa; highly similar to many e.g. ASSY_HAEIN P44315
FT                   argininosuccinate synthase (EC 6.3.4.5) (444 aa), fasta
FT                   scores; E(): 0, 87.1% identity in 443 aa overlap. Contains
FT                   Pfam match to entry PF00764 Arginosuc_synth,Arginosuccinate
FT                   synthase"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0303"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07605"
FT                   /db_xref="GOA:Q9JWM1"
FT                   /db_xref="InterPro:IPR001518"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR018223"
FT                   /db_xref="InterPro:IPR023437"
FT                   /db_xref="InterPro:IPR024073"
FT                   /db_xref="InterPro:IPR024074"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9JWM1"
FT                   /protein_id="CAM07605.1"
FT                   /translation="MNQNHTILQNLPVGQKVGIAFSGGLDTSAALLWMKLKGALPYAYT
FT                   ANLGQPDEDDYNAIPKKAMEYGAENARLIDCRAQLAHEGIAAIQCGAFHVSTGGIAYFN
FT                   TTPLGRAVTGTMLVSAMKEDDVNIWGDGSTYKGNDIERFYRYGLLTNPALKIYKPWLDQ
FT                   QFIDELGGRHEMSEFLIANGFNYKMSVEKAYSTDSNMLGATHEAKDLEFLNSGIKIVKP
FT                   IMGIAFWDENVEIKPEEVSVRFEEGVPVALNGKEYADPVELFLEANRIGGRHGLGMSDQ
FT                   IENRIIEAKSRGIYEAPGMALFHIAYERLVTGIHNEDTIEQYRINGLRLGRLLYQGRWF
FT                   DSQALMLRETAQRWVAKAITGEVTLELRRGNDYSILNTESPNLTYQPERLSMEKVEDAA
FT                   FTPLDRIGQLTMRNLDITDTRAKLGIYSQSGLLALGEGSVLPQLGNKQ"
FT   CDS_pept        295327..296127
FT                   /transl_table=11
FT                   /locus_tag="NMA0304"
FT                   /product="hypothetical protein NMA0304"
FT                   /note="NMA0304, unknown, len: 266 aa; similar to
FT                   hypothetical proteins e.g. TR:AAD42399 (EMBL:AF157493)
FT                   Zymomonas mobilis hypothetical competence-damage protein
FT                   ZM10ORF4 (253 aa), fasta scores; E(): 8.4e-12, 31.1%
FT                   identity in 209 aa overlap, and weakly simar to the
FT                   N-terminus of e.g. CINA_BACSU P46323 putative
FT                   competence-damage protein (416 aa), fasta scores; E():
FT                   0.00012, 25.6% identity in 254 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0304"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07606"
FT                   /db_xref="InterPro:IPR001453"
FT                   /db_xref="InterPro:IPR036425"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RH44"
FT                   /protein_id="CAM07606.1"
FT                   /translation="MNAFNLIIIGDEILHGSRQDKHFVFFKSLLESKGLKLNQVQYLPD
FT                   EPDLLVKQLRRSFSDGMPTFVTGGIGATPDDHTRQAAAAALDLPVVRHAQAAGFIEGVT
FT                   LKRGEPLDSPEHAQRLKMADFPQGAELVPNPFNNIAGFSIREHYFFPGFPVMAHPMAEW
FT                   VLDTYYAGRFNQTQRGSRSVYVFEQPESRITPIMEHIEQTYLGVRSYSLPSVGWTHSDG
FT                   TQVKPHIEFGIKAEGEAVNLLDAAWAEVLHSLEGLGAELKNRVN"
FT   CDS_pept        296167..297153
FT                   /transl_table=11
FT                   /locus_tag="NMA0305"
FT                   /product="putative protease"
FT                   /note="NMA0305, probable protease, len: 328 aa; similar to
FT                   part of e.g. SPPA_SYNY3 P73689 protease IV homolog (610
FT                   aa), fasta scores; E(): 1.4e-14, 32.7% identity in 211 aa
FT                   overlap, and SPPA_ECOLI P08395 protease IV (618 aa), fasta
FT                   scores; E(): 2.5e-10, 29.2% identity in 271 aa overlap.
FT                   Contains Pfam match to entry PF01343 Peptidase_U7,Peptidase
FT                   family U7"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0305"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07607"
FT                   /db_xref="GOA:A0A0U1RH45"
FT                   /db_xref="InterPro:IPR002142"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RH45"
FT                   /protein_id="CAM07607.1"
FT                   /translation="MQYRIRRENEAPEAKNAGETLWERDMMREVLLSAYRDRRRERMWK
FT                   NIWRAVSTLILVALIAGIFRKDEAALQLAGNTPHTAVVNLYGEIGNGVEDQVKKLKDGM
FT                   EAAYKNPQAKAIVIRANSPGGSPVVSNTAFEEIRRLKAQHPGIPVYLVAEDMCASGCYY
FT                   IAAAADKIYADPSSIVGSIGVIGSSFDATGLMEKIGVKRRVKIAGSNKGMGDPFSPETP
FT                   EQSKIWEEMLTGIHGEFIKAVKTGRGGRLKFRQYPDVFSGRVYTGADALKVGLVDGLGN
FT                   IYSVARDVVKAPDVVDYTPKDDFGRILGRRFGAELKASVREALQAVR"
FT   misc_feature    complement(297154..306931)
FT                   /note="label:maf1_nma"
FT   CDS_pept        join(297515..297727,297810..298043)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="NMA0306"
FT                   /product="pseudogene (probable IS1016 transposase)"
FT                   /product="pseudogene (transposase remnant)"
FT                   /note="NMA0306, probable transposase IS1016 remnant, len:
FT                   231 bp; similar to e.g. TR:Q9ZIX7 (EMBL:AF007429)
FT                   Haemophilus gallinarum putative transposase (216 aa),fasta
FT                   scores; E(): 7.5e-30, 87.5% identity in 72 aa overlap"
FT                   /note="NMA0305A, probable transposase remnant, len: 213 bp;
FT                   similar to e.g. TR:O86023 (EMBL:AF079817) Clavibacter
FT                   michiganensis Plasmid pCS1 putative transposase (320
FT                   aa),fasta scores; E(): 0.00042, 40.6% identity in 64 aa
FT                   overlap"
FT   CDS_pept        complement(298110..298484)
FT                   /transl_table=11
FT                   /locus_tag="NMA0307"
FT                   /product="hypothetical protein NMA0307"
FT                   /note="NMA0307, unknown, len: 124 aa; similar to upstream
FT                   gene NMA0320 (45.6% identity in 125 aa overlap)"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0307"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07609"
FT                   /db_xref="InterPro:IPR037883"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RH46"
FT                   /protein_id="CAM07609.1"
FT                   /translation="MIIQNEFNLYPSNMLPERFCYPEKYVRISNDTSLIPYIQPHNFHW
FT                   WFENYGTEGAEVAYIFRNSILPDLNLIPFASNGEWEAYFDGNDVTGNPRVIVINLDNIE
FT                   NHEFFNSFEEWLELAIKDTW"
FT   CDS_pept        complement(298481..298609)
FT                   /transl_table=11
FT                   /locus_tag="NMA0307A"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0307A"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07610"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RH47"
FT                   /protein_id="CAM07610.1"
FT                   /translation="MPQTWGEAIQFRIKKQIENELAPPNWSTQFPNGSIYDPKVTK"
FT   CDS_pept        complement(298657..299013)
FT                   /transl_table=11
FT                   /locus_tag="NMA0308"
FT                   /product="hypothetical protein NMA0308"
FT                   /note="NMA0308, unknown, len: 118 aa"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0308"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07611"
FT                   /db_xref="InterPro:IPR031891"
FT                   /db_xref="InterPro:IPR038223"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RH48"
FT                   /protein_id="CAM07611.1"
FT                   /translation="MNEHNLLIFCLKDNVSISEYTEMIDWAYKNIQSETVVEITENQII
FT                   EYQNRGLWRLVSEITDNWLFGPSEGDWLIDKESILAVKEKLQNSDFSTESLVKNIIHAL
FT                   EYAIKNEKTVIFHF"
FT   CDS_pept        complement(299018..299155)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="NMA0309"
FT                   /product="putative mafB alternative C-terminus (fragment)"
FT                   /note="NMA0309, mafB', possible MAFB alternative
FT                   C-terminus, partial CDS, len: 45 aa; contains a region of
FT                   high similarity to TR:AAD31039 (EMBL:AF142582) Neisseria
FT                   gonorrhoeae MS11 adhesin MAFB (509 aa), fasta scores; E():
FT                   0.00016, 75.0% identity in 24 aa overlap. Also similar in
FT                   part to NMA0324, mafB (83.3% identity in 24 aa overlap)"
FT   CDS_pept        complement(299156..299500)
FT                   /transl_table=11
FT                   /locus_tag="NMA0310"
FT                   /product="hypothetical protein NMA0310"
FT                   /note="NMA0310, unknown, len: 114 aa"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0310"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07613"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RH49"
FT                   /protein_id="CAM07613.1"
FT                   /translation="MNLENYENILIKLLFYHNNLVNEYSYFIENKNLFKIVSRTKTSKG
FT                   FFFTIEKPLNFLSKKTYFEFNFKYLHSGKERFGSFMCWINTNLMEFEGVFFNDLLPDNM
FT                   IINNFFEIND"
FT   CDS_pept        complement(299659..300060)
FT                   /transl_table=11
FT                   /locus_tag="NMA0311"
FT                   /product="hypothetical protein NMA0311"
FT                   /note="NMA0311, unknown, len: 133 aa; similar to NMA2120
FT                   (32.8% identity in 128 aa overlap)"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0311"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07614"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RH50"
FT                   /protein_id="CAM07614.1"
FT                   /translation="MKLKSLDFPTGYFYFDNAAINSDKVEVIAVGYRNTDKTIKIFIED
FT                   VIHFRVVDESYFIDTFMDLISEDADRALLHENGGQSFFELLDECYAEWILKESYFPLNR
FT                   EFFKYYIFMFEQTFIEIIGSSATYSIIEG"
FT   CDS_pept        complement(join(300064..300270,300275..300787))
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="NMA0312"
FT                   /product="putative MafB alternative C-terminus (fragment)"
FT                   /note="NMA0312, unknown, len: 68 aa"
FT                   /note="NMA0313, mafB', possible MAFB alternative
FT                   C-terminus, partial CDS, len: 170 aa; contains a region of
FT                   high similarity to TR:AAD31039 (EMBL:AF142582) Neisseria
FT                   gonorrhoeae MS11 adhesin MAFB (509 aa), fasta scores; E():
FT                   3.4e-30, 64.1% identity in 156 aa overlap. Also similar in
FT                   part to NMA0324, mafB (89.9% identity in 99 aa overlap)"
FT   CDS_pept        complement(300863..301180)
FT                   /transl_table=11
FT                   /locus_tag="NMA0314"
FT                   /product="hypothetical protein NMA0314"
FT                   /note="NMA0314, unknown, len: 105 aa"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0314"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07616"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RH51"
FT                   /protein_id="CAM07616.1"
FT                   /translation="MKKNIFHNVSLYEIIFSDNGNTLTLSFTDTIEGNYFGYIKCSNIL
FT                   NFKLDTNNFVDYEDKEDSLFPLFIPEIELYKYQFYSEIIIDVGIIIKISAETINFEPLG
FT                   K"
FT   CDS_pept        complement(301177..301773)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="NMA0315"
FT                   /product="putative MafB alternative C-terminus (fragment)"
FT                   /note="NMA0315, mafB', possible MAFB alternative
FT                   C-terminus, partial CDS, len: 198 aa; contains a region of
FT                   high similarity to TR:AAD31039 (EMBL:AF142582) Neisseria
FT                   gonorrhoeae MS11 adhesin MAFB (509 aa), fasta scores; E():
FT                   0, 62.0% identity in 184 aa overlap. Also similar in part
FT                   to NMA0324, mafB (79.3% identity in 135 aa overlap)"
FT   CDS_pept        complement(301872..302174)
FT                   /transl_table=11
FT                   /locus_tag="NMA0316"
FT                   /product="hypothetical protein NMA0316"
FT                   /note="NMA0316, unknown, len 100 aa"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0316"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07618"
FT                   /db_xref="InterPro:IPR029080"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RH52"
FT                   /protein_id="CAM07618.1"
FT                   /translation="MLNEIFEIYSRQGESLIGIGIREAALPVPIAIDILNLFINERILV
FT                   LGGDIYIKKDNYFYQTYDNWYYEGSNLFNSIDKAMHYLSQIKLENAYVSFVLKFI"
FT   CDS_pept        complement(302197..302466)
FT                   /transl_table=11
FT                   /locus_tag="NMA0317"
FT                   /product="hypothetical protein NMA0317"
FT                   /note="NMA0317, unknown, len: 89 aa"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0317"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07619"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RH53"
FT                   /protein_id="CAM07619.1"
FT                   /translation="MMTESHGYLSNNLPVKIINDIIYATQLVEDLVLGKIKIVDFLKSY
FT                   NNFYCWLGFDELPQSEKIKFLSYLNILSIHKEIQDETVNRVYTD"
FT   CDS_pept        complement(302487..302693)
FT                   /transl_table=11
FT                   /locus_tag="NMA0318"
FT                   /product="hypothetical protein NMA0318"
FT                   /note="NMA0318, unknown, len: 68 aa"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0318"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07620"
FT                   /db_xref="InterPro:IPR025983"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RH54"
FT                   /protein_id="CAM07620.1"
FT                   /translation="MMENSKKTWEIDGEIWLHCPVCGTEVMDYDICDVCQWQNTGETNI
FT                   DGGPNEMTLAEAKEAYAKGLPIR"
FT   CDS_pept        complement(302659..303414)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="NMA0319"
FT                   /product="putative MafB alternative C-terminus (fragment)"
FT                   /note="NMA0319, mafB', possible MAFB alternative
FT                   C-terminus, partial CDS, len: 251 aa; highly similar to the
FT                   C-terminus of TR:AAD31039 (EMBL:AF142582) Neisseria
FT                   gonorrhoeae MS11 adhesin MAFB (509 aa), fasta scores; E():
FT                   0, 92.8% identity in 251 aa overlap. Also highly similar to
FT                   part of NMA0324, mafB (79.3% identity in 135 aa overlap)"
FT   CDS_pept        complement(303514..303885)
FT                   /transl_table=11
FT                   /locus_tag="NMA0320"
FT                   /product="hypothetical protein NMA0320"
FT                   /note="NMA0320, unknown, len: 123 aa. Similar to NMA0307
FT                   (45.6% identity in 125 aa overlap)"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0320"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07622"
FT                   /db_xref="InterPro:IPR018958"
FT                   /db_xref="InterPro:IPR037883"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RH55"
FT                   /protein_id="CAM07622.1"
FT                   /translation="MIKQNSFVPYPEAMLPKGFKYPQSYLKLAQSTHAINYDEQYSFPW
FT                   WFENAESNISEVIDIYFEITGIPNLLPFARNQEWAACFDISDKSGNPKIIVVNLDNTKY
FT                   YETFENFDTWLKEAENDGW"
FT   CDS_pept        complement(303882..304088)
FT                   /transl_table=11
FT                   /locus_tag="NMA0321"
FT                   /product="hypothetical protein NMA0321"
FT                   /note="NMA0321, unknown, len: 68 aa"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0321"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07623"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RH56"
FT                   /protein_id="CAM07623.1"
FT                   /translation="MEANVHNFNDRLSSKERIRFKHDGIEPQTWGEAIQLRIRKQETQK
FT                   GVPEGWSKRFPNGSIYDVKVLRK"
FT   CDS_pept        complement(304091..304252)
FT                   /transl_table=11
FT                   /locus_tag="NMA0322"
FT                   /product="hypothetical protein NMA0322"
FT                   /note="NMA0322, unknown, len: 53 aa"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0322"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07624"
FT                   /db_xref="GOA:A0A0U1RH57"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RH57"
FT                   /protein_id="CAM07624.1"
FT                   /translation="MSEPSANYNYDSIVAEMKEKNHGLATGLMLLICLMEHLLVWITRV
FT                   LWQHVKQE"
FT   CDS_pept        complement(304265..304471)
FT                   /transl_table=11
FT                   /locus_tag="NMA0323"
FT                   /product="hypothetical protein NMA0323"
FT                   /note="NMA0323, unknown, len: 68 aa. Similar to NMA0024
FT                   (46.4% identity in 69 aa overlap)"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0323"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07625"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RH58"
FT                   /protein_id="CAM07625.1"
FT                   /translation="MNILSINNQNSTISLTQDEVFVLRAILNEIYAGVCVDSREFENVS
FT                   GVRKHEVDNLQQQFAGIYKKMTT"
FT   CDS_pept        complement(304481..305929)
FT                   /transl_table=11
FT                   /locus_tag="NMA0324"
FT                   /product="adhesin"
FT                   /note="NMA0324, mafB, adhesin, len: 492 aa; almost
FT                   identical to TR:AAD31039 (EMBL:AF142582) Neisseria
FT                   gonorrhoeae MS11 adhesin MAFB (509 aa), fasta scores; E():
FT                   0, 72.6% identity in 503 aa overlap, but varying in the
FT                   C-terminus. An identical sequence to the C-terminus is
FT                   present in NMA0319 (mafB'). NMA0319, NMA0315, NMA0313 and
FT                   NMA0309 contain perfect direct repeats from this gene, and
FT                   may represent alternative C-termini. Contains N-terminal
FT                   signal sequence. Also similar to NMA2113 (31.4% identity in
FT                   500 aa overlap), and NMA0853 (33.5% identity in 376 aa
FT                   overlap)"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0324"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07626"
FT                   /db_xref="InterPro:IPR008106"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RH59"
FT                   /protein_id="CAM07626.1"
FT                   /translation="MNLPIQKFMMLFAAAISLLQIPISHANGLDARLRDDMQAKHYEPG
FT                   GKYHLFGNARGSVKNRVYAVQTFDATAVGPILPITHERTGFEGIIGYETHFSGHGHEVH
FT                   SPFDNHDSKSTSDFSGGVDGGFTVYQLHRTGSEIHPEDGYDGPQGSDYPPPGGARDIYS
FT                   YYVKGTSTKTKSNIVPRAPFSDRWLKENAGAASGFFSRADEAGKLIWESDPNKNWWANR
FT                   MDDIRGIVQGAVNPFLMGFQGVGIGAITDSAVSPVTDTAAQQTLQGINHLGNLSPEAQL
FT                   AAATALQDSAFAVKDGINSARQWADAHPNITATAQTALAVAEAATTVWGGKKVELNPTK
FT                   WDWVKNTGYKTPAVRTMHTLDGEMAGGNRPPKSITSNSKADASTQPSLQAQLIGEQISS
FT                   GHAYNKHVIRQQEFTDLNINSPADFARHIENIVSHPTNMKELPRGRTAYWDDKTGTIVI
FT                   RDKNSDDGGTAFRPTSGKKYYDDL"
FT   CDS_pept        complement(305969..306931)
FT                   /transl_table=11
FT                   /locus_tag="NMA0325"
FT                   /product="adhesin"
FT                   /note="NMA0325, mafA, adhesin, len: 320 aa; almost
FT                   identical to TR:AAD31038 (EMBL:AF142582) Neisseria
FT                   gonorrhoeae MS11 adhesin MAFA (320 aa), fastaa scores; E():
FT                   0, 98.4% identity in 320 aa overlap. Contains N-terminal
FT                   signal sequence and appropriately positioned PS00013
FT                   Prokaryotic membrane lipoprotein lipid attachment site"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0325"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07627"
FT                   /db_xref="GOA:A1IPF8"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1IPF8"
FT                   /protein_id="CAM07627.1"
FT                   /translation="MQARLLIPILFSVFILSACGTLTGIPSHGGGKRFAVEQELVAASA
FT                   RAAVKDMDLQALHGRKVALYIATMGDQGSGSLTGGRYSIDALIRGEYINSPAVRTDYTY
FT                   PRYETTAETTSGGLTGLTTSLSTLNAPALSRTQSDGSGSKSSLGLNIGGMGDYRNETLT
FT                   TNPRDTAFLSHLVQTVFFLRGIDVVSPANADTDVFINIDVFGTIRNRTEMHLYNAETLK
FT                   AQTKLEYFAVDRTNKKLLIKPKTNAFEAAYKENYALWMGPYKVSKGIKPTEGLMVDFSD
FT                   IQPYGNHMGNSAPSVEADNSHEGYGYSDEAVRRHRQGQP"
FT   CDS_pept        complement(307114..307833)
FT                   /transl_table=11
FT                   /locus_tag="NMA0326"
FT                   /product="uridylate kinase"
FT                   /EC_number="2.7.4.-"
FT                   /note="NMA0326, pyrH, uridylate kinase, len: 239 aa;
FT                   similar to many e.g. PYRH_ECOLI P29464 uridylate kinase (EC
FT                   2.7.4.-) (240 aa), fasta scores; E(): 0, 53.7% identity in
FT                   231 aa overlap. Contains Pfam match to entry PF00696
FT                   aakinase, Aspartate kinases, Glutamate kinases and Gamma
FT                   glutamate phospho-reductases"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0326"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07628"
FT                   /db_xref="GOA:P65931"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR011817"
FT                   /db_xref="InterPro:IPR015963"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="UniProtKB/Swiss-Prot:P65931"
FT                   /protein_id="CAM07628.1"
FT                   /translation="MTQQIKYKRVLLKLSGESLMGSDPFGINHDTIVQTVGEIAEVVKM
FT                   GVQVGIVVGGGNIFRGVSAQAGSMDRATADYMGMMATVMNALALKDAFETLGIKARVQS
FT                   ALSMQQIAETYARPKAIQYLEEGKVVIFAAGTGNPFFTTDTAAALRGAEMNCDVMLKAT
FT                   NVDGVYTADPKKDPSATRYETITFDEALLKNLKVMDATAFALCRERKLNIVVFGIAKEG
FT                   SLKRVITGEDEGTLVHC"
FT   CDS_pept        complement(308156..309010)
FT                   /transl_table=11
FT                   /locus_tag="NMA0327"
FT                   /product="elongation factor TS"
FT                   /note="NMA0327, tsf, elongation factor TS, len; 284 aa;
FT                   similar to many e.g. EFTS_HAEIN P43894 elongation factor TS
FT                   (282 aa), fasta scores; E(): 0, 53.6% identity in 280 aa
FT                   overlap. Contains Pfam match to entry PF00889
FT                   EF_TS,Elongation factor TS, PS01126 Elongation factor Ts
FT                   signature 1, and PS01127 Elongation factor Ts signature 2"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0327"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07629"
FT                   /db_xref="GOA:P64050"
FT                   /db_xref="InterPro:IPR001816"
FT                   /db_xref="InterPro:IPR009060"
FT                   /db_xref="InterPro:IPR014039"
FT                   /db_xref="InterPro:IPR018101"
FT                   /db_xref="InterPro:IPR036402"
FT                   /db_xref="UniProtKB/Swiss-Prot:P64050"
FT                   /protein_id="CAM07629.1"
FT                   /translation="MAEITAKMVADLRAATGLGMMECKKALVEAEGNFDKAEEILRIKS
FT                   GAKAGKLAGRTAAEGVLAYAINGNVGALVEVNCETDFVAKDAGFVEFANFVAKTAAEKK
FT                   PASVEELSELVEAERKAIIAKLGENMSVRRFQVIDTANQLVAYIHGALATEGVLVEYKG
FT                   SEDVARKIGMHIVAAKPQCVSEAEVDAETVEKERHIYTEQAIASGKPADIAAKMVEGRI
FT                   RKFLAEITLNGQAFVMNPDQTVAQFSKENGTEVISFVRYKVGDGIEKKAVDYAAEVAAA
FT                   AKV"
FT   CDS_pept        complement(309139..309867)
FT                   /transl_table=11
FT                   /locus_tag="NMA0328"
FT                   /product="30S ribosomal protein S2"
FT                   /note="NMA0328, rpsB, 30S ribosomal protein S2, len: 242
FT                   aa; similar to many e.g. RS2_SPIPL P34831 30S ribosomal
FT                   protein S2 (251 aa), fasta scores; E(): 0, 62.3% identity
FT                   in 228 aa overlap. Contains Pfam match to entry PF00318
FT                   Ribosomal_S2, Ribosomal protein S2, and PS00962 Ribosomal
FT                   protein S2 signature 1"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0328"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07630"
FT                   /db_xref="GOA:P66539"
FT                   /db_xref="InterPro:IPR001865"
FT                   /db_xref="InterPro:IPR005706"
FT                   /db_xref="InterPro:IPR018130"
FT                   /db_xref="InterPro:IPR023591"
FT                   /db_xref="UniProtKB/Swiss-Prot:P66539"
FT                   /protein_id="CAM07630.1"
FT                   /translation="MSQITMRQMIEAGVHFGHQTRFWNPKMAQYIFGARNKIHIVNLEK
FT                   TLPMFQDAQEAVRRLVANKGTVLFVGTKRQARDIIREEATRAGMPFVDYRWLGGMLTNY
FT                   KTVKQSIKRLEEKTAALENAAESGFSKKEILEMQRDVEKLERSLGGIKNMKGLPDAIFV
FT                   IDTGYQKGTLVEAEKLGIPVIAVVDTNNSPDGVKYVIPGNDDSAKAIRLYCRGIADAVL
FT                   EGKNQALQETVAAAQEAAAE"
FT   CDS_pept        complement(310068..310277)
FT                   /transl_table=11
FT                   /locus_tag="NMA0329"
FT                   /product="putative integral membrane protein"
FT                   /note="NMA0329, possible integral membrane protein, len: 69
FT                   aa"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0329"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07631"
FT                   /db_xref="GOA:A0A0U1RH60"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RH60"
FT                   /protein_id="CAM07631.1"
FT                   /translation="MWHIVAIGYLFVAVMFSAAQPSIARALIYLVFWAVLPTVFTVFVV
FT                   TIRRRNRLMKQQEQAEFEQQRAQR"
FT   CDS_pept        310355..310936
FT                   /transl_table=11
FT                   /locus_tag="NMA0330"
FT                   /product="hypothetical protein NMA0330"
FT                   /note="NMA0330, unknown, len: 193 aa; similar to
FT                   hypothetical proteins e.g. YGFA_HAEIN P44905 hypothetical
FT                   protein HI0858 (187 aa), fasta scores; E(): 5e-11, 27.8%
FT                   identity in 194 aa overlap, and to e.g. FTHC_HUMAN P49914
FT                   5-formyltetrahydrofolate cyclo-ligase (202 aa), fasta
FT                   scores; E(): 6.7e-07, 24.1% identity in 191 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0330"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07632"
FT                   /db_xref="GOA:A0A0U1RH61"
FT                   /db_xref="InterPro:IPR002698"
FT                   /db_xref="InterPro:IPR024185"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RH61"
FT                   /protein_id="CAM07632.1"
FT                   /translation="MRNEEKHALRRELRRARAQMGHQGRLAAGQTINRLLKRYIKRGRK
FT                   IGVYWPMGKELRLDGFVRAAQKRGAKLYLPYIEPRSRRMWFTPYPESGMERERIRGRAK
FT                   LNVPQFAGRKIRVHGLSVLLVPLVGIDREGYRLGQAGGYYDATLAAMKYRLQAKTVGVG
FT                   FACQFVDRLPREPHDLLLDGFVSEAGILCF"
FT   CDS_pept        310997..311587
FT                   /transl_table=11
FT                   /locus_tag="NMA0331"
FT                   /product="hypothetical protein NMA0331"
FT                   /note="NMA0331, unknown, len: 196 aa; similar to
FT                   hypothetical proteins e.g. TR:O54394 (EMBL:U81516)
FT                   hypothetical 24.4 kd protein (216 aa), fasta scores; E():
FT                   4.2e-19, 37.2% identity in 199 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0331"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07633"
FT                   /db_xref="GOA:A0A0U1RH62"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RH62"
FT                   /protein_id="CAM07633.1"
FT                   /translation="MSERIILPVLSLGGVRLEPLDVHHETGLREAVCDGEVWKLGVTSA
FT                   PHPDRVADYIGTALATRLAFAVVDEEAGRVVGTTAYYHFEPQIPRLDIGFTWYAASARR
FT                   TRINTCCKIMLLDYAFDVLACRCVGWRTDILNLASQRAIERLGAEKDGVLRMHMLRKDG
FT                   SVRDTVVYSMLREDWCKNREILTGRLAGYGVQV"
FT   CDS_pept        312124..313590
FT                   /transl_table=11
FT                   /locus_tag="NMA0333"
FT                   /product="probable malate:quinone oxidoreductase"
FT                   /EC_number="1.1.99.16"
FT                   /note="NMA0333, mqo, probable malate:quinone
FT                   oxidoreductase, len: 488 aa; similar to e.g. MQO_ECOLI
FT                   P33940 probable malate:quinone oxidoreductase (EC
FT                   1.1.99.16) (548 aa), fasta scores; E(): 0, 52.7% identity
FT                   in 490 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0333"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07634"
FT                   /db_xref="GOA:Q9JWK3"
FT                   /db_xref="InterPro:IPR006231"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9JWK3"
FT                   /protein_id="CAM07634.1"
FT                   /translation="MAEATDVVLVGGGIMSATLGVLLKELEPSWEITLIERLEDVALES
FT                   SNAWNNAGTGHSALCELNYAPLGANGIIDPARALNIAEQFHVSRQFWATLVAEGKLEDN
FT                   SFINAVPHMSLVMNEDHCSYLQKRYDAFKTQKLFENMEFSTDRNKISDWAPLMMRGRDE
FT                   NQPVAANYSAEGTDVDFGRLTRQMVKYLQGKGVKTEFNRHVEDIKRESDGAWVLKTADT
FT                   RNPDGQLTLRTRFLFLGAGGGALTLLQKSGIPEGKGYGGFPVSGLFFRNSNPETAEQHN
FT                   AKVYGQASVGAPPMSVPHLDTRNVDGKRHLMFGPYAGFRSNFLKQGSLMDLPLSIHMDN
FT                   LYPMLRAGWANMPLTKYLLGELRKTKEERFASLLEYYPEANPDDWELITAGQRVQIIKK
FT                   DSEKGGVLQFGTEIVAHADGSLAALLGASPGASTAVPLMIRLMHQCFPERTPSWEGRLK
FT                   ELVPGYGIKLNENPERADEIIAYTAKVLDI"
FT   CDS_pept        complement(313778..314338)
FT                   /transl_table=11
FT                   /locus_tag="NMA0335"
FT                   /product="putative adhesin component"
FT                   /note="NMA0335, possible adhesin component, len: 186 aa;
FT                   similar to TR:P94741 (EMBL:D78153) Eikenella corrodens
FT                   component protein of adhesin complex (226 aa), fasta
FT                   scores; E(): 3.9e-08, 43.9% identity in 98 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0335"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07635"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RH63"
FT                   /protein_id="CAM07635.1"
FT                   /translation="MPSETPDRPPYPACRPCLKPPNRPNPPFYKLYPISCLFQDTPTLE
FT                   CQTVRNGQTPHPSKGIKMKLLTTAILSSAIALSSMAAAAGTNNPTVAKKTVSYVCQQGK
FT                   KVKVTYGFNKQGLTTYASAVINGKRVQMPVNLDKSDNVETFYGKEGGYVLGTGVMDGKS
FT                   YRKQPIMITAPDNQIVFKDCSPR"
FT   CDS_pept        complement(314390..314689)
FT                   /transl_table=11
FT                   /locus_tag="NMA0336"
FT                   /product="hypothetical protein NMA0336"
FT                   /note="NMA0336, unknown, len: 99 aa"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0336"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07636"
FT                   /db_xref="GOA:A0A0U1RH64"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RH64"
FT                   /protein_id="CAM07636.1"
FT                   /translation="MKIFENIEDVKAIRKKTGLNQIDFWGKVGVTQSGGSRYETGRKMP
FT                   KPVRELLRLVHIECIDLAKVNKKDMEIAALLKKHHPDLYAELSKQTKSERKKQS"
FT   CDS_pept        complement(314844..315623)
FT                   /transl_table=11
FT                   /locus_tag="NMA0337"
FT                   /product="methionine aminopeptidase"
FT                   /EC_number="3.4.11.18"
FT                   /note="NMA0337, map, methionine aminopeptidase, len: 259
FT                   aa; similar to many e.g. AMPM_ECOLI P07906 methionine
FT                   aminopeptidase (EC 3.4.11.18) (264 aa), fasta scores; E():
FT                   0, 56.4% identity in 257 aa overlap. Contains Pfam match to
FT                   entry PF00557 Peptidase_M24, metallopeptidase family M24,
FT                   and PS00680 Methionine aminopeptidase subfamily 1
FT                   signature"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0337"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07637"
FT                   /db_xref="GOA:A0A0U1RH65"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR001714"
FT                   /db_xref="InterPro:IPR002467"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RH65"
FT                   /protein_id="CAM07637.1"
FT                   /translation="MNGIIIKTPEEIEKMRELGKLVAEALDYIGQFVKPGVTTDEIDKL
FT                   VYDYHVNVQGGYPAPLHYGNPPYPKSCCTSVNHVICHGIPDDKPLKEGDIINIDLTIKK
FT                   DGFHGDSSRMFTVGKVSPIAQRLIDVTHASMMAGIEAVKPGATLGDVGYACQQVAENAG
FT                   YSVVQEFCGHGIGRGFHEAPQVLHYGKKGQGSVLKPGMIFTVEPMINQGKRHLRILNDG
FT                   WTVVTKDRSLSAQWEHEVLVTETGYEILTVSPASGKP"
FT   CDS_pept        complement(315663..316256)
FT                   /transl_table=11
FT                   /locus_tag="NMA0338"
FT                   /product="putative periplasmic protein"
FT                   /note="NMA0338, probable periplasmic protein, len: 197 aa;
FT                   contains N-terminal signal sequence and P-,E-rich
FT                   C-terminal region"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0338"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07638"
FT                   /db_xref="GOA:A0A0U1RH66"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RH66"
FT                   /protein_id="CAM07638.1"
FT                   /translation="MAKKPNKPFRLTPKLLIRAVLLICITAIGALAIGIVSTFNPNGDK
FT                   TLQTEPQHTDSPRETEFWLPNGVVGQDAAQPEHHHASSSAPAQPDGTDESGSGLPSPAA
FT                   PKKNRVKPQPADTAQTDRQPDDAGAQAENTLKETPVLPTNVPRPEPRKETPEKQAQPKE
FT                   TPKEKETPKENHTKPDTPKNTPPKPHKEILDNLF"
FT   CDS_pept        complement(316321..316929)
FT                   /transl_table=11
FT                   /locus_tag="NMA0339"
FT                   /product="putative lipoprotein"
FT                   /note="NMA0339, probable lipoprotein, len: 202 aa; similar
FT                   to hypothetical proteins e.g. YRAP_ECOLI P45467 (191
FT                   aa),fasta scores; E(): 4.8e-14, 35.0% identity in 183 aa
FT                   overlap, and to HLY2_ACTPL P46028 Actinobacillus
FT                   pleuropneumoniae 21 KD hemolysin precursor (194 aa), fasta
FT                   scores; E(): 9.2e-10, 32.3% identity in 164 aa overlap.
FT                   Contains N-terminal signal sequence and appropriately
FT                   positioned PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0339"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07639"
FT                   /db_xref="InterPro:IPR007055"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RH67"
FT                   /protein_id="CAM07639.1"
FT                   /translation="MKPKPHTVRTLTAAVLSLALGGCVSAVVGGAAVGAKSAVDRRTTG
FT                   AQTDDNVMALRIETTARSYLRQNNQTKGYTPQISVVGYNRHLLLLGQVATEGEKQFVGQ
FT                   IARSEQAAEGVYNYITVASLPRTAGDIAGDTWNTSKVRATLLGISPATQARVKIVTYGN
FT                   VTYVMGILTPEEQAQITQKVSTTVGVQKVITLYQNYVQR"
FT   CDS_pept        complement(316993..317586)
FT                   /transl_table=11
FT                   /locus_tag="NMA0340"
FT                   /product="phosphoheptose isomerase"
FT                   /EC_number="5.-.-.-"
FT                   /note="NMA0340, lpcA, phosphoheptose isomerase, len: 197
FT                   aa; LPCA_ECOLI P51001 phosphoheptose isomerase (EC 5.-.-.-)
FT                   (192 aa), fasta scores; E(): 7.1e-27, 49.7% identity in 165
FT                   aa overlap. Contains Pfam match to entry PF01380 SIS, SIS
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0340"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07640"
FT                   /db_xref="GOA:P0A0Y5"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR004515"
FT                   /db_xref="InterPro:IPR035461"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0A0Y5"
FT                   /protein_id="CAM07640.1"
FT                   /translation="MTTLQERVAAHFAESIRAKQEAGKVLVEPTVQAAELMLQCLMNDG
FT                   KILACGNGGSAADAQHFAAEMTGRFEKERMELAAVALTTDTSALTAIGNDYGFDHVFSK
FT                   QVRALGRAGDVLVGISTSGNSANVIEAVKAAHERDMHVIALTGRDGGKIAAILKDTDVL
FT                   LNVPHPRTARIQENHILLIHAMCDCIDSVLLEGM"
FT   CDS_pept        complement(317591..317938)
FT                   /transl_table=11
FT                   /locus_tag="NMA0341"
FT                   /product="hypothetical protein NMA0341"
FT                   /note="NMA0341, unknown, len: 115 aa; similar to
FT                   hypothetical proteins e.g. YRAN_ECOLI P45465 (131 aa),fasta
FT                   scores; E(): 7.4e-11, 37.7% identity in 114 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0341"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07641"
FT                   /db_xref="GOA:Q9JWJ8"
FT                   /db_xref="InterPro:IPR003509"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR011856"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9JWJ8"
FT                   /protein_id="CAM07641.1"
FT                   /translation="MRLNHKQGEAGEDAALAFLQSQGCTLLARNWHCAYGEIDLIVKNG
FT                   GMILFVEVKYRKNRQFGGAAYSISPSKLLKLQRSVEYYLQQNRLTNVPCRLDAVLIEGS
FT                   RPPEWIQNITG"
FT   CDS_pept        317991..318866
FT                   /transl_table=11
FT                   /locus_tag="NMA0342"
FT                   /product="hypothetical protein NMA0342"
FT                   /note="NMA0342, unknown, len: 291 aa; similar to many
FT                   hypothetical proteins e.g. YRAL_ECOLI P45528 (286 aa),fasta
FT                   scores; E(): 0, 44.4% identity in 284 aa overlap. Contains
FT                   Pfam match to entry PF00590 TP_methylase,Tetrapyrrole
FT                   (Corrin/Porphyrin) Methylases"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0342"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07642"
FT                   /db_xref="GOA:Q9JWJ7"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR008189"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR018063"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9JWJ7"
FT                   /protein_id="CAM07642.1"
FT                   /translation="MFQKHLQKASDSVVGGTLYVVATPIGNLADITLRALAVLQKADII
FT                   CAEDTRVTAQLLSAYGIQGKLVSVREHNERQMADKIVGYLSDGMVVAQVSDAGTPAVCD
FT                   PGAKLARRVREVGFKVVPVVGASAVMAALSVAGVAGSDFYFNGFVPPKSGERRKLFAKW
FT                   VRVAFPVVMFETPHRIGATLADMAELFPERRLMLAREITKTFETFLSGTVGEIQTALAA
FT                   DGNQSRGEMVLVLYPAQDEKHEGLSESAQNIMKILTAELPTKQAAELAAKITGEGKKAL
FT                   YDLALSWKNK"
FT   CDS_pept        complement(318901..319305)
FT                   /transl_table=11
FT                   /locus_tag="NMA0343"
FT                   /product="putative cytochrome B561"
FT                   /note="NMA0343, cybB, probable cytochrome B561, len: 134
FT                   aa; similar to e.g. C561_ECOLI P08732 cytochrome B561 (176
FT                   aa), fasta scores; E(): 0.00015, 30.6% identity in 134 aa
FT                   overlap"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0343"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07643"
FT                   /db_xref="GOA:A0A0U1RH68"
FT                   /db_xref="InterPro:IPR011577"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RH68"
FT                   /protein_id="CAM07643.1"
FT                   /translation="MGSLFGLHKSFGFLTLTVITLRIVWAVANRAKRPQSDSKAAAAGH
FT                   GILYLLMLAVPVIGMIRQYGSGRGPLKVFGVEVMQGSPEKIEWMANLGNTFHGNLGWLL
FT                   FAAVVGHVAMVVVHRVQGKDVLYRMTGRVR"
FT   CDS_pept        join(319596..320048,320047..320238)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="NMA0344A"
FT                   /product="probable IS1016 transposase (pseudogene)"
FT                   /note="NMA0344A, insertion element IS1016
FT                   transposase,partial CDS, len; 63 aa; similar to e.g.
FT                   TR:Q48234 (EMBL:X59756) insertion sequence IS1016-V6 (191
FT                   aa), fasta scores; E(): 2.4e-06, 75.0% identity in 28 aa
FT                   overlap"
FT                   /note="NMA0344, insertion element IS1016
FT                   transposase,partial CDS, len; 151 aa; similar to e.g.
FT                   TR:Q48234 (EMBL:X59756) insertion sequence IS1016-V6 (191
FT                   aa), fasta scores; E(): 8.7e-31, 59.7% identity in 144 aa
FT                   overlap"
FT                   /db_xref="PSEUDO:CAM07644.1"
FT   CDS_pept        320559..321713
FT                   /transl_table=11
FT                   /locus_tag="NMA0345"
FT                   /product="putative GTP-binding protein"
FT                   /note="NMA0345, probable GTP-binding protein, len: 384 aa;
FT                   similar to many e.g. YHBZ_ECOLI P42641 hypothetical 43.3 kd
FT                   GTP-binding protein (390 aa), fasta scores; E(): 0,56.3%
FT                   identity in 359 aa overlap. Contains Pfam match to entry
FT                   PF01018 GTP1_OBG, GTP1/OBG family, PS00017 ATP/GTP-binding
FT                   site motif A (P-loop), and PS00905 GTP1/OBG family
FT                   signature"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0345"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07645"
FT                   /db_xref="GOA:A1IPH6"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR006074"
FT                   /db_xref="InterPro:IPR006169"
FT                   /db_xref="InterPro:IPR014100"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031167"
FT                   /db_xref="InterPro:IPR035101"
FT                   /db_xref="InterPro:IPR036726"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1IPH6"
FT                   /protein_id="CAM07645.1"
FT                   /translation="MKFIDEAKIEVAAGKGGNGATSFRREKFVPRGGPDGGDGGKGGSV
FT                   WAEADENTNTLVEYRFVKRYQAKNGEKGHGSDRYGAGADDIVLKMPVGTLIRDLDTGEN
FT                   VADLTYHGQRVCLAKGGKGGLGNIHFKSSVNRAPKQSTPGEEGEARSLQLELKVLADVG
FT                   LLGMPNAGKSTLITAVSAARPKIANYPFTTLHPNLGVVRIDENHSFVMADIPGLIEGAA
FT                   EGAGLGHRFLKHLSRTGLLLHVVDLAPFDETVNPAEEALAIINELRKYDEELYGKPRWL
FT                   VLNKLDMLDEEEARARTAAFLEAVGWDYPKPDDRFQFDMETPRLFQISALTHQGTQELV
FT                   HQINQYLIEKKRIEAEKAEAERAATNVEIAEQQPKTDTGVFKPE"
FT   CDS_pept        321796..322845
FT                   /transl_table=11
FT                   /locus_tag="NMA0346"
FT                   /product="putative ATP-binding protein"
FT                   /note="NMA0346, probable ATP-binding protein, len: 349 aa;
FT                   Also similar to NMA0935 (28.7% identity in 338 aa overlap).
FT                   Contains PS00017 ATP/GTP-binding site motif A (P-loop)"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0346"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07646"
FT                   /db_xref="GOA:A0A0U1RH70"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038729"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RH70"
FT                   /protein_id="CAM07646.1"
FT                   /translation="MSSNQYIQSLELTNFTVLPNDTFEFSENLNVIVAENGCGKTHLLK
FT                   ILYSLLEVTSNTKNRLLKTELQKSFADKLLNVFRPDSLGRLSKRLQGRGRTEIVLKLQN
FT                   GTTHSSLNFSSNSSSQVNVQSIGLKENEYTPTPIFLPSRELITLCPWFTSLYQNQSIPF
FT                   EETWFDTCMQLNHPLAKGPRETKIRELLEPIENAMGGKVSEEQGRFYLSLTNTGGKIEA
FT                   PLVAEGLRKFVMIARLIATGALLDKGYLFWDEPEANLNPKLIKVAARIIWSLSQQGIQV
FT                   FIATHSLFLLRELELLKLENNTDLPVRFFSLIASDDGTKVEQGNSINDLNTLILLDENI
FT                   MQADRYLNI"
FT   CDS_pept        322855..324954
FT                   /transl_table=11
FT                   /locus_tag="NMA0347"
FT                   /product="cysteinyl-tRNA synthetase"
FT                   /EC_number="6.1.1.16"
FT                   /note="NMA0347, cysS, probable cysteinyl-tRNA
FT                   synthetase,len: 699 aa; alternative start at aa 227.
FT                   Similar (sfter aa 227) to many e.g. SYC_BACSU Q06752
FT                   cysteinyl-tRNA synthetase (EC 6.1.1.16) (466 aa), fasta
FT                   scores; E(): 0,45.6% identity in 487 aa overlap. Contains
FT                   Pfam match to entry PF01406 tRNA-synt_1e, tRNA synthetases
FT                   class I (C). N-terminal extension is AT-rich, and does not
FT                   have any data base similarities"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0347"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07647"
FT                   /db_xref="GOA:Q9JWJ3"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015273"
FT                   /db_xref="InterPro:IPR015803"
FT                   /db_xref="InterPro:IPR024909"
FT                   /db_xref="InterPro:IPR032678"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9JWJ3"
FT                   /protein_id="CAM07647.1"
FT                   /translation="MTTITEKRLTFAFPEDYYVTKYDEWEHYKIFQNSCNLRNKIDTNE
FT                   KGKNGINQSVDDDNGSSGVDIIALHESTLWLIEIKDYYRLGLEPNAQSIDEKLSDLPYL
FT                   IARKIRDSLAGLVSAKFKAEKQEEKDFSRLALDCNEIKIVLHIEMPSIRSKLYPSSSDL
FT                   ANLLKDKFKLSEFTKNFANCYAEPIFTNISHINNPQLRNVPWSVSTGTEQKLSSEQQRL
FT                   IHNPMTTIYNTLTRQKEPFAPIDPKNVRMYVCGMTVYDYCHLGHARVMVVFDMIARWLR
FT                   ECGYPLTYVRNITDIDDKIIARAAENGETIGELTARFIQAMHEDADALGVLRPDIEPKA
FT                   TENIPQMIAMIETLIQNGKAYPAANGDVYYAVREFSAYGQLSGKSLDDLRAGERVEVDG
FT                   FKRDPLDFVLWKAAKAGEPAWESPWGNGRPGWHIECSAMSENLFGNTFDIHGGGADLQF
FT                   PHHENEIAQSVGATGHTCGHHHAQTHHGQSIASHVKYWLHNGFIRVDGEKMSKSLGNFF
FT                   TIREVLKQYDPEVVRFFILRAHYRSPLNYSDAHLDDAKGALTRLYTTLKNTPAAEFDLS
FT                   ENVNDYTRRFYAAMNDDFGTVEAVAVLFELAGEVNKTNDAQLAGCLKALGGIIGLLQRD
FT                   PTEFLQGGAASDGLSNEEIEDLIARRKQARADKNWAESDRIRDLLNEHKIILEDNAGGT
FT                   TWRRG"
FT   CDS_pept        325037..325816
FT                   /transl_table=11
FT                   /locus_tag="NMA0348"
FT                   /product="putative nuclease"
FT                   /note="NMA0348, putative nuclease, len: 259 aa; similar to
FT                   EXOA_BACSU P37454 exodeoxyribonuclease (252 aa), fasta
FT                   scores; E(): 0, 39.0% identity in 251 aa overlap, and
FT                   TR:Q51380 (EMBL:U38241) Pseudomonas aeruginosa catabolite
FT                   repression control protein (259 aa), fasta scores; E():
FT                   0,37.3% identity in 255 aa overlap, and APE1_HUMAN P27695
FT                   DNA-(apurinic or apyrimidinic site) lyase (317 aa), fasta
FT                   scores; E(): 0, 35.8% identity in 254 aa overlap. Contains
FT                   Pfam match to entry PF01260 AP_endonucleas1, AP
FT                   endonuclease family 1, and PS00726 AP endonucleases family
FT                   1 signature 1. Also similar to NMA2086, xthA (29.5%
FT                   identity in 268 aa overlap)"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0348"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07648"
FT                   /db_xref="GOA:A0A0U1RH71"
FT                   /db_xref="InterPro:IPR004808"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR020847"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RH71"
FT                   /protein_id="CAM07648.1"
FT                   /translation="MLKIISANVNGIRSAYKKGFYEYIAASGADIVCVQELKAQEADLS
FT                   ADMKNPHGMHGHWHCAEKRGYSGVAVYSKRKPDNVQIGMGIEEFDREGRFVRCDFGRLS
FT                   VISLYLPSGSSAEERQQVKYRFLDAFYPMLEAMKNEGRDIVVCGDWNIAHQNIDLKNWK
FT                   GNQKNSGFLPEEREWIGKVIHKLGWTDMWRTLYPDVPGYTWWSNRGQAYAKDVGWRIDY
FT                   QMVTPELAAKAVSAHVYKDEKFSDHAPLVVEYDYAAE"
FT   CDS_pept        325803..326147
FT                   /transl_table=11
FT                   /locus_tag="NMA0349"
FT                   /product="putative integral membrane protein"
FT                   /note="NMA0349, probable integral membrane protein, len:
FT                   114 aa; contains three possible transmembrane domain"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0349"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07649"
FT                   /db_xref="GOA:A0A0U1RH72"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RH72"
FT                   /protein_id="CAM07649.1"
FT                   /translation="MLPNKVLGKYDWNVDGKTGIGAAWVVAAFILPMLVWAIFMLSRMQ
FT                   GWLAPTKANPIWALVWLLICLPCLLIASKCLGWKGWRLLANVLACLAVRTLLSVPAALL
FT                   IAFTLQDLLK"
FT   CDS_pept        326157..326687
FT                   /transl_table=11
FT                   /locus_tag="NMA0350"
FT                   /product="hypothetical protein NMA0350"
FT                   /note="NMA0350, unknown, len: 176 aa"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0350"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07650"
FT                   /db_xref="GOA:A0A0U1RH73"
FT                   /db_xref="InterPro:IPR010662"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RH73"
FT                   /protein_id="CAM07650.1"
FT                   /translation="MESFELEDLTLWLVRDADEAEMWIDRWAISYPVVQMSEASAGQSI
FT                   GEWQAGLQTAFERIRGKYVAVVAHGAGAAAFLAWLYQADILTRKKIANIILVPQRPDIF
FT                   PDDAEHAFQRVRCPCRAALVVPEHGGVPHGWAQRQADLWNARLLVSPHSGSLNGMLGGW
FT                   QWGMKLMQEMLLA"
FT   CDS_pept        complement(326780..327895)
FT                   /transl_table=11
FT                   /locus_tag="NMA0351"
FT                   /product="aspartate-semialdehyde dehydrogenase"
FT                   /EC_number="1.2.1.11"
FT                   /note="NMA0351, asd, aspartate-semialdehyde
FT                   dehydrogenase,len: 371 aa; similar to many e.g. DHAS_HAEIN
FT                   P44801 aspartate-semialdehyde dehydrogenase (EC 1.2.1.11)
FT                   (371 aa), fasta scores; E(): 0, 68.2% identity in 368 aa
FT                   overlap. Contains Pfam match to entry PF01118
FT                   Semialdhyde_dh, Semialdehyde dehydrogenase, and PS01103
FT                   Aspartate-semialdehyde dehydrogenase signature"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0351"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07651"
FT                   /db_xref="GOA:P57008"
FT                   /db_xref="InterPro:IPR000319"
FT                   /db_xref="InterPro:IPR000534"
FT                   /db_xref="InterPro:IPR011534"
FT                   /db_xref="InterPro:IPR012080"
FT                   /db_xref="InterPro:IPR012280"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57008"
FT                   /protein_id="CAM07651.1"
FT                   /translation="MKVGFVGWRGMVGSVLMQRMKEENDFAHIPEAFFFTTSNVGGAAP
FT                   DFGQAAKTLLDANDVAELAKMDIIVTCQGGDYTKSVFQPLRDSGWNGYWVDAASSLRMK
FT                   DDAIIVLDPVNRNVIDNGLKNGVKNYIGGNCTVSLMLMALGGLFQNDLVEWATSMTYQA
FT                   ASGAGAKNMRELISGMGAIHAKVADELADPSSAILDIDRKVSDFLRSEDYPKANFGVPL
FT                   AGSLIPWIDVDLGNGQSKEEWKGGVETNKILGRSDNPTVIDGLCVRIGSMRCHSQALTL
FT                   KLKKDLPVSEIEAILAGANDWVKVIPNEKEASIHELTPAKVTGTLSVPVGRIRKLEMGG
FT                   EYISAFTVGDQLLWGAAEPLRRVLRIVLGSL"
FT   CDS_pept        328071..328652
FT                   /transl_table=11
FT                   /locus_tag="NMA0353"
FT                   /product="putative integral membrane protein"
FT                   /note="NMA0353, probable integral membrane protein, len:
FT                   193 aa; some similarity to YF60_HAEIN P44253 hypothetical
FT                   protein HI1560 (156 aa), fasta scores; E(): 0.0012, 28.1%
FT                   identity in 128 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0353"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07652"
FT                   /db_xref="GOA:A0A0U1RH74"
FT                   /db_xref="InterPro:IPR010432"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RH74"
FT                   /protein_id="CAM07652.1"
FT                   /translation="MEEKNDYTDAASDNRNGQEIEVGIAGAGDRILAALLNQLFTFLVL
FT                   LVPFAGLIAFAIKNEGRIGGSEEIFGLLLGMTSFWVGLAGILVYTVVQIYYMSRDGQSL
FT                   GKKIMRIRVLKTDGRNPGFVGTVLVREIAWSVLVAIIAAVIGLAVGDNGENAINLLAFL
FT                   ANFVLLFMVKRDRRTLYDILADTVVVKLPK"
FT   CDS_pept        complement(328714..329568)
FT                   /transl_table=11
FT                   /locus_tag="NMA0354"
FT                   /product="methylenetetrahydrofolate
FT                   dehydrogenase/cyclohydrolase"
FT                   /EC_number="1.5.1.5"
FT                   /EC_number="3.5.4.9"
FT                   /note="NMA0354, folD, methylenetetrahydrofolate
FT                   dehydrogenase/cyclohydrolase, len: 284 aa; simialr to many
FT                   e.g. FOLD_HAEIN P44313 FOLD bifunctional protein [includes:
FT                   methylenetetrahydrofolate dehydrogenase (EC 1.5.1.5);
FT                   methenyltetrahydrofolate cyclohydrolase (EC 3.5.4.9)] (281
FT                   aa), fasta scores; E(): 0, 61.4% identity in 277 aa
FT                   overlap. Contains Pfam match to entry PF00763 THF_DHG_CYH,
FT                   Tetrahydrofolate dehydrogenase/cyclohydrolase, PS00766
FT                   Tetrahydrofolate dehydrogenase/cyclohydrolase signature 1,
FT                   and PS00767 Tetrahydrofolate dehydrogenase/cyclohydrolase
FT                   signature 2"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0354"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07653"
FT                   /db_xref="GOA:Q9JWI9"
FT                   /db_xref="InterPro:IPR000672"
FT                   /db_xref="InterPro:IPR020630"
FT                   /db_xref="InterPro:IPR020631"
FT                   /db_xref="InterPro:IPR020867"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9JWI9"
FT                   /protein_id="CAM07653.1"
FT                   /translation="MSAQLINGKEVSQKRLQAVAEAVAQRQQDNLHMPCLAVVLVGGDP
FT                   ASAVYVRNKKTACQKCGIKSLSYELPESTSQEELLALVDRLNADSEVDGILVQLPLPKH
FT                   LDSQAVLERISPDKDVDGFHPYNVGRLAVKMPLMRPCTPKGVMTLLEAYGIDPKGKKAV
FT                   VVGASNIVGRPQALELLLARATVTVCHSATENLTDEVAGADILVVGVGIPNFVKGEWIK
FT                   PGAVVIDVGINRLDDGSLCGDVEFETAKERAAMITPVPGGVGPMTIATLMENTLHAASL
FT                   HDA"
FT   CDS_pept        330283..330789
FT                   /transl_table=11
FT                   /locus_tag="NMA0356"
FT                   /product="putative transferase"
FT                   /note="NMA0356, possible transferase, len: 168 aa; similar
FT                   to e.g. TR:Q43999 (EMBL:U07639) Alcaligenes eutrophus H16
FT                   autotrophic growth (aut) gene (164 aa), fasta scores; E():
FT                   0, 59.4% identity in 160 aa overlap, and to C-terminus of
FT                   RFAE_ECOLI P76658 ADP-heptose synthase (477 aa), fasta
FT                   scores; E(): 1.4e-22, 50.4% identity in 137 aa overlap.
FT                   Contains Pfam match to entry PF01467
FT                   Cytidylyltransf,Cytidylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0356"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07654"
FT                   /db_xref="GOA:A0A0U1RH75"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RH75"
FT                   /protein_id="CAM07654.1"
FT                   /translation="MVDAWSVPDFESKICPPEALAARLALLPRPLVFTNGCFDILHRGH
FT                   VTYLAQARSMGGALVLALNTDASVRRLGKGGDRPINPLENRAAVAAALESVDLVTWFDG
FT                   DTPAALIEAVKPEILVKGGDWAADKIVGAAETLARGGQVFSIPFLHQTSTTKTLAKIRA
FT                   AEGGK"
FT   CDS_pept        330786..332564
FT                   /transl_table=11
FT                   /locus_tag="NMA0357"
FT                   /product="BirA bifunctional protein"
FT                   /EC_number="6.3.4.15"
FT                   /note="NMA0357, birA, BirA bifunctional protein, len: 592
FT                   aa; similar in N-terminal half to BIRA_ECOLI P06709 BIRA
FT                   bifunctional protein [includes: biotin operon repressor;
FT                   biotin--[acetyl-CoA-carboxylase] synthetase (EC 6.3.4.15)
FT                   (biotin--protein ligase)] (321 aa), fasta scores; E():
FT                   2e-20, 30.7% identity in 322 aa overlap, and in C-terminal
FT                   half to BAF_BORPE Q45338 Bordetella pertussis BVG accessory
FT                   factor (267 aa), fasta scores; E(): 2.2e-12,32.7% identity
FT                   in 269 aa overlap (baf is downstream of birA in B.
FT                   pertussis). Contains Pfam match to entry PF01317 BIRA,
FT                   Biotin repressor, and PS00095 C-5 cytosine-specific DNA
FT                   methylases C-terminal signature"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0357"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07655"
FT                   /db_xref="GOA:Q9JWI7"
FT                   /db_xref="InterPro:IPR003142"
FT                   /db_xref="InterPro:IPR004143"
FT                   /db_xref="InterPro:IPR004408"
FT                   /db_xref="InterPro:IPR004619"
FT                   /db_xref="InterPro:IPR008988"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9JWI7"
FT                   /protein_id="CAM07655.1"
FT                   /translation="MTVLKPSHWRVLAELADGLPQHVSQLARMADMKPQQLNGFWQQMP
FT                   AHIRGLLRQHDGYWRLVRPLAVFDAEGLRELGERSGFQTALKHECASSNDEILELARIA
FT                   PDKAHKTICVTHLQSKGRGRQGRKWSHRLGECLMFSFGWVFDRPQYELGSLSPVAAVAC
FT                   RRALSRLGLKTQIKWPNDLVVGRDKLGGILIETVRTGGKTVAVVGIGINFVLPKEVENA
FT                   ASVQSLFQTASRRGNADAAVLLETLLAELDAVLLQYARDGFAPFVAEYQAANRDHGKAV
FT                   LLLRDGETVFEGTVKGVDGQGVLHLETAEGKQTVVSGEISLRSDDRPVSVPKRRDSERF
FT                   LLLDGGNSRLKWAWVENGTFATVGSAPYRDLSPLGAEWAEKVDGNVRIVGCAVCGEFKK
FT                   AQVQEQLARKIEWLPSSAQALGIRNHYRHPEEHGSDRWFNALGSRRFSRNACVVVSCGT
FT                   AVTVDALTDDGHYLGGTIMPGFHLMKESLAVRTANLNRHAGKRYPFPTTTGNAVASGMM
FT                   DAVCGSVMMMHGRLKEKTGAGKPVDVIITGGGAAKVAEALPPAFLAENTVRVADNLVIH
FT                   GLLNLIAAEGGESEHT"
FT   CDS_pept        332677..333501
FT                   /transl_table=11
FT                   /locus_tag="NMA0358"
FT                   /product="putative periplasmic protein"
FT                   /note="NMA0358, probable periplasmic protein, len: 274 aa.
FT                   Contains N-terminal signal sequence and probable
FT                   coiled-coil domain from approx aa 70-100"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0358"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07656"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RH76"
FT                   /protein_id="CAM07656.1"
FT                   /translation="MKWLFTLLAVLNIAVFGGTVGYKLAVKATGGVPENRAVENTPPAT
FT                   PAADNAAASVEDTAALLKPGDILTEEQAEQLRLKKEAEQKKLREKKQREEKARREKLAA
FT                   EKAQAERENGAADALCAAQASLTMDEDDYHRIKGLLGKWSHVASRSVEKRTAKAKPADK
FT                   TYRVVLPVSADAENQAAELSAKGFNPIPFDGALSLGVGNSRENAQALQNRLAGAGFGGA
FT                   YIVEHFAEADRQDDSLSVSRMTVLFTGVNAADADEIRKITSLYGKLNLKSCK"
FT   CDS_pept        complement(334264..335052)
FT                   /transl_table=11
FT                   /locus_tag="NMA0361"
FT                   /product="thiamine biosynthesis protein"
FT                   /note="NMA0361, thiG, probable thiamine biosynthesis
FT                   protein, len: 262 aa; similar to many e.g. THIG_ECOLI
FT                   P30139 THIG protein (281 aa), fasta scores; E(): 0, 39.5%
FT                   identity in 253 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0361"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07657"
FT                   /db_xref="GOA:Q9JWI4"
FT                   /db_xref="InterPro:IPR008867"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR033983"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9JWI4"
FT                   /protein_id="CAM07657.1"
FT                   /translation="MLTLYSETFPSRLLLGTAAYPTPEILKQSVRTARPAMITVSLRRA
FT                   GCGGEAHGQGFWSLLQETGVPVLPNTAGCQSVQEAVTTAQMAREVFETDWIKLELIGDD
FT                   DTLQPDVFQLVEAAEILIKDGFKVLPYCTEDLIACRRLLDAGCQALMPWAAPIGTGLGA
FT                   VHAYALNVLRERLPDTPLIIDAGLGLPSQAAQVMEWGFDGVLLNTAVSRSGDPVNMARA
FT                   FALAVESGRLAFEAGPVEARDKAQASTPTVGQPFWHSAEY"
FT   CDS_pept        complement(335266..335460)
FT                   /transl_table=11
FT                   /locus_tag="NMA0362"
FT                   /product="hypothetical protein NMA0362"
FT                   /note="NMA0362, unknown, len: 64 aa"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0362"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07658"
FT                   /db_xref="InterPro:IPR003749"
FT                   /db_xref="InterPro:IPR010035"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR016155"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RH77"
FT                   /protein_id="CAM07658.1"
FT                   /translation="MNIILNGGPAELHGTSVADLIAQTAPQKPFAVAVNTVFVPKGAYA
FT                   ETVLNENDKIDIVRPVVGG"
FT   CDS_pept        complement(335882..336499)
FT                   /transl_table=11
FT                   /locus_tag="NMA0363"
FT                   /product="thiamin-phosphate pyrophosphorylase"
FT                   /EC_number="2.5.1.3"
FT                   /note="NMA0363, thiE, thiamin-phosphate
FT                   pyrophosphorylase,len: 205 aa; THIE_ECOLI P30137
FT                   thiamin-phosphate pyrophosphorylase (EC 2.5.1.3) (211 aa),
FT                   fasta scores; E(): 1.3e-32, 52.1% identity in 188 aa
FT                   overlap. Contains PS00012 Phosphopantetheine attachment
FT                   site"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0363"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07659"
FT                   /db_xref="GOA:Q9JWI2"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR022998"
FT                   /db_xref="InterPro:IPR034291"
FT                   /db_xref="InterPro:IPR036206"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9JWI2"
FT                   /protein_id="CAM07659.1"
FT                   /translation="MTFLPLKSPLKFYAVVPTADWVERMVEAGADTVQLRCKALHGDEL
FT                   KREIARCVAACQGSHTQLFINDHWREAIEAGAYGVHLGQEDMDTADLAAIAAAGLRLGL
FT                   STHSVAELDRALSVHPSYIASGAIFPTTTKQMPTAPQGLDKLREYVKQAGGTPVVAIGG
FT                   IDLNNARAVLATGVSSLAAVRAVTKAANPEAVVKAFQALWDG"
FT   CDS_pept        complement(336520..337620)
FT                   /transl_table=11
FT                   /locus_tag="NMA0364"
FT                   /product="putative oxidoreductase"
FT                   /note="NMA0364, probable oxidoreductase, len: 366 aa;
FT                   similar to e.g. TR:O34292 (EMBL:AF004408) Rhizobium etli
FT                   putative amino acid oxidase flavoprotein thiO (327
FT                   aa),fasta scores; E(): 1.1e-23, 36.2% identity in 351 aa
FT                   overlap, and GLOX_BACSU O31616 glycine oxidase (369
FT                   aa),fasta scores; E(): 1e-08, 24.3% identity in 350 aa
FT                   overlap"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0364"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07660"
FT                   /db_xref="GOA:A0A0U1RH78"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR023209"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RH78"
FT                   /protein_id="CAM07660.1"
FT                   /translation="MTRIAILGGGLSGRLTALQLAEQGYQIALFDKGCRRGEHAAAYVA
FT                   AAMLAPAAEAVEATPEVVRLGRQSIPLWRGIRCHLKTPAMMQENGSLIVWHGQDKPLSN
FT                   EFVRHLKRGGVADDEIVRWRADDIAEREPQLGGRFSDGIYLPTEGQLDGRQILSALADA
FT                   LDELNVPCHWEHECAPEDLQAQYDWLIDCRGYGAKTAWNQSPEHTSTLRGIRGEVARVY
FT                   TPEITLNRPVRLLHPRYPLYIAPKENHVFVIGATQIESESQAPASVRSGLELLSALYAV
FT                   HPAFGEADILEIATGLRPTLNHHNPEIRYNRARRLIEINGLFRHGFMISPAVTAAAVRL
FT                   AVALFDGKDAPERDEESGLAYIRRQD"
FT   CDS_pept        complement(337526..338839)
FT                   /transl_table=11
FT                   /locus_tag="NMA0365"
FT                   /product="putative permease"
FT                   /note="NMA0365, probable permease protein, len: 437 aa;
FT                   similar to e.g. CODB_ECOLI P25525 cytosine permease (419
FT                   aa), fasta scores; E(): 3.8e-14, 26.0% identity in 369 aa
FT                   overlap"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0365"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07661"
FT                   /db_xref="GOA:A0A0U1RH79"
FT                   /db_xref="InterPro:IPR001248"
FT                   /db_xref="InterPro:IPR012732"
FT                   /db_xref="InterPro:IPR030191"
FT                   /db_xref="InterPro:IPR038271"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RH79"
FT                   /protein_id="CAM07661.1"
FT                   /translation="MSGNASSPSSSAAIGLIWFGAAVSIAEISTGTLLAPLGWQRGLAA
FT                   LLLGHAVGGALFFAAAYIGALTGRSSMESVRLSFGKRGSVLFSVANMLQLAGWTAVMIY
FT                   AGATVSSALGKVLWDGESFVWWALANGALIVLWLVFGARKTGGLKTVSMLLMLLAVLWL
FT                   SAEVFSTAGSTAAQVSDGMSFGTAVELSAVMPLSWLPLAADYTRHARRPFAATLTATLA
FT                   YTLTGCWMYALGLAAALFTGETDVAKILLGAGLGAAGILAVVLSTVTTTFLDAYSAGVS
FT                   ANNISAKLSEIPIAVAVAVVGTLLAVLLPVTEYENFLLLIGSVFAPMAAVLIADFFVLK
FT                   RREEIEGFDFAGLVLWLAGFILYRFLLSSGWESSIGLTAPVMSAVAIATVSVRLFFKKP
FT                   NLYKGTRHDPYRHPRRRPLGKADRTAACRTRLSDCTFR"
FT   CDS_pept        339126..340568
FT                   /transl_table=11
FT                   /locus_tag="NMA0367"
FT                   /product="TLDD protein homolog"
FT                   /note="NMA0367, tldD, TLDD protein homolog, len: 480 aa;
FT                   TLDD_ECOLI P46473 TLDD protein (481 aa), fasta scores; E():
FT                   0, 53.9% identity in 477 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0367"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07662"
FT                   /db_xref="GOA:A0A0U1RH80"
FT                   /db_xref="InterPro:IPR002510"
FT                   /db_xref="InterPro:IPR025502"
FT                   /db_xref="InterPro:IPR035068"
FT                   /db_xref="InterPro:IPR036059"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RH80"
FT                   /protein_id="CAM07662.1"
FT                   /translation="MHPTYSAVQARLLEANRLSPELLAKSLCIIGAHHVDYADIYCQRT
FT                   AYESWHLEEGIVKSGSFQINQGVGVRAVSGDKTAFAYADSLCIDSINRSARAVRAIGAA
FT                   GGKVSAKMPSETRGKPVCSASDPIAGLDSAAKVALLNKVEAIAKAADPRIVQVMAGLTC
FT                   EYDMVYLARLDGKHAADIRPMVRLNVTVIAKQGERREQGSAGGGGRYDLAYFDENLVRQ
FT                   FVDAAVKQALTNLESRPAPAGEMTVVLGNGWPGVLLHEAVGHGLEGDFNRKGTSVFSGR
FT                   IGERVAAKGVTVVDQGDIAGRRGSLNIDDEGNETRRTVLIEDGILVGYMQDETNARLTG
FT                   TQSTGNGRRESYASAPMPRMTNTFMENGSYEPEEIIASIDKGIYAVNFGGGQVDITSGK
FT                   FVFSASEAWWVEGGRLQYPVKGATIIGNGPEVLKHVSMIGNDTALDSGVGVCGKEGQSV
FT                   PVGVGQPTLRIDAGLTVGGSAI"
FT   CDS_pept        join(340819..341280,341270..342091)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="NMA0368"
FT                   /product="putative integral membrane protein (pseudogene)"
FT                   /product="HemK protein"
FT                   /note="NMA0368, probable integral membrane protein, len:
FT                   153 aa; contains four probable transmembrane domains"
FT                   /note="NMA0369, hemK, HemK protein, len: 273 aa; similar to
FT                   e.g. HEMK_ECOLI P37186 HEMK protein (277 aa), fasta scores;
FT                   E(): 0, 42.3% identity in 279 aa overlap. Contains PS00092
FT                   N-6 Adenine-specific DNA methylases signature"
FT   CDS_pept        342177..343565
FT                   /transl_table=11
FT                   /locus_tag="NMA0370"
FT                   /product="putative integral membrane protein"
FT                   /note="NMA0370, probable integral membrane protein, len:
FT                   462 aa; similar to hypothetical proteins e.g. Y325_HAEIN
FT                   P44640 hypothetical protein HI0325 (450 aa), fasta scores;
FT                   E(): 0, 49.8% identity in 464 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0370"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07664"
FT                   /db_xref="GOA:A0A0U1RH81"
FT                   /db_xref="InterPro:IPR018461"
FT                   /db_xref="InterPro:IPR032813"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RH81"
FT                   /protein_id="CAM07664.1"
FT                   /translation="MNAVVVAVIVMLVLSLSRVHVVLSLTIGAFVGGAVAGMPLQNIAD
FT                   AAGQVSQAGIIPVFNKGLEGGAKIALSYAMLGAFAMAITHSGLPQQLAGAVVRKLNRGG
FT                   MPDSVRSGEGVVKWLLLSIILVMGMMSQNIIPIHIAFIPMIVPPLLLVFNRLKIDRRLI
FT                   ACVITFGLVTTYMFLPYGFGAIFLNEILLGNIHSAAPQLDVKNINVMAAMAIPALGMLA
FT                   GLLLAFVHYRKPRLYQSNNADTAGNADAANRPQPSAYRSLAAAVAIAVCFAIQLMYEDS
FT                   LVLGAMLGFAVFMMLGVINRDKANDVFGEGIKMMAMVGFIMIAAQGFAAVMNATGHIQP
FT                   LVESSMAIFGNSKGMAALAMLVVGLLVTMGIGSSFSTLPIIAAIYVPLCVGLGFSPLAT
FT                   VAIVGTAGALGDAGSPASDSTLGPTMGLNADGQHDHIRDSVIPTFIHYNIPLLIAGWIA
FT                   AMVL"
FT   CDS_pept        343566..343790
FT                   /transl_table=11
FT                   /locus_tag="NMA0371"
FT                   /product="SLYX protein homolog"
FT                   /note="NMA0371, slyX, SLYX protein homolog, len: 74 aa;
FT                   simlar to SLYX_HAEIN P44759 SLYX protein homolog (73
FT                   aa),fasta scores; E(): 0.0017, 33.8% identity in 74 aa
FT                   overlap, and SLYX_ECOLI P30857 SLYX protein (72 aa), fasta
FT                   scores; E(): 0.24, 32.4% identity in 68 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0371"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07665"
FT                   /db_xref="InterPro:IPR007236"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9JWH4"
FT                   /protein_id="CAM07665.1"
FT                   /translation="MDAVQEFEHRITELEIQSALQEDVIAGLNAMVAELRQTLDLQQAQ
FT                   LRLLYQKMQDRNPDAQEPYSLRDEIPPHY"
FT   CDS_pept        complement(344185..344955)
FT                   /transl_table=11
FT                   /locus_tag="NMA0373"
FT                   /product="ThiF protein"
FT                   /note="NMA0373, thiF, probable ThiF protein, len: 256 aa;
FT                   similar to e.g. THIF_ECOLI P30138 THIF protein (251
FT                   aa),fasta scores; E(): 0, 43.1% identity in 246 aa overlap,
FT                   and MOEB_ECOLI P12282 molybdopterin biosynthesis MOEB
FT                   protein. (249 aa), fasta scores; E(): 0, 43.9% identity in
FT                   244 aa overlap (note that N.m. does not have
FT                   NMB_orthologues of any other molybdopterin biosynthesis
FT                   proteins). Contains Pfam match to entry PF00899
FT                   ThiF_family, ThiF family"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0373"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07666"
FT                   /db_xref="GOA:A0A0U1RH82"
FT                   /db_xref="InterPro:IPR000594"
FT                   /db_xref="InterPro:IPR035985"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RH82"
FT                   /protein_id="CAM07666.1"
FT                   /translation="MTTTEHDNDDAFLLRYSRHILLDEIGIEGQQKLSAAHILVVGCGG
FT                   LGAAALPYLAASGIGTLTIADSDTVELHNLQRQVAFDEGDVGKLKTEALADRLRHINHT
FT                   VDVRTINEKLDGCRLTGLVQAADIVLDCCDNYATRQAVNRACVQAKTPLVSGAAVRFEG
FT                   QLAVYRPDLPDSPCYACLFDGGSASDGICSLFGVFSPLVGIIGSTQAAEALKILLDAGE
FT                   PSHGRLAVYRALEGGWQYFDLPRNPECPVCGAER"
FT   CDS_pept        345070..347823
FT                   /transl_table=11
FT                   /locus_tag="NMA0374"
FT                   /product="phosphoenolpyruvate carboxylase"
FT                   /EC_number="4.1.1.31"
FT                   /note="NMA0374, ppc, phosphoenolpyruvate carboxylase, len:
FT                   917 aa; simlar to many e.g. CAPP_RHOPA O32483
FT                   phosphoenolpyruvate carboxylase (EC 4.1.1.31) (936
FT                   aa),fasta scores; E(): 0, 43.3% identity in 928 aa overlap.
FT                   Contains 2x Pfam match to entry PF00311
FT                   PEPcase,Phosphoenolpyruvate carboxylase, PS00017
FT                   ATP/GTP-binding site motif A (P-loop), and PS00393
FT                   Phosphoenolpyruvate carboxylase active site 2"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0374"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07667"
FT                   /db_xref="GOA:Q9JWH1"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018129"
FT                   /db_xref="InterPro:IPR021135"
FT                   /db_xref="InterPro:IPR022805"
FT                   /db_xref="InterPro:IPR033129"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9JWH1"
FT                   /protein_id="CAM07667.1"
FT                   /translation="MRHLRYIYSIYGNERKIMQLHILNNPKDAALAADAEFLKQSLFNL
FT                   LHEEASPLVVETVKLLSTSDDSAALIEKVLPQLDEQQTHDLTLACGLFAQILNIAEDVH
FT                   HERRRQIHEEAGRGGAEGSLTETVRRLKAGKADGKSVQRQLDNTSVTAVLTAHPTEVQR
FT                   QTVLNFNRRIRALLPQRERCTNADALARLRREIDTILLGLWQTSETRRHKLSVNDEINN
FT                   GVSIFPMSFFEALPKLYRKMEHDFQTAYPDVRVPDILKIGGWIGGDRDGNPFVSAETLR
FT                   FAFRRHADAVFRFYRGELDKLYRELPLSIRRVKVNGDVMALSDKSPDEETARAEEPYRR
FT                   AIAYIMARAMGKARALGLGMGCKFGFLEPYASAQEFLDDLKKLQHSLIDNGSRLLAEGR
FT                   LADLIRSVSVFGFHMMPLDLRQHAGKHADVVAELFQHAGLEDYNSLNEEQKQAALLREL
FT                   SHQRPLYSPFITYSDHTRHELAIFNEARKIKDEFGEDAVTQSIISNCEQPSDLLALALL
FT                   LKETGLLAVENGKPKSRINIVPLFETIEALENACPVMETMFRLDWYGALLESRGNIQEI
FT                   MLGYSDSNKDGGYVTSSWCLYQAELGLVELFKKYDVRMRLFHGRGGSVGRGGGPSYQAI
FT                   LAQPAGSVAGQIRITEQGEVITAKYADPGNAQRNLETLVAATLEASILPDKKDPDAKLM
FT                   QDLSDVSFKYYRELITHPDFIDYFLQTSPIQEIATLNLGSRPASRKTLARIQDLRAIPW
FT                   VFSWMQNRLMLPAWYGFGSAVETLCEGNPDTLAALREHAQSNPFFQAMLSNMEQVMAKT
FT                   DITLAENYAGLSESPDKAKVIFGMIKEEYRRSRKALLDLLQTEELLRDNRSLARSLALR
FT                   IPYLNALNGLQVAMLKRLRKEPDNPHALLMVHLTINGVAQGLRNTG"
FT   CDS_pept        347946..348935
FT                   /transl_table=11
FT                   /locus_tag="NMA0375"
FT                   /product="glycerol-3-phosphate dehydrogenase"
FT                   /EC_number="1.1.1.8"
FT                   /note="NMA0375, gpsA, glycerol-3-phosphate
FT                   dehydrogenase,len: 329 aa; similar to many e.g. GPDA_HAEIN
FT                   P43798 glycerol-3-phosphate dehydrogenase [NAD+] (EC
FT                   1.1.1.8) (335 aa), fasta scores; E(): 0, 42.1% identity in
FT                   328 aa overlap. Contains Pfam match to entry PF01210
FT                   NAD_Gly3P_dh, NAD-dependent glycerol-3-phosphate
FT                   dehydrogenase, and PS00957 NAD-dependent
FT                   glycerol-3-phosphate dehydrogenase signature"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0375"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07668"
FT                   /db_xref="GOA:Q9JWH0"
FT                   /db_xref="InterPro:IPR006109"
FT                   /db_xref="InterPro:IPR006168"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR011128"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9JWH0"
FT                   /protein_id="CAM07668.1"
FT                   /translation="MKITVIGAGSWGTALALHFSQHGNRVSLWTRNADQVRQMQEAREN
FT                   KRGLPGFSFPETLEVCADLADALKDSGLVLIVTSVAGLRSSAELLKQYGAGHLPVLAAC
FT                   KGFEQDTGLLTFQVLKEVLPDNKKIGVLSGPSFAQELAKQLPCAVVLASENQEWVEELV
FT                   PQLNTSVMRLYGSTDVIGVAVGGAVKNVMAIATGLSDGLEYGLNARAALVTRGLAEITR
FT                   LASAMGAQPKTMMGLAGIGDLILTCTGALSRNRRVGLGLAEGKELHQVLVEIGHVSEGV
FT                   STIEEVFNTACKYQIDMPITQTLLQLIRKEMTPQQVVERLMERSARFE"
FT   CDS_pept        348990..349319
FT                   /transl_table=11
FT                   /locus_tag="NMA0376"
FT                   /product="hypothetical protein NMA0376"
FT                   /note="NMA0376, unknown, len: 109 aa; contains several
FT                   coiled-coil domains"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0376"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07669"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RH83"
FT                   /protein_id="CAM07669.1"
FT                   /translation="MKQNIEKLESSVYTLVQKFETLVSENRRLKETVAELKRAHERQKL
FT                   EHETAVDELSEALLVQVGKLKEDLQNKIDSLTEENTRYRSLLEQSREKISALAARLPQR
FT                   QETQQ"
FT   CDS_pept        349330..349635
FT                   /transl_table=11
FT                   /locus_tag="NMA0377"
FT                   /product="hypothetical protein NMA0377"
FT                   /note="NMA0377, unknown, len: 101 aa; some similarity to
FT                   YGFE_ECOLI P45580 (109 aa), fasta scores; E():
FT                   0.00018,29.5% identity in 95 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0377"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07670"
FT                   /db_xref="InterPro:IPR007838"
FT                   /db_xref="InterPro:IPR036192"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RH84"
FT                   /protein_id="CAM07670.1"
FT                   /translation="MNIEQVHIEVMHARLTVNTPAEEKDTLLQAVGMLNGKAEAIREGG
FT                   RVADSEKIVIMAALNVVHDLLKTSLNGGDLAIGDFARKIADMDNACQKALSRLAQE"
FT   CDS_pept        349998..350429
FT                   /transl_table=11
FT                   /locus_tag="NMA0378"
FT                   /product="50S ribosomal protein L13"
FT                   /note="NMA0378, rplM, 50S ribosomal protein L13, len: 143
FT                   aa; highly similar to many e.g. RL13_ECOLI P02410 50S
FT                   ribosomal protein L13 (142 aa), fasta scores; E(): 0,67.6%
FT                   identity in 142 aa overlap. Contains Pfam match to entry
FT                   PF00572 Ribosomal_L13, Ribosomal protein L13"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0378"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07671"
FT                   /db_xref="GOA:Q9JQM8"
FT                   /db_xref="InterPro:IPR005822"
FT                   /db_xref="InterPro:IPR005823"
FT                   /db_xref="InterPro:IPR036899"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9JQM8"
FT                   /protein_id="CAM07671.1"
FT                   /translation="MKTFSAKPHEVKREWFVIDAQDKVLGRVAAEVASRLRGKHKPEYT
FT                   PHVDTGDYIIVINADKLRVTGAKFEDKKYFRHSGFPGGIYERTFREMQEQFPGRALEQA
FT                   VKGMLPKGPLGYAMIKKLKVYAGAEHAHAAQQPKVLELK"
FT   CDS_pept        350439..350831
FT                   /transl_table=11
FT                   /locus_tag="NMA0379"
FT                   /product="30S ribosomal protein S9"
FT                   /note="NMA0379, rpsI, 30S ribosomal protein S9, len: 130
FT                   aa; highly similar to many e.g. RS9_ECOLI P02363 30S
FT                   ribosomal protein S9 (129 aa), fasta scores; E():
FT                   2e-30,64.0% identity in 125 aa overlap. Contains Pfam match
FT                   to entry PF00380 Ribosomal_S9, Ribosomal protein S9/S16,
FT                   and PS00360 Ribosomal protein S9 signature"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0379"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07672"
FT                   /db_xref="GOA:P66641"
FT                   /db_xref="InterPro:IPR000754"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020574"
FT                   /db_xref="InterPro:IPR023035"
FT                   /db_xref="UniProtKB/Swiss-Prot:P66641"
FT                   /protein_id="CAM07672.1"
FT                   /translation="MNGKYYYGTGRRKSSVARVFLIKGTGQIIVNGRPVDEFFARETSR
FT                   MVVRQPLVLTENAESFDIKVNVVGGGETGQSGAIRHGITRALIDFDAALKPALSQAGFV
FT                   TRDAREVERKKPGLRKARRAKQFSKR"
FT   CDS_pept        complement(351086..352015)
FT                   /transl_table=11
FT                   /locus_tag="NMA0381"
FT                   /product="putative transcriptional activator protein METR"
FT                   /note="NMA0381, metR, probable transcriptional activator
FT                   protein METR, len: 309 aa; similar to METR_HAEIN P45349
FT                   transcriptional activator protein METR (309 aa), fasta
FT                   scores; E(): 0, 68.4% identity in 304 aa overlap, and
FT                   METR_ECOLI P19797 transcriptional activator protein METR
FT                   (317 aa), fasta scores; E(): 0, 44.0% identity in 298 aa
FT                   overlap. Contains Pfam match to entry PF00126
FT                   HTH_1,Bacterial regulatory helix-turn-helix protein, lysR
FT                   family, and PS00044 Bacterial regulatory proteins, lysR
FT                   family signature"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0381"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07673"
FT                   /db_xref="GOA:A0A0U1RH85"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037406"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RH85"
FT                   /protein_id="CAM07673.1"
FT                   /translation="MDSIIELRHLKTLLALEETGSVSLAAKRVFLTQSALSHQIRMLEN
FT                   HYGTPLFERKSTPLRFTPVGERLLRLAHELIPQVAVAERDLARITEGEAGELRIAVECH
FT                   TCFDWLMPAMGEFRPMWPQVELDIVSGFQADPVGLLLQHRADLAIVSEAEKQNGISFQP
FT                   LFAYEMVGICAPDHPLAAKNVWTAEDFIGETLITYPVPDEMLDLPKKILIPKNINPPRR
FT                   HSELTIAIIQLVASRRGIAALPYWTVMPYLEKGYVVHRQITDDGLQSKLYAAIRTEDTD
FT                   KSYLNNFCQIIRERGFADLPGLSELESV"
FT   CDS_pept        352146..352895
FT                   /transl_table=11
FT                   /locus_tag="NMA0382"
FT                   /product="hypothetical protein NMA0382"
FT                   /note="NMA0382, unknown, len: 249 aa; similar to
FT                   hypothetical proteins e.g. YBGI_HAEIN Q57354 hypothetical
FT                   protein HI0105 (279 aa), fasta scores; E(): 0, 49.8%
FT                   identity in 241 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0382"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07674"
FT                   /db_xref="GOA:Q9JWG6"
FT                   /db_xref="InterPro:IPR002678"
FT                   /db_xref="InterPro:IPR036069"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9JWG6"
FT                   /protein_id="CAM07674.1"
FT                   /translation="MVLRRDFLTWCNETLQTALFKDYAPNGLQVEGREYIGKIVTSVTA
FT                   SRAAIDFAVEQKADLLLVHHGMFWKNELPTVTGWKKERIAALLRHDINMAGYHLPLDAH
FT                   PTLGNNAQLADRLGFATEKRFGEQNLLNSGSLKQAKTLGALAAHIETVLQRKPVVIGKP
FT                   EREIRRVAWCSGGAQGFFQTAIDEGVDLYLTGEISEAQYHLANETGTAFISAGHHATER
FT                   YGVRALAESAAEVFGLEVCHFDENNPA"
FT   CDS_pept        353018..353599
FT                   /transl_table=11
FT                   /locus_tag="NMA0383"
FT                   /product="ubiquinol-cytochrome c reductase iron-sulfur
FT                   subunit"
FT                   /note="NMA0383, petA, ubiquinol-cytochrome c reductase
FT                   iron-sulfur subunit, len: 193 aa; similar to many e.g.
FT                   UCRI_CHRVI O31214 ubiquinol-cytochrome c reductase
FT                   iron-sulfur subunit (EC 1.10.2.2) (207 aa), fasta scores;
FT                   E(): 0, 59.6% identity in 193 aa overlap. Contains Pfam
FT                   match to entry PF00355 Rieske, Rieske iron-sulfur protein,
FT                   and PS00200 Rieske iron-sulfur protein signature 2"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0383"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07675"
FT                   /db_xref="GOA:A0A0U1RH86"
FT                   /db_xref="InterPro:IPR005805"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR006317"
FT                   /db_xref="InterPro:IPR014349"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR019470"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RH86"
FT                   /protein_id="CAM07675.1"
FT                   /translation="MDNQEINNGRRRFLTLATCGAGGVAALGVATPFVASFFPSEKAKA
FT                   AGAAVEVDVSKIEAGQLLTAEWQGKPIWVLNRTDQQLKDLKGLNGELTDPNSDAEQQPE
FT                   YAKNETRSIKPNILVAIGICTHLGCSPTFRPDIAPADLGADWKGGFFCPCHGSKFDLAG
FT                   RVYKGVPAPTNLVVPPYKYLSDTTILVGED"
FT   CDS_pept        353618..354967
FT                   /transl_table=11
FT                   /locus_tag="NMA0384"
FT                   /product="cytochrome B"
FT                   /EC_number="1.10.2.2"
FT                   /note="NMA0384, petB, cytochrome B, len: 449 aa; similar to
FT                   many e.g. CYB_CHRVI O31215 Chromatium vinosum cytochrome B
FT                   (EC 1.10.2.2) (411 aa), fasta scores; E(): 0,62.9% identity
FT                   in 407 aa overlap. Contains Pfam match to entry PF00033
FT                   cytochrome_b_N, Cytochrome b(N-terminal)/b6/petB, Pfam
FT                   match to entry PF00032 cytochrome_b_C, Cytochrome
FT                   b(C-terminal)/b6/petD, and PS00192 Cytochrome b/b6
FT                   heme-ligand signature"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0384"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07676"
FT                   /db_xref="GOA:A0A0U1RH87"
FT                   /db_xref="InterPro:IPR005797"
FT                   /db_xref="InterPro:IPR005798"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="InterPro:IPR027387"
FT                   /db_xref="InterPro:IPR030689"
FT                   /db_xref="InterPro:IPR036150"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RH87"
FT                   /protein_id="CAM07676.1"
FT                   /translation="MANQTNSKAKALLGWMDARFPLSKMWNEHLAQYYAPKNFNFWYYF
FT                   GSLALLVLVIQIVSGIFLTMNYKPDGNLNAYHLPAAFTAVEYIMRDVSGGWIIRYMHST
FT                   GASFFFIVVYLHMFRGLIYGSYKKPRELVWIFGSLIFLALMAEAFMGYLLPWGQMSFWG
FT                   AQVIINLFSAIPVIGPDLSTWIRGDFNVSDVTLNRFFALHVIAVPLVLLGLVVAHIIAL
FT                   HEVGSNNPDGVEIKKNKDENGIPRDGIPFHPYYTVKDVLGVVVFLIVFCAVLFFAPEGG
FT                   GYFLEAPNFDAANALKTPPHIAPVWYFTPFYAILRAIPSFLGTQVWGVIGMGAAVVLIA
FT                   LLPWLDRGEVKSVRYRGPIFKTALVLFIISFIGLGILGAMVATDTRTLVARILSFVYFA
FT                   FFLGMPFYTKLDKNKPVPERVTMSTAKQKIMFFVYVGITAVGAYLFATNI"
FT   CDS_pept        354982..355770
FT                   /transl_table=11
FT                   /locus_tag="NMA0385"
FT                   /product="cytochrome C1 precursor"
FT                   /note="NMA0385, petC, cytochrome C1 precursor, len: 262 aa;
FT                   similar to e.g. CY1_CHRVI O31216 cytochrome C1 precursor
FT                   (244 aa), fasta scores; E(): 2.8e-27, 47.1% identity in 255
FT                   aa overlap. Contains PS00190 Cytochrome c family
FT                   heme-binding site signature"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0385"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07677"
FT                   /db_xref="GOA:A0A0U1RH88"
FT                   /db_xref="InterPro:IPR002326"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RH88"
FT                   /protein_id="CAM07677.1"
FT                   /translation="MKQAMKNWFAALLLAVPMGAAFASGGHAHYEKVDIDLRDQVSLQR
FT                   GAQIFTNYCLSCHSASGMRFNRLKDIGLTDEEIKKNLMFTTDNVGDVMHSAMNPKDAAK
FT                   WFGAAPPDLTLIARSKGADYLYAYMRGFYKDPTRPSGWNNTVFDKVGMPHPLWEQQGVQ
FT                   AVELDAKGQPVMVKDEHGEMKPKLYWESTGLHSRRLPNGKVIQKEYDAYVRDLVNYLVY
FT                   MGEPAQLQRKRIGYVVMIFLFAVMLPLAYFLKKEYWKDVH"
FT   CDS_pept        356109..357893
FT                   /transl_table=11
FT                   /locus_tag="NMA0386"
FT                   /product="putative periplasmic protein"
FT                   /note="NMA0386, probable periplasmic protein, len: 594 aa;
FT                   similar to YIGN_ECOLI P27850 hypothetical 54.7 kd protein
FT                   (475 aa), fasta scores; E(): 0, 44.3% identity in 404 aa
FT                   overlap. Contains N-terminal signal sequence and several
FT                   coiled-coil domains in N-terminal half"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0386"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07678"
FT                   /db_xref="GOA:Q9JWG3"
FT                   /db_xref="InterPro:IPR003798"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9JWG3"
FT                   /protein_id="CAM07678.1"
FT                   /translation="MELMTVLLPLAALVSGVLFTWLLMKGRFQGEFADLNAQLAEKAAR
FT                   CDFVEQAHAEIASELAVLDGKYRHLQDENYALGNRFSAAEKQIAHLQEKEAESVRLKQS
FT                   YIELQEKAQGLAVENERLATQLGQERKAFADQYALERQIRQRIETDLEESRQTVRDVQN
FT                   DLADVGNRFAAAEKQIAHLQEKEAEAERLRQSHTELQEKAQGLAVENERLATQIEQERL
FT                   ASEEKLSLLGEARKSLSDQFQNLANTILEEKSRRFTEQNREQLHQVLNPLNERIQGFGE
FT                   LVKQTYDKESRERLTLENELKRLQGLNAQLHSEAKALTNALTGTQNKVQGNWGEMILET
FT                   VLENSGLQKGREYVVQAASVRKEEDGGTRRLQPDVLVNLPDNKQIVIDSKVSLTAYVRY
FT                   TQAADADTAARELAAHVASIRAHMKGLSLKDYTDLEGVNTLDFVFMFIPVEPAYLLALQ
FT                   NDAGLFQECFDKRIMLVGPSTLLATLRTVANIWRNEQQNQNALAIADEGGKLYDKFVGF
FT                   VQTLESVGKGIDQAQNSFQTAFKQLAEGRGNLVGRAEKLRLLGVKANKQLARDLTERAN
FT                   ETTALSESLEYVAEDEAV"
FT   CDS_pept        complement(358099..358731)
FT                   /transl_table=11
FT                   /locus_tag="NMA0387"
FT                   /product="putative hydrolase"
FT                   /note="NMA0387, possible hydrolase, len: 210 aa; similar to
FT                   many hypothetical proteins belonging to the glyoxalase II
FT                   family e.g. YCBL_ECOLI P75849 (215 aa), fasta scores; E():
FT                   0, 47.1% identity in 208 aa overlap. Contains Pfam match to
FT                   entry PF00753 lactamase_B, Metallo-beta-lactamase
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0387"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07679"
FT                   /db_xref="GOA:A0A0U1RH89"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RH89"
FT                   /protein_id="CAM07679.1"
FT                   /translation="MTLRYEILSVTPFRQNCTLIWDDESGEAVLTDVGGDVPFLLQALA
FT                   NRKLTLTAIWLTHGHLDHAGGVVEMLKTHKVPVLGPHPDDEFLLQSLPQTTAQYGFPVS
FT                   PAFAPNRWLEEGETLTVGRYAFQVLHIPGHTPGHIVFYCAEAELLIAGDVLFYETIGRT
FT                   DFPRGNHADLINNIRNKLFALPETVQVVAGHGRMTSIGHEKRHNPFF"
FT   CDS_pept        358822..359646
FT                   /transl_table=11
FT                   /locus_tag="NMA0388"
FT                   /product="possible secreted DNA ligase"
FT                   /note="NMA0388, possible secreted DNA ligase, len: 274 aa;
FT                   similar to e.g. DNLI_HAEIN P44121 DNA ligase (268 aa),fasta
FT                   scores; E(): 0, 52.0% identity in 246 aa overlap, and part
FT                   of DNLI_ASFM2 P26813 African swine fever virus DNA ligase
FT                   (419 aa), fasta scores; E(): 0.092, 27.1% identity in 144
FT                   aa overlap. Contains Pfam match to entry PF01068
FT                   DNA_ligase, DNA ligase, and N-terminal signal sequence"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0388"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07680"
FT                   /db_xref="GOA:A0A0U1RH90"
FT                   /db_xref="InterPro:IPR012310"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR029319"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RH90"
FT                   /protein_id="CAM07680.1"
FT                   /translation="MIKKTIGGIIPIFTAVFIPASAGAADLMLAQEYKGQDIAGWAMSE
FT                   KLDGVRAYWDGKHLISRQGYAFTPPKGFTAQFPPYPLDGELYSGRGQFEQISATVRSVS
FT                   SDWRGIRLHVFDVPKAQGNLYQRLAVATQWLKTHPNAPITIIPQIKVRDRQHAMDFLKQ
FT                   IEAQGGEGVMLRQPESRYSGGRSSQLLKLKSQYDDECTVTRHYEGKGRNAGRLGAVGCK
FT                   NRHGEFRIGSGFKDKDRDNPPKIGTLITYRYRGFTRKGTPKFATFVRVRTDR"
FT   CDS_pept        359715..360278
FT                   /transl_table=11
FT                   /locus_tag="NMA0389"
FT                   /product="hypoxanthine phosphoribosyltransferase"
FT                   /EC_number="2.4.2.8"
FT                   /note="NMA0389, hpt, probable hypoxanthine
FT                   phosphoribosyltransferase, len: 187 aa; simlar to
FT                   HGXR_TRIFO P51900 hypoxanthine-guanine-xanthine
FT                   phosphoribosyltransferase (EC 2.4.2.-) (183 aa), fasta
FT                   scores; E(): 8e-12, 35.0% identity in 177 aa
FT                   overlap,HPRT_BACSU P37472 hypoxanthine-guanine
FT                   phosphoribosyltransferase (EC 2.4.2.8) (180 aa), fasta
FT                   scores; E(): 2.1e-10, 28.3% identity in 166 aa overlap, and
FT                   HPRT_ECOLI P36766 hypoxanthine phosphoribosyltransferase
FT                   (EC 2.4.2.8) (182 aa), fasta scores; E(): 2e-07, 25.1%
FT                   identity in 183 aa overlap. Contains Pfam match to entry
FT                   PF00156 Pribosyltran,Purine/pyrimidine phosphoribosyl
FT                   transferases"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0389"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07681"
FT                   /db_xref="GOA:A0A0U1RH91"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RH91"
FT                   /protein_id="CAM07681.1"
FT                   /translation="MTDLETKRLETQAMLENADLLFDQGQCRAALQKVADEITRDLGGK
FT                   YPLLLPVMGGAVVFTGQLLPLLRFPLDFDYVHVSRYGDKLEGGAFNWKRMPDAEQIRGR
FT                   HVVVLDDILDEGHTMSAIQAKLLEMGAASCRAAVFANKLIDKPKPIRADYVGLDVPNRY
FT                   VFGYGMDAAGCWRNLGEIYALDGK"
FT   CDS_pept        360359..360796
FT                   /transl_table=11
FT                   /locus_tag="NMA0390"
FT                   /product="sugar transport PTS system IIA component"
FT                   /EC_number="2.7.1.69"
FT                   /note="NMA0390, probable sugar transport PTS system IIA
FT                   component, len: 145 aa; simlar to e.g. PTFA_BACSU P26379
FT                   PTS system, fructose-specific IIA component (EC 2.7.1.69)
FT                   (146 aa), fasta scores; E(): 0.053, 26.2% identity in 103
FT                   aa overlap, and the N-terminal domain of PTNA_ECOLI P08186
FT                   PTS system, mannose-specific IIAB component (322 aa),fasta
FT                   scores; E(): 8.8e-06, 30.1% identity in 136 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0390"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07682"
FT                   /db_xref="GOA:A0A0U1RH92"
FT                   /db_xref="InterPro:IPR004701"
FT                   /db_xref="InterPro:IPR033887"
FT                   /db_xref="InterPro:IPR036662"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RH92"
FT                   /protein_id="CAM07682.1"
FT                   /translation="MIGLLIITHETIGEAYRKLAHHFFPGGLPENVRILGVQPTEDQDD
FT                   IINNAIAALQEFPDNDGVLIMTDIFGATPCNAARRLVRENKSAILTGLNAPMMVKAVQY
FT                   SPAAEDLAAFTECVREAAVKGIFAITSAPEDLVCRRSGDAV"
FT   CDS_pept        360865..361134
FT                   /transl_table=11
FT                   /locus_tag="NMA0391"
FT                   /product="sugar transport PTS system phosphocarrier protein
FT                   HPR"
FT                   /note="NMA0391, ptsH, probable sugar transport PTS system
FT                   phosphocarrier protein HPR, len: aa; similar to many e.g
FT                   PTHP_ALCEU P23537 phosphocarrier protein HPR (89 aa),fasta
FT                   scores; E(): 2.6e-17, 59.6% identity in 89 aa overlap.
FT                   Contains Pfam match to entry PF00381 PTS-HPr, PTS HPr
FT                   component phosphorylation sites, and PS00012
FT                   Phosphopantetheine attachment site"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0391"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07683"
FT                   /db_xref="GOA:P65876"
FT                   /db_xref="InterPro:IPR000032"
FT                   /db_xref="InterPro:IPR001020"
FT                   /db_xref="InterPro:IPR002114"
FT                   /db_xref="InterPro:IPR035895"
FT                   /db_xref="UniProtKB/Swiss-Prot:P65876"
FT                   /protein_id="CAM07683.1"
FT                   /translation="MLKQSIEIINKLGLHARASNKFTQTASQFKSEVWVTKNDSRVNGK
FT                   SIMGLMMLAAAKGTVIELETDGADEAEAMRALTDLINGYFGEGE"
FT   CDS_pept        361134..362909
FT                   /transl_table=11
FT                   /locus_tag="NMA0392"
FT                   /product="phosphoenolpyruvate-protein phosphotransferase"
FT                   /EC_number="2.7.3.9"
FT                   /note="NMA0392, ptsI, probable phosphoenolpyruvate-protein
FT                   phosphotransferase (phosphotransferase system, enzyme
FT                   I),len: aa; similar to many e.g. PT1_ALCEU P23536
FT                   phosphoenolpyruvate-protein phosphotransferase (EC 2.7.3.9)
FT                   (592 aa), fasta scores; E(): 0, 46.1% identity in 583 aa
FT                   overlap. Contains 2x Pfam match to entry PF00391
FT                   PEP-utilizers, PEP-utilizing enzymes, and PS00742
FT                   PEP-utilizing enzymes signature 2"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0392"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07684"
FT                   /db_xref="GOA:A0A0U1RH93"
FT                   /db_xref="InterPro:IPR000121"
FT                   /db_xref="InterPro:IPR006318"
FT                   /db_xref="InterPro:IPR008279"
FT                   /db_xref="InterPro:IPR008731"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR023151"
FT                   /db_xref="InterPro:IPR024692"
FT                   /db_xref="InterPro:IPR036618"
FT                   /db_xref="InterPro:IPR036637"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RH93"
FT                   /protein_id="CAM07684.1"
FT                   /translation="MSIVLHGVAAGKGIAVGCAHLIARGTEEVPQYDVAEADTDAEAER
FT                   FDAAVKATRKELEQLRSAIPENAPTELGAFISLHLMLLTDVTLSREPVDILREQKINAE
FT                   WALKQQSDKLAAQFDNMDDAYLRERKQDMLQVVRRIHNNLIGQGNELEVADNLFDETVL
FT                   IANDLSPADTVLFKEQRIAAFVTDAGGPTGHTAILGRSLDIPSVVGLHNARKLITEGET
FT                   VIVDGINGVLIIAPDESVLNEYRRRAREYRSHKRDLNKLKKTAAATADGVCIELVGNIE
FT                   SAEDVKPLHNLGADGIGLFRSEFLYLNRDTMPSEDEQYEVYSAIVKKMKGKSVTIRTVD
FT                   LGVDKNPRWFGKNSTPNGSLNPALGMTGIRLCLAEPVMFRTQMRAILRAAAHGPVRMMW
FT                   PMITSVSEVRQCLIHLDTAQRQLAERGDAFGKVGIGCMIEIPSAALTVGSILKLVDFIS
FT                   VGTNDLIQYILSVDRGDDSVSHLYQPGHPAVLKMLQHVIRTANRMDKDVSVCGEMAGDT
FT                   AFTRVLLGMGLRRFSMNPNNILPVKNIILHSNVGQLESDIVKVIRCEDEEKSEKLIKQM
FT                   NSVSVEEEADFKGRK"
FT   CDS_pept        complement(363353..364291)
FT                   /transl_table=11
FT                   /locus_tag="NMA0393"
FT                   /product="ABC-transport system ATP-binding protein"
FT                   /note="NMA0393, probable ABC-transport system ATP-binding
FT                   protein, len: 312 aa; similar to e.g. POTA_ECOLI P23858
FT                   spermidine/putrescine transport atp-binding protein POTA
FT                   (378 aa), fasta scores; E(): 0, 44.5% identity in 281 aa
FT                   overlap. Contains Pfam match to entry PF00005 ABC_tran,ABC
FT                   transporter, PS00017 ATP/GTP-binding site motif A (P-loop),
FT                   and PS00211 ABC transporters family signature"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0393"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07685"
FT                   /db_xref="GOA:A0A0U1RH94"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RH94"
FT                   /protein_id="CAM07685.1"
FT                   /translation="MLELNGLCKRFGGKTVADDICLTVGRGKILAVLGRSGCGKSTLLN
FT                   MIAGIVRPDGGEIWLNGENITRMPPEKRRISLMFQDYALFPHMSALENAAFGLKMQKMP
FT                   KAEAESLAMAALAEVGLENEAHRKPEKLSGGEKQRLALARALVVRPSLLLLDESFSSLD
FT                   THLRDRLRRMTAERIRKGGIPAVLVTHSPEEACTAADEIAVMHEGKILQCGTPETLVQT
FT                   PAGVQVAHLMGLPNTDDDRHIPQHAVRFDQDGMECRVLSRTCLPESFSLSVLHPEHGIL
FT                   WLNLDMPHAGEISGNDTVRIHIEDREIVRFR"
FT   CDS_pept        complement(364300..365175)
FT                   /transl_table=11
FT                   /locus_tag="NMA0394"
FT                   /product="hypothetical protein NMA0394"
FT                   /note="NMA0394, unknown, len:291 aa; some similarity to
FT                   N-terminus of TNR3_SCHPO P41888 thiamine pyrophosphokinase
FT                   (569 aa), fasta scores; E(): 4.7e-18, 30.4% identity in 260
FT                   aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0394"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07686"
FT                   /db_xref="GOA:A0A0U1RH95"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR031804"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RH95"
FT                   /protein_id="CAM07686.1"
FT                   /translation="MPTVRFTESVSKHDLDALFEWAKASYGAESCWKTLYLNGLPLGNL
FT                   SPEWAERVKKDWEAGCSESSDGIFLNADGWPDMGRRLQHLARIWKEAGLLHGWRDECFD
FT                   LTDGGSNPLFALERAAFRPFGLLSRAVHLNGLVESDGRWHFWIGRRSPHKAVDPDKLDN
FT                   TAAGGVSSGELPSETVCRESSEEAGLDKTLLPLIRPVSQLHSLRPVSRGVHNEILYVFD
FT                   AVLPETFLPENQDGEVAGFEKMDIGGLLAAMLSGNMMHDAQLVTLDAFCRYGLIDAAHP
FT                   LSEWLDGIRL"
FT   CDS_pept        365773..367674
FT                   /transl_table=11
FT                   /locus_tag="NMA0397"
FT                   /product="thiamin biosynthesis protein"
FT                   /note="NMA0397, thiC, thiamin biosynthesis protein, len:
FT                   633 aa; similar to many e.g. THIC_ECOLI P30136 thiamin
FT                   biosynthesis protein THIC (631 aa), fasta scores; E():
FT                   0,68.4% identity in 637 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0397"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07687"
FT                   /db_xref="GOA:Q9JWF3"
FT                   /db_xref="InterPro:IPR002817"
FT                   /db_xref="InterPro:IPR025747"
FT                   /db_xref="InterPro:IPR037509"
FT                   /db_xref="InterPro:IPR038521"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9JWF3"
FT                   /protein_id="CAM07687.1"
FT                   /translation="MTTPKKTAKTSGNEARELADLSEDIGIRFKYPNSERVYLQGSRDD
FT                   IRVPLREIRQDDTYTAQGAEANPPIPVYDTSGVYGDPAAHIDLKQGLPHIRTVWLDERG
FT                   DTEILPKLSSEYGIERAHDPKTAHLRFNQITRPRRAKAGRNVTQLHYARQGIITPEMEF
FT                   VAIRERLKLDELSQKPEYAKLLKQHAGQSFGANIPTHPDQITPEFVRREIAAGRAIIPA
FT                   NINHPELEPMIIGRNFRVKINGNLGNSAVTSSLTEEVEKMVWSLRWGADTIMDLSTGAH
FT                   IHETREWIIRNAPVPIGTVPIYQALEKTGGIAEDLTWDLFRDTLIEQAEQGVDYFTIHA
FT                   GVLLRYVPMTANRLTGIVSRGGSIMAKWCLAHHRENFLYTHFDEICEIMKAYDVSFSLG
FT                   DGLRPGCIADANDESQFAELHTLGELTDKAWKHDVQVMIEGPGHVPLQRVKENMTEELQ
FT                   HCFEAPFYTLGPLVTDIAPGYDHITSGIGAANIGWYGTAMLCYVTPKEHLGLPDKEDVR
FT                   TGIITYKLAAHAADLAKGWPGAQLRDNALSKARFEFRWRDQFRLSLDPERAESFHDETL
FT                   PAEGAKIAHFCSMCGPKFCSMKITQEVRDYADKQKAQRQGMEEKAVEFVKKGAKIYS"
FT   CDS_pept        complement(369454..370443)
FT                   /transl_table=11
FT                   /locus_tag="NMA0398"
FT                   /product="porin, major outer membrane protein P.I"
FT                   /note="NMA0398, porB, porin, major outer membrane protein
FT                   P.I, len: 329 aa; almost identical to many e.g. OMB2_NEIME
FT                   P30688 major outer membrane protein P.IB precursor (331
FT                   aa), fasta scores; E(): 0, 94.9% identity in 331 aa
FT                   overlap. Contains Pfam match to entry PF00267
FT                   Gram-ve_porins, General diffusion Gram-negative porins, and
FT                   PS00576 General diffusion Gram-negative porins signature.
FT                   Also similar to NMA1642, porA (43.7% identity in 398 aa
FT                   overlap)"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0398"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07688"
FT                   /db_xref="GOA:P57042"
FT                   /db_xref="InterPro:IPR001702"
FT                   /db_xref="InterPro:IPR002299"
FT                   /db_xref="InterPro:IPR013793"
FT                   /db_xref="InterPro:IPR023614"
FT                   /db_xref="InterPro:IPR033900"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57042"
FT                   /protein_id="CAM07688.1"
FT                   /translation="MKKSLIALTLAALPVAAMADVTLYGTIKTGVETSRSVEHNGGQVV
FT                   SVETGTGIVDLGSKIGFKGQEDLGNGLKAIWQVEQKASIAGTDSGWGNRQSFIGLKGGF
FT                   GKLRVGRLNSVLKDTGDINPWDSKSDYLGVNKIAEPEARLISVRYDSPEFAGLSGSVQY
FT                   ALNDNVGRHNSESYHAGFNYKNGGFFVQYGGAYKRHQDVDDVKIEKYQIHRLVSGYDND
FT                   ALYASVAVQQQDAKLVEDNSHNSQTEVAATLAYRFGNVTPRVSYAHGFKGSVDDAKRDN
FT                   TYDQVVVGAEYDFSKRTSALVSAGWLQEGKGENKFVATAGGVGLRHKF"
FT   CDS_pept        complement(371688..372005)
FT                   /transl_table=11
FT                   /locus_tag="NMA0400"
FT                   /product="PEMK-like protein"
FT                   /note="NMA0400, chpA, PEMK-like protein, len: 105 aa;
FT                   simlar to e.g. CHPA_ECOLI P33645 PEMK-like protein 1 (MAZF
FT                   protein) (111 aa), fasta scores; E(): 7e-06, 38.9% identity
FT                   in 72 aa overlap, and PEMK_ECOLI P13976 Plasmid IncFII R100
FT                   PEMK protein (133 aa), fasta scores; E(): 5.9e-05, 32.7%
FT                   identity in 107 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0400"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07689"
FT                   /db_xref="GOA:A0A0U1RH96"
FT                   /db_xref="InterPro:IPR003477"
FT                   /db_xref="InterPro:IPR011067"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RH96"
FT                   /protein_id="CAM07689.1"
FT                   /translation="MVVRGGIYLVSLDPTVGSEIKKTRPCVVVSPPEIHNYLKTVLIVP
FT                   MTSGSRPAPFRVNVRFQDKDGLLLPEQIRAVDKAGLVKHLGNLDNSTAEKLFAVLQEMF
FT                   A"
FT   CDS_pept        complement(371999..372238)
FT                   /transl_table=11
FT                   /locus_tag="NMA0401"
FT                   /product="hypothetical protein NMA0401"
FT                   /note="NMA0401, unknonwn, len: 79 aa"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0401"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07690"
FT                   /db_xref="InterPro:IPR037914"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RH97"
FT                   /protein_id="CAM07690.1"
FT                   /translation="MILNIRKMGNSQGVILPKSLLGQIGAVDSLAVTVEKGNIILSCPT
FT                   VRRGWAEAAAMLVETEQEHFFSEIENEADKEWIW"
FT   CDS_pept        complement(372361..373158)
FT                   /transl_table=11
FT                   /locus_tag="NMA0402"
FT                   /product="tRNA pseudouridine synthase"
FT                   /EC_number="4.2.1.70"
FT                   /note="NMA0402, truA, probable tRNA pseudouridine synthase,
FT                   len: 265 aa; similar to e.g. TRUA_HAEIN P45291 tRNA
FT                   pseudouridine synthase A (EC 4.2.1.70) (269 aa),fasta
FT                   scores; E(): 0, 47.5% identity in 257 aa overlap. Contains
FT                   Pfam match to entry PF01416 PseudoU_synt, tRNA
FT                   pseudouridine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0402"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07691"
FT                   /db_xref="GOA:Q9JWF1"
FT                   /db_xref="InterPro:IPR001406"
FT                   /db_xref="InterPro:IPR020095"
FT                   /db_xref="InterPro:IPR020097"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9JWF1"
FT                   /protein_id="CAM07691.1"
FT                   /translation="MDTAQKQRWAITLSYDGSRFYGWQKQADGVPTVQAALETALAQIA
FT                   GEAVSTTVAGRTDTGVHATAQVVHFDTTAARPQQAWVRGVNAHLPEGIAVLHARQVAPE
FT                   FHARFDAYGRHYRYLLESAPVRSPLLKNRAGWTHLKLDIEPMRRAAAYLIGEQDFSSFR
FT                   AAECQAKSPVKTIYRADLTQSAGLVRLDLHGNAFLHHMVRNIMGALVYVGSGRLSVEGF
FT                   AALIQERSRLKAPPTFMPDGLYLTGVDYPEAYGIIRPQIPEWL"
FT   CDS_pept        complement(374566..375258)
FT                   /transl_table=11
FT                   /locus_tag="NMA0403"
FT                   /product="hypothetical protein NMA0403"
FT                   /note="NMA0403, unknown, len: 230 aa; almost identical to
FT                   TR:AAD38302 (EMBL:AF036242) N. meningitidis NMB
FT                   hypothetical 26.3 kd protein (230 aa), fasta scores; E():
FT                   0, 97.4% identity in 230 aa overlap, and similar to
FT                   TR:O28566 (EMBL:AE000985) Archaeoglobus fulgidus AF1707
FT                   (219 aa), fasta scores; E(): 5.6e-06, 25.1% identity in 215
FT                   aa overlap. Also similar to NMA0032 (53.5% identity in 230
FT                   aa overlap)"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0403"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07692"
FT                   /db_xref="InterPro:IPR002725"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RH98"
FT                   /protein_id="CAM07692.1"
FT                   /translation="MTAFVHTLSDGMELTVEIKRRAKKNLIIRPAGTHTIRISVPPCFS
FT                   VSALNRWLYENEAVLRQTLAKTPPPQTAENRLPESILFHGRQLALTAHQDTQILLMPSE
FT                   IRVPEGAPEKQLALLRDFLERQAHSYLIPRLERHARTTQLFPAPSSLTSAKTFWGVCRK
FT                   TTGIRFNWRLVGAPEYVADYVCIHELCHLAHADHSRAFWALTRRFAPYTPEAKQWLKIH
FT                   GRELFALG"
FT   CDS_pept        complement(375255..375998)
FT                   /transl_table=11
FT                   /locus_tag="NMA0404"
FT                   /product="1-acyl-SN-glycerol-3-phosphate acyltransferase"
FT                   /EC_number="2.3.1.51"
FT                   /note="NMA0404, nlaB, probable
FT                   1-acyl-SN-glycerol-3-phosphate acyltransferase, len: 247
FT                   aa; identical to TR:AAD38301 (EMBL:AF036242) N.
FT                   meningitidis NMB lysophosphatidic acid acyltransferase
FT                   homolog (247 aa), and similar to many e.g. PLSC_BORBU
FT                   Q59188 1-acyl-SN-glycerol-3-phosphate acyltransferase (EC
FT                   2.3.1.51) (250 aa), fasta scores; E(): 4e-11, 31.4%
FT                   identity in 226 aa overlap. Also similar to NMA1504, plsC
FT                   (23.6% identity in 148 aa overlap). Contains N-terminal
FT                   signal sequence"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0404"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07693"
FT                   /db_xref="GOA:A0A0U1RH99"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RH99"
FT                   /protein_id="CAM07693.1"
FT                   /translation="MLIIRNLIYWLILCSTLIFLFPFMLLASPFRDGAHKMARVWVKIL
FT                   NLSLKHIVGLKYRIIGAENIPDRPAVICAKHQSGWETLALQDIFPPQVYVAKRELFKIP
FT                   FFGWGLKLVKTIGIDRNNRREANEQLIKQGLARKNEGYWITIFPEGTRLAPGKRGKYKL
FT                   GGARMAKMFEMDIVPVALNSGEFWPKNSFLKYPGEITVVICPTIPHASGSEAELMGKCE
FT                   HLIETQQPLISGAGPFAAKMPSETA"
FT   CDS_pept        complement(376027..376590)
FT                   /transl_table=11
FT                   /locus_tag="NMA0405"
FT                   /product="putative phosphatase"
FT                   /note="NMA0405, possible phosphatase, len: 187 aa; similar
FT                   to hypothetical proteins e.g. YAED_HAEIN P46452
FT                   hypothetical protein HI0621.1 (184 aa), fasta scores; E():
FT                   1.2e-15, 29.7% identity in 182 aa overlap, and to the
FT                   N-terminal phosphatase domain of e.g. HIS7_ECOLI P06987
FT                   histidine biosynthesis bifunctional protein (355 aa),fasta
FT                   scores; E(): 1.2e-10, 29.5% identity in 139 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0405"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07694"
FT                   /db_xref="GOA:Q9JWE9"
FT                   /db_xref="InterPro:IPR004446"
FT                   /db_xref="InterPro:IPR006543"
FT                   /db_xref="InterPro:IPR006549"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9JWE9"
FT                   /protein_id="CAM07694.1"
FT                   /translation="MKLIILDRDGVINQDRDDFVKSVDEWIPVEGSMDAVAFLTQAGYT
FT                   VAVATNQSGIGRKYFTVQNLTEMHAKMHRLVRQAGGEINGIWFCPHTDADNCNCRKPKP
FT                   GMIEDIIGRFNAQASETWLVGDSLRDLQAIDAVGGKPALVLTGKGKKTLSQHGHELPEH
FT                   TQVFDTLLDFSQYIMQENAAPQAD"
FT   CDS_pept        complement(join(376590..376916,376916..377158))
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="NMA0407"
FT                   /product="pseudogene (putative acetyltransferase)"
FT                   /note="NMA0407, probable acetyltransferase, pseudogene,len:
FT                   569 bp; N-terminus similar to the N-terminal half of
FT                   TR:Q06962 (EMBL:X59554) Vibrio cholerae RFBO protein (188
FT                   aa), fasta scores; E(): 3.8e-06, 36.3% identity in 80 aa
FT                   overlap. C-terminus similar to the C-terminal half of e.g.
FT                   WBBJ_ECOLI P37750 putative lipopolysaccharide biosynthesis
FT                   O-acetyl transferase WBBJ (196 aa), fasta scores; E():
FT                   4.7e-07, 37.3% identity in 83 aa overlap, and VATA_STAAU
FT                   P26839 virginiamycin A acetyltransferase (219 aa), fasta
FT                   scores; E(): 7.4e-06, 37.7% identity in 77 aa overlap.
FT                   Contains Pfam match to entry PF00132 hexapep, Bacterial
FT                   transferase hexapeptide (four repeats), and PS00101
FT                   Hexapeptide-repeat containing-transferases signature.
FT                   Contains a G(12) homopolymeric tract which would allow
FT                   translation as an intact CDS, if variable"
FT   CDS_pept        377328..378980
FT                   /transl_table=11
FT                   /locus_tag="NMA0408"
FT                   /product="putative integral membrane protein"
FT                   /note="NMA0408, probable integral membrane protein, len:
FT                   550 aa; highly similar to Y275_HAEIN P43975 hypothetical
FT                   protein HI0275 (551 aa), fasta scores; E(): 0, 68.4%
FT                   identity in 551 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0408"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07696"
FT                   /db_xref="GOA:A0A0U1RHA0"
FT                   /db_xref="InterPro:IPR000917"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RHA0"
FT                   /protein_id="CAM07696.1"
FT                   /translation="MVAYVFLFLFVTAALVLIIRSHYRWTYFFASALFVFLAGGMLMLT
FT                   AQWQRALNFASVWFVVLILFHRLKIHYYKQPLLISDFLLIADWRNWETLFHYKEAVIGM
FT                   AGLLALAAYAVFGWSGADSLDVPWRWAGAVLFAAAFVSMRHFSKHPGAVKTWLDSLPDD
FT                   GRDVFLNLPMSCRAVFFQVPVFEGDGEAFARQMPSETRPCGMSDEKPDIVVTLMESTLD
FT                   PHCFDFAAAKIPDLKMFGRQEDTVFSSPLRVHTFGGATWKSEFAFLAGVPSTDFGALAS
FT                   GVFYSVVPHLQTGFVRNLREHGYFCVALSPFTKGNYNAKAAYDHFGFNLMFQPQDLGYP
FT                   APMGKNLWHISSEEMMQYARMILEKRHPDLENVRQPMFVYVLTMKEHGPYRTDTDNVFD
FT                   LDAPDLNAKTVSALNDYIGRIADLDKAVESFDRYLHERGKPFVFGYFGDHQVPFEGVSV
FT                   RKKWDYAQPDYVTQFAVRSNIAGGFVQRQNFLDLAFAGGVLMEAAGLEAKDGFMRANMA
FT                   MRGLCGGGLEDCPNWELVGNYRNYLYDVLKIAR"
FT   CDS_pept        complement(379050..380291)
FT                   /transl_table=11
FT                   /locus_tag="NMA0409"
FT                   /product="amino-acid transport protein"
FT                   /note="NMA0409, probable amino-acid transport protein,len:
FT                   413 aa; similar to many e.g. MTR_ECOLI P22306
FT                   tryptophan-specific transport protein (414 aa), fasta
FT                   scores; E(): 0, 47.1% identity in 408 aa overlap,TNAB_ECOLI
FT                   P23173 low affinity tryptophan permease (415 aa), fasta
FT                   scores; E(): 0, 43.5% identity in 409 aa overlap, and
FT                   TYRP_ECOLI P18199 tyrosine-specific transport protein (403
FT                   aa), fasta scores; E(): 0, 36.9% identity in 401 aa
FT                   overlap. Contains PS00594 Aromatic amino acids permeases
FT                   signature"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0409"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07697"
FT                   /db_xref="GOA:A0A0U1RHA1"
FT                   /db_xref="InterPro:IPR013059"
FT                   /db_xref="InterPro:IPR013061"
FT                   /db_xref="InterPro:IPR018227"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RHA1"
FT                   /protein_id="CAM07697.1"
FT                   /translation="MPTKTPSLFGGAMIIAGTVIGAGMLANPTATSGVWFTGSLAVLLY
FT                   TWFSMLSSGLMILEVNTHYPHGASFDTMVKDLLGRSWNIINGIAVAFVLYLLTYAYIFV
FT                   GGDLTAKGLGSAAGGNVSLTVGQLVFFGILAFCVWASARLVDRFTSVLIGGMVLTFIWA
FT                   TGGLIADAKLPVLFDTQAPTGTNYWIYVATALPVCLASFGFHGNVSSLLKYFKGDAPKV
FT                   AKSIWTGTLIALVIYVLWQTAIQGNLPRNEFAPVIAAEGQVSVLIETLSKFAQTGNMDK
FT                   ILSLFSYMAIATSFLGVTLGLFDYIADIFKWNDSVSGRTKTAALTFLPPLISCLLFPTG
FT                   FVTAIGYVGLAATVWTGIIPAMLLYRSRKKFGAGKTYKVYGGLWLMVWVFLFGIVNIAA
FT                   QVLSQMELVPVFKG"
FT   CDS_pept        380455..381171
FT                   /transl_table=11
FT                   /locus_tag="NMA0410"
FT                   /product="3-demethylubiquinone-9 3-methyltransferase"
FT                   /EC_number="2.1.1.64"
FT                   /note="NMA0410, ubiG, probable 3-demethylubiquinone-9
FT                   3-methyltransferase, len: 238 aa; similar to many e.g.
FT                   UBIG_ECOLI P17993 3-demethylubiquinone-9
FT                   3-methyltransferase (EC 2.1.1.64) (240 aa), fasta scores;
FT                   E(): 0, 54.9% identity in 237 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0410"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07698"
FT                   /db_xref="GOA:Q9JWE6"
FT                   /db_xref="InterPro:IPR010233"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9JWE6"
FT                   /protein_id="CAM07698.1"
FT                   /translation="MSDKKYNVDEGEIAKFSRIADKWWDKSGEFKTLHDINPLRLDYID
FT                   GHADLCGKRVLDVGCGGGILAESMARRGAAFVKGIDMAEQSLETARLHAALNNVADIEY
FT                   ECIRVEDLAEAEPHSFDVVTCMEMMEHVPDPAAIVRACAKLVKPDGMVFFSTINKNPKS
FT                   YLHLIVAAEYLLKFVPKGTHDWKKFIVPAELARMCRQAGLDVADTKGMTYHVLSQTYAL
FT                   CDSTDVNYMFACRPAF"
FT   CDS_pept        381201..382124
FT                   /transl_table=11
FT                   /locus_tag="NMA0411"
FT                   /product="putative homoserine kinase"
FT                   /EC_number="2.7.1.39"
FT                   /note="NMA0411, thrB, probable homoserine kinase, len: 307
FT                   aa; similar to KHSE_PSEAE P29364 homoserine kinase (EC
FT                   2.7.1.39) (316 aa), fasat scores; E(): 1.9e-24, 31.3%
FT                   identity in 310 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0411"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07699"
FT                   /db_xref="GOA:Q9JWE5"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR005280"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9JWE5"
FT                   /protein_id="CAM07699.1"
FT                   /translation="MDMSVYTSVSDDEMRGFLSGYDLGEFVSLQGIAQGITNSNYFLTT
FT                   TSGRYVLTVFEVLKQEELPFFLELNRHLSMKGVAVAAPVARKDGRLDSVLAGKPACLVA
FT                   CLKGSDTALPTAEQCFHTGAMLAKMHLAAADFPLEMENPRYDAWWTEACARLLPVLSQD
FT                   DAALLRAEIDALKDNLGNHLPSGIIHADLFKDNVLLDGGQVSGFIDFYYACRGNFMYDL
FT                   AIAVNDWARTADNKLDEALKKAFIGGYEGVRPLSAEEKAYFPTAQRAGCIRFWVSRLLD
FT                   FHFPQAGEMTFIKDPNAFRNLLLSLG"
FT   CDS_pept        complement(382463..382981)
FT                   /transl_table=11
FT                   /locus_tag="NMA0412"
FT                   /product="putative glucokinase"
FT                   /EC_number="2.7.1.12"
FT                   /note="NMA0412, probable glucokinase, len: 172 aa; similar
FT                   to e.g. GNTK_SCHPO Q10242 probable gluconokinase (EC
FT                   2.7.1.12) (193 aa), fasta scores; E(): 1.8e-17, 41.5%
FT                   identity in 176 aa overlap, GNTV_ECOLI P39208
FT                   thermosensitive gluconokinase (EC 2.7.1.12) (187 aa),fasta
FT                   scores; E(): 2e-15, 41.8% identity in 134 aa overlap, and
FT                   GNTK_ECOLI P46859 thermoresistant gluconokinase (EC
FT                   2.7.1.12) (175 aa), fasta scores; E(): 1.2e-16, 37.4%
FT                   identity in 163 aa overlap. Contains PS00017
FT                   ATP/GTP-binding site motif A (P-loop)"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0412"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07700"
FT                   /db_xref="GOA:A0A0U1RHA2"
FT                   /db_xref="InterPro:IPR006001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031322"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RHA2"
FT                   /protein_id="CAM07700.1"
FT                   /translation="MTTHFVVMGVCGCGKTTAALSLQKHLGQCPYAEGDEFHTQANRDK
FT                   MGAGIPLTDEDRYPWLGNLRDWMTQQAQNGANHTIVTCSALKRGYRDILRGAEGKAAFI
FT                   HLSPPQDINLERMMSRKGHYMKAGMLDSQLEILEELGEGEYGVKIANPGTPEAVEADIL
FT                   NWVASENLL"
FT   CDS_pept        complement(383001..384386)
FT                   /transl_table=11
FT                   /locus_tag="NMA0413"
FT                   /product="putative gluconate permease"
FT                   /note="NMA0413, gntP, probable gluconate permease, len: 461
FT                   aa; similar to many e.g. GNTP_BACSU Q9ZIJ1 gluconate
FT                   permease (448 aa), fasta scores; E(): 0, 37.1% identity in
FT                   453 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0413"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07701"
FT                   /db_xref="GOA:A0A0U1RHA3"
FT                   /db_xref="InterPro:IPR003474"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RHA3"
FT                   /protein_id="CAM07701.1"
FT                   /translation="MDGWTQTLSAQTLLGISAAAIILILILIVKFRIHALLTLVIVSLL
FT                   TALATGLPTGSIVNDVLVKNFGGTLGGVALLVGLGAMLGRLVETSGGAQSLADALIRMF
FT                   GEKRAPFALGVASLIFGFPIFFDAGLIVMLPIVFATARRMKQDVLPFALASIGAFSVMH
FT                   VFLPPHPGPIAASEFYGANIGQVLILGLPTAFITWYFSGYMLGKVLGRTIHVPVPELLS
FT                   GGTQDNDLPKEPAKAGTVVAIMLIPMLLIFLNTGVSALISEKLVSADETWVQTAKIIGS
FT                   TPIALLISVLVALFVLGRKRGESGSALEKTVDGALAPVCSVILITGAGGMFGGVLRASG
FT                   IGKALADSMADLGIPVLLGCFLVALALRIAQGSATVALTTAAALMAPAVAAAGFTDWQL
FT                   ACIVLATAAGSVGCSHFNDSGFWLVGRLLDMDVPTTLKTWTVNQTLIALIGFALSALLF
FT                   AIV"
FT   CDS_pept        384727..386319
FT                   /transl_table=11
FT                   /locus_tag="NMA0414"
FT                   /product="putative permease"
FT                   /note="NMA0414, probable permease, len: 530 aa; similar to
FT                   many e.g. YABK_ECOLI P31549 (536 aa), fasta scores; E():
FT                   1.1e-14, 28.0% identity in 517 aa overlap, and MODB_ECOLI
FT                   P09834 molybdenum transport system permease protein (229
FT                   aa), fasta scores; E(): 9.1e-12, 29.8% identity in 198 aa
FT                   overlap. Contains 2x Pfam match to entry PF00528
FT                   BPD_transp, Binding-protein-dependent transport systems
FT                   inner membrane component, and PS00402
FT                   Binding-protein-dependent transport systems inner membrane
FT                   comp sign"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0414"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07702"
FT                   /db_xref="GOA:A0A0U1RHA4"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RHA4"
FT                   /protein_id="CAM07702.1"
FT                   /translation="MGLLGTIATSVFQVGKAMDGRRWAVWGAFALLPSAFLAAMVVAPL
FT                   WAVAAYDGLAWRAVLSDAYMLKRLAWTVFQAAATCVLVLPLGVPVAWVLARLAFPGRAL
FT                   VLRLLMLPFVMPTLVAGVGVLALFGADGLLWRGWQDTPYLLLYGNVFFNLPVLVRAAYQ
FT                   GFVQVPAARLQTARTLGAGAWRRFWDIEMPVLRPWLAGGVCLVFLYCFSGFGLALLLGG
FT                   SRYATVEVEIYQLVMFELDMAVASVLVWLVLGVTAAAGLLYAWFGRRAVSDKAVSPVMP
FT                   SPPQSVGEYVLLAFAAAVLSVCCLFPLLAIVVKAWSAGESWRVLMESETWQAVWNTLRF
FT                   SAAAVYAAAVLGVVYAAAARRSAWMRGLMFLPFMVSPVCVSAGVLLLYPQWTASLPLLL
FT                   AMYALLAYPFVAKDVLSAWDALPPDYGRAAAGLGANGFQTACRITFPLLKPALRRGLTL
FT                   AAATCVGEFAATLFLSRPEWQTLTTLIYAYLGRAGEDNYARAMVLTLLLAAFALGIFLL
FT                   LDGGEGGKRTETL"
FT   CDS_pept        386348..386947
FT                   /transl_table=11
FT                   /locus_tag="NMA0415"
FT                   /product="hypothetical protein NMA0415"
FT                   /note="NMA0415, unknown, len: 199 aa; similar to
FT                   hypothetical proteins e.g. TR:O34872 (EMBL:AF008220)
FT                   Bacillus subtilis YTIB (187 aa), fasta scores; E(): 0,55.4%
FT                   identity in 184 aa overlap, and to CYNT_ECOLI P17582
FT                   carbonic anhydrase (EC 4.2.1.1) (219 aa), fasta scores;
FT                   E(): 0.067, 31.5% identity in 108 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0415"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07703"
FT                   /db_xref="GOA:A0A0U1RHA5"
FT                   /db_xref="InterPro:IPR001765"
FT                   /db_xref="InterPro:IPR036874"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RHA5"
FT                   /protein_id="CAM07703.1"
FT                   /translation="MSELDNILAHNRQFVESGEYEKYFTDKYPERGLAVLSCMDARIIG
FT                   LLPDALGLKNGDAKLIKNAGALVTHPWGSVMRSLLVAVFELKVREIMVIAHHDCGMQGL
FT                   NAEEFLGRVRESRIPEDRIETLRYAGIDLDGWLTGFDNVEDSVRHTVDLIRNHPLMPRH
FT                   IAVHGLVIHPVTGKLTLVVDGSVSDGMDLSEGMETS"
FT   CDS_pept        386944..387537
FT                   /transl_table=11
FT                   /locus_tag="NMA0416"
FT                   /product="hypothetical protein NMA0416"
FT                   /note="NMA0416, unknown, len: 197 aa; similar to many
FT                   hypothetical proteins, e.g. YQEJ_BACSU P54455 (189
FT                   aa),fasta scores; E(): 1.7e-17, 35.5% identity in 203 aa
FT                   overlap"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0416"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07704"
FT                   /db_xref="GOA:P57089"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR005248"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57089"
FT                   /protein_id="CAM07704.1"
FT                   /translation="MKKIGLFGGTFDPIHNGHLHIARAFADEIGLDAVVFLPTGGPYHK
FT                   DAASASAADRLAMVELATAEDARFAVSDCDIVREGATYTFDTVQIFRQQFPSAQLWWLM
FT                   GSDSLMKLHTWKKWQMLVRETNIAVAMRQGDSLHQTPRELHAWLGKSLQDGSVRILSAP
FT                   MHNVSSTEIRRAGVSDGIPPAAARYIREHGLYEK"
FT   CDS_pept        387596..387982
FT                   /transl_table=11
FT                   /locus_tag="NMA0417"
FT                   /product="hypothetical protein NMA0417"
FT                   /note="NMA0417, unknown, len: 128 aa; similar to many
FT                   hypothetical proteins, e.g. YBEB_ECOLI P05848 (105
FT                   aa),fasta scores; E(): 3e-10, 36.4% identity in 110 aa
FT                   overlap"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0417"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07705"
FT                   /db_xref="GOA:A0A0U1RHA6"
FT                   /db_xref="InterPro:IPR004394"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RHA6"
FT                   /protein_id="CAM07705.1"
FT                   /translation="MNEQELQDLQKMVGVAVNALGDIKAKDISVLETQDKTSLFARMII
FT                   ASGDSTRQVKALANNVAVDLKEAGFEILSTEGDSGEWTLVDAGDLVVHVMLPAVRDFYD
FT                   IDTLWGGEKPSFHAGMQKPWHAAD"
FT   CDS_pept        388036..388506
FT                   /transl_table=11
FT                   /locus_tag="NMA0418"
FT                   /product="hypothetical protein NMA0418"
FT                   /note="NMA0418, unknown, len: 156 aa; similar to many
FT                   hypothetical proteins, e.g. YBEA_ECOLI P05850 (155
FT                   aa),fasta scores; E(): 1.1e-19, 41.0% identity in 156 aa
FT                   overlap"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0418"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07706"
FT                   /db_xref="GOA:P67518"
FT                   /db_xref="InterPro:IPR003742"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/Swiss-Prot:P67518"
FT                   /protein_id="CAM07706.1"
FT                   /translation="MNITVLAVGTKMPRWVDEAVAEYAKRFGRDVAYALKEIKPEKRGA
FT                   GVNAAQGMAAEEKRILEAIPQGAFLVVLDERGKAPTSVELAEHLKSWRQNGEHVCFVIG
FT                   GADGMTDRLKQQARMMMRLSSLTLPHGMVRVFLTEQLYRAVSILHNHPYHRE"
FT   CDS_pept        388579..388845
FT                   /transl_table=11
FT                   /locus_tag="NMA0419"
FT                   /product="hypothetical protein NMA0419"
FT                   /note="NMA0419, unknown, len: 88 aa; similar to many
FT                   hypothetical proteins, e.g. YGGX_ECOLI P52065 (90 aa),fasta
FT                   scores; E(): 8.2e-15, 44.3% identity in 88 aa overlap.
FT                   Contains GC(6) repeat near C-terminus"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0419"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07707"
FT                   /db_xref="GOA:P67615"
FT                   /db_xref="InterPro:IPR007457"
FT                   /db_xref="InterPro:IPR036766"
FT                   /db_xref="UniProtKB/Swiss-Prot:P67615"
FT                   /protein_id="CAM07707.1"
FT                   /translation="MARMVFCVKLNKEAEGMKFPPLPNELGKRIFENVSQEAWAAWTRH
FT                   QTMLINENRLSLADPRAREYLAQQMEQYFFGDGADAVQGYVPQ"
FT   CDS_pept        389002..389685
FT                   /transl_table=11
FT                   /locus_tag="NMA0420"
FT                   /product="putative integral membrane protein"
FT                   /note="NMA0420, probable integral membrane protein, len:
FT                   227 aa; similar to many hypothetical proteins, e.g.
FT                   YCCA_ECOLI P06967 (219 aa), fasta scores; E():
FT                   2.5e-18,36.7% identity in 215 aa overlap. Contains Pfam
FT                   match to entry PF01027 UPF0005, Uncharacterized protein
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0420"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07708"
FT                   /db_xref="GOA:P63701"
FT                   /db_xref="InterPro:IPR006214"
FT                   /db_xref="UniProtKB/Swiss-Prot:P63701"
FT                   /protein_id="CAM07708.1"
FT                   /translation="MQHDVYDYTAHTVSKNTVLQKTYRLLGFSFIPASAGAALAANAGF
FT                   NFYAAFGSRWIGFAVVLAFFYGMIHFIEKNRYSNTGVTLLMVFTFGMGVLIGPVLQYAL
FT                   HIADGAKIVGIAAAMTAAVFLTMSALARRTRLDMNALGRFLTVGAVILMVAVVANLFLG
FT                   IPALALTISAGFVLFSSLMIMWQVRTVIDGGEDSHISAALTLFISLYNIFSSLLNILLS
FT                   LNGED"
FT   CDS_pept        389809..390321
FT                   /transl_table=11
FT                   /locus_tag="NMA0421"
FT                   /product="putative lipopolysaccharide core biosynthesis
FT                   protein"
FT                   /note="NMA0421, kdtB, probable lipopolysaccharide core
FT                   biosynthesis protein, len: 170 aa; similar to many e.g.
FT                   KDTB_ECOLI P23875 lipopolysaccharide core biosynthesis
FT                   protein (159 aa), fasta scores; E(): 2.1e-19, 34.6%
FT                   identity in 159 aa overlap. Contains Pfam match to entry
FT                   PF01467 Cytidylyltransf, Cytidylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0421"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07709"
FT                   /db_xref="GOA:P63816"
FT                   /db_xref="InterPro:IPR001980"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/Swiss-Prot:P63816"
FT                   /protein_id="CAM07709.1"
FT                   /translation="MLPNTPRRAVYAGSFDPPTLGHLWMIRQAQSMFDELIVAIGINPD
FT                   KRSTYTVAERQDMLCDITKMFPNVRTDVFENRFLVHYAREVDAGFIVRGIRSASDYEYE
FT                   RSMRHINSDLAPEISTVFLMPPREIAEVSSTMVKGLVGPEGWTETIHRYVPQAVYEKIL
FT                   AEHQHEN"
FT   CDS_pept        390347..391009
FT                   /transl_table=11
FT                   /locus_tag="NMA0422"
FT                   /product="putative psedouridine synthase"
FT                   /note="NMA0422, probable psedouridine synthase, len: 220
FT                   aa; similar to hypothetical proteins e.g. Y042_HAEIN P43930
FT                   hypothetical protein HI0042 (224 aa), fasta scores; E(): 0,
FT                   51.9% identity in 214 aa overlap, and to ribosomal
FT                   psedouridine synthases e.g. RLUA_ECOLI P39219 ribosomal
FT                   large subunit pseudouridine synthase A (218 aa), fasta
FT                   scores; E(): 9.3e-12, 33.5% identity in 182 aa overlap.
FT                   Contains Pfam match to entry PF00849 YABO, Hypothetical
FT                   yabO/yceC/sfhB family, and PS01129 Hypothetical
FT                   yabO/yceC/sfhB family signature"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0422"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07710"
FT                   /db_xref="GOA:A0A0U1RHA7"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR006224"
FT                   /db_xref="InterPro:IPR006508"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RHA7"
FT                   /protein_id="CAM07710.1"
FT                   /translation="MDMLEILFRHQDFVAINKPGGISVHQDSGETRLARTLAIQLGVER
FT                   VWLLHRLDKQTSGILLFALNRESASALSGQFVGKSIKKTYLALSDRKPSKKQGWIKGGM
FT                   EKSRCGMWKLTRNTENIAVTRFHSISIAEKLRLFILEPHTGKTHQLRVAMKSLGSPILG
FT                   DSLYGGTESETMFLYAWKIQFDYQNRQIEIVAPLKNEWQTENIHRALEEFCMENKID"
FT   CDS_pept        396694..397158
FT                   /transl_table=11
FT                   /locus_tag="NMA0423"
FT                   /product="putative DNA transport competence protein"
FT                   /note="NMA0423, possible DNA transport competence
FT                   protein,len: 154 aa; region of similarity to SW:P39694
FT                   (CME1_BACSU) ComE a late competence operon protein from
FT                   Bacillus subtilis (205 aa) fasta scores; E(): 6.2e-07,47.6%
FT                   identity in 63 aa overlap. Almost identical to TR:CAB44958
FT                   (EMBL:AJ242837) ComEA protein (fragment) from Neisseria
FT                   meningitidis serogroup A strain Z2491 (170 aa) fasta
FT                   scores; E(): 0, 98.7% identity in 154 aa overlap. Contains
FT                   Pfam match to entry PF00633 HHH,Helix-hairpin-helix motif
FT                   and possible membrane-spanning hydrophobic region.
FT                   Identical to NMA0211, and almost identical to NMA1915
FT                   (98.7% identity in 154 aa overlap), and NMA2187 (98.7%
FT                   identity in 154 aa overlap)"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0423"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07711"
FT                   /db_xref="GOA:A0A0U1RGY6"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR004509"
FT                   /db_xref="InterPro:IPR004787"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RGY6"
FT                   /protein_id="CAM07711.1"
FT                   /translation="MLCPEKMSGMAGQYPYGVRSGLRRNGLKLWDIHFRMTRFIVARCG
FT                   LLFATLKGKTMKKMFVLFCMLFSCAFSLAAVNINAASQQELEALPGIGPAKAKAIAEYR
FT                   AQNGAFKSVDDLTKVKGIGPAVLAKLKDQASVGAPAPKGPAKPVLPADKK"
FT   CDS_pept        397246..397695
FT                   /transl_table=11
FT                   /locus_tag="NMA0424"
FT                   /product="putative pilin"
FT                   /note="NMA0424, probable pilin, len: 149 aa; similar to
FT                   e.g. FMM1_NEIGO P02974 fimbrial protein precursor (pilin)
FT                   (165 aa), fasta scores; E(): 0.00029, 24.7% identity in 154
FT                   aa overlap. Contains PS00409 Prokaryotic N-terminal
FT                   methylation site"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0424"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07712"
FT                   /db_xref="GOA:A0A0U1RHA9"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="InterPro:IPR031982"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RHA9"
FT                   /protein_id="CAM07712.1"
FT                   /translation="MTDNRGFTLVELISVVLILSVLALIVYPSYRNYVEKAKINTVRAA
FT                   LLENAHFMEKFYLQNGRFKQTSTKWPSLPIKEAEGFCIRLNGIARGALDSKFMLKAVAI
FT                   DKDKNPFIIKMNENLVTFICKKSASSCSDGLDYFKGNDKDCKLLK"
FT   CDS_pept        complement(397856..398125)
FT                   /transl_table=11
FT                   /locus_tag="NMA0425"
FT                   /product="hypothetical protein NMA0425"
FT                   /note="NMA0425, unknown, len: 89 aa"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0425"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07713"
FT                   /db_xref="GOA:A0A0U1RHB0"
FT                   /db_xref="InterPro:IPR010394"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RHB0"
FT                   /protein_id="CAM07713.1"
FT                   /translation="MSNVHPYTIFATIPHKSTAKDILIMSYDLSKRLVIGLASSALFDL
FT                   SESDNIFRMEGAETYRQYQREKQNHPLKKALSFHLLKNFCQSMK"
FT   CDS_pept        398752..399807
FT                   /transl_table=11
FT                   /locus_tag="NMA0427"
FT                   /product="modification methylase (cytosine-specific DNA
FT                   methylase)"
FT                   /EC_number="2.1.1.73"
FT                   /note="NMA0427, probable modification methylase
FT                   (cytosine-specific DNA methylase), len: 351 aa; similar to
FT                   many e.g. MTD2_HERAU P25265 modification methylase HgiDII
FT                   (EC 2.1.1.73) (354 aa), fasta scores; E(): 0, 39.7%
FT                   identity in 345 aa overlap. Contains 2x Pfam match to entry
FT                   PF00145 DNA_methylase, C-5 cytosine-specific DNA methylase"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0427"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07714"
FT                   /db_xref="GOA:A0A0U1RHB1"
FT                   /db_xref="InterPro:IPR001525"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RHB1"
FT                   /protein_id="CAM07714.1"
FT                   /translation="MKNSKLKAVDFFCGGGGMSYGMQSAGIQVLAGIDYEPSCKETYEA
FT                   NINAKFIQADVFELQPETLEKELGLKKNDDDLILIGCSPCQYWSVIQTDKRKSEKSKSL
FT                   LLEFQRFVEYFNPGYVVVENVPGILSRMKESRLDNFIKLLEEKGFTVHFGIHNTADYGI
FT                   PQSRKRFTLIANRITKEKLEPVKYSGKRLTVRDVLGMENGFPKIIAGHQDETDFMHSCA
FT                   GLSDINLKRLALIPKNGGNRLAFAHIPELQLECFIGKDNSFKDTFGRLWWDKPAPTITT
FT                   KFFSISNGRFAHPEEDRALSLREGATLQSFPRNYVFKAGSRDKIARLIGNAVPPMYAEK
FT                   IGRAIVDNIEC"
FT   CDS_pept        399821..401467
FT                   /transl_table=11
FT                   /locus_tag="NMA0428"
FT                   /product="conserved hypothetical protein"
FT                   /note="NMA0428, conserved hypothetical protein, len: 560aa;
FT                   similar to many of undefined function eg. SW:P25280
FT                   (YD3M_HERAU) hypothetical protein from Herpetosiphon
FT                   aurantiacus (Herpetosiphon giganteus) (611 aa) fasta
FT                   scores; E(): 2.6e-15, 30.1% identity in 369 aa overlap.
FT                   Lies in a region of unusually low GC content. Also shows
FT                   weak similarity to SW:P70754 (MUTL_AQUPY) DNA mismatch
FT                   repair protein from Aquifex pyrophilus (426 aa) fasta
FT                   scores; E(): 4.4, 26.4% identity in 292 aa overlap."
FT                   /db_xref="EnsemblGenomes-Gn:NMA0428"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07715"
FT                   /db_xref="InterPro:IPR012654"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RHB2"
FT                   /protein_id="CAM07715.1"
FT                   /translation="MSEEKLKMSFEPTVIEHLGVKMYSHTVPAIAELIANAYDACATEV
FT                   EVRLFDKPEHKIVIKDNGIGMSFDEINDFYLRIGRNRREEKQASPCGRIPTGKKGLGKL
FT                   ALFGLGNKIEISTIQGNERVTFTLDYAEIRRSKGIYQPEFRKESVESNIESGTTITLTE
FT                   LTKKQGYPLDNYVEHLSRLFDFPAQDFKIKVSLNGSEPKIIDGNLKYDLVTPQFEWEYQ
FT                   DLATNISSLSSKFEQYEYSGLIQGKFITTEKPLKNNMKGITLFANGRMVNMPEFFTDSE
FT                   SSHFYSYLTGWLNVDFIDNDDEDLIATDRTSLDWKHSKTSKLRVFLGEIVRAIGQDWRK
FT                   RRKKEKDDEVKGESGVDIEDWKNKLPEKEREPVEVILNRLEDSELTNKEQAEVISALHS
FT                   IIPEYPYYHWRHLHQDLHTACNDFYNEKKDYLSAAIEAVKVFEDKVQKQTGLHSIDGRE
FT                   LIEQAFGSKNSILLLTNNKTKAEQNLEDGLEQLACGTWTGFRNPVQHELRANLSPSIFN
FT                   DKDALDLISLVSYLLRKVEQTKKRSKVVSSK"
FT   CDS_pept        401471..401893
FT                   /transl_table=11
FT                   /locus_tag="NMA0429"
FT                   /product="patch repair protein"
FT                   /EC_number="3.1.-.-"
FT                   /note="NMA0429, vsr, patch repair protein, len: 140aa;
FT                   similar to SW:P09184 (VSR_ECOLI) vsr, patch repair protein
FT                   from Escherichia coli (156 aa) fasta scores; E():
FT                   9.8e-21,39.3% identity in 122 aa overlap. Lies in a region
FT                   of unusually low GC content."
FT                   /db_xref="EnsemblGenomes-Gn:NMA0429"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07716"
FT                   /db_xref="GOA:Q9JWD6"
FT                   /db_xref="InterPro:IPR004603"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9JWD6"
FT                   /protein_id="CAM07716.1"
FT                   /translation="MTDIFTTSKRSFVMLKIHSKETKPEVLVRKFLFFQGFRYRKNDKR
FT                   YVGKPDIVLSKYKTVVFIHGCFWYGHSCNKGHIPKSNTDFWLEKITKNCERDIKNETEL
FT                   EKIGFKVIVVWECELKNKAICRERLNRLVREIKDAV"
FT   CDS_pept        complement(401916..405041)
FT                   /transl_table=11
FT                   /locus_tag="NMA0430"
FT                   /product="putative DNA helicase"
FT                   /note="NMA0430, possible DNA helicase, len: 1041aa; regions
FT                   similar to many eg. SW:P43329 (HRPA_ECOLI) ATP-dependent
FT                   helicase from Escherichia coli (1281 aa) fasta scores; E():
FT                   0, 30.6% identity in 1035 aa overlap. Contains a direct
FT                   degenerate repeat (408-473, 474-531) which is absent from
FT                   homologues."
FT                   /db_xref="EnsemblGenomes-Gn:NMA0430"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07717"
FT                   /db_xref="GOA:A0A0U1RHB3"
FT                   /db_xref="InterPro:IPR007502"
FT                   /db_xref="InterPro:IPR011709"
FT                   /db_xref="InterPro:IPR024590"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RHB3"
FT                   /protein_id="CAM07717.1"
FT                   /translation="MQNMKNQVRGSGMDARSNPANVSDGLQNSSGHIGTNTRYRLTKLG
FT                   EQMARLPIDPKIARILLAAKKHDCMAEILVIASALSIQDPRERPLEARDAAAKAHERFT
FT                   DKQSDFLAYLNIWDSFQRERDKGLSNKQLVQWCRQYFLSHLRMREWRELHHQLAQTAIE
FT                   MGLTTKEAAFRRLSEIKQLTSSENQGDQDLSAKRKQKQLDKKQHRAQIRAAKEAGYEQI
FT                   HRALLTGLIANVGMKSPDGNDYTGARGSRFHLFPASALFKAKPKWVMAAELVETTKLYA
FT                   RDVAVIQPEWIEQEAPHLVRYHYFEPHWEQKRGEVVASERVTLYGLTVLPRRPVPYGKV
FT                   APEEAREIFIRSALVAQECDLKADFFVHNKKLIKEITELEHKSRKQDVLVDDEALFAFY
FT                   HERLPDFYTADAVSDGLRPANPQQTAPSYAREERREGKTVAAQTNFSATAANPLPNPLP
FT                   QEREQSAAASAVSNDLHPANPQQTAPSPVGEGRGEGKTVASQTNFSATTANPLPNPLPQ
FT                   EGEQSAAASAVSNDPKPKKQPAPPKGRLKPLPLADIRTFQAWLKTAKRDNPRLLFLSRD
FT                   DLMQHAAAHITEEQFPKFWQTADGKFKLSYRFEPHHPLDGVTMTVPLTVLNRLHAPSLE
FT                   WLVPGMLREKIQLLIKALPKQIRRICVPVPDFITKFLESNPDRQAVIIPQLAHFIAKSA
FT                   GDMRIFEQIDQDAWAAQELPEHCYLNLLIIDDGGQELAGGRKLHELQQQLGQAAAVTFR
FT                   DNTQEFERDNVTTWDIGTLPESIKFARGKQQLTGYLGLQKEKDGRIALRLCDTTEAAEQ
FT                   AHRQGVIELMKLQLKEQVKDLNKGIQGFTQAAMLLKHINADTLRDDLTQAVCDRAFIGE
FT                   DELPRNEKAFKEQIKRARSRLPAVKEALSRYLQETAAAYAELNGKLGKHPLTHLLRLRL
FT                   QTLLAAGFATRTPWAQWPRLPIYLKAMTLRLEKYSSNPARDAAREADIQELEQMWQEKN
FT                   DGLVKQGLPVSDDLTAFKWMIEELRVSLFAQELKTPYPVSVKRLLKEWEDLN"
FT   CDS_pept        complement(405107..406381)
FT                   /transl_table=11
FT                   /locus_tag="NMA0431"
FT                   /product="putative inner membrane protein"
FT                   /note="NMA0431, possible inner membrane protein, len:
FT                   424aa; contains possible membrane-spanning hydrophobic
FT                   regions. Lies in a region of unusually low GC content."
FT                   /db_xref="EnsemblGenomes-Gn:NMA0431"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07718"
FT                   /db_xref="GOA:A0A0U1RHB4"
FT                   /db_xref="InterPro:IPR000917"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="InterPro:IPR040423"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RHB4"
FT                   /protein_id="CAM07718.1"
FT                   /translation="MKKSLFVLFLYSSLLTASEIAYRFVFGIETLPAAKMAETFALTFV
FT                   IAALYLFARYKATRLLIAVFFAFSIIANNVHYAVYQSWITGINYWLMLKEITEVGGAGA
FT                   SMLDKLWLPALWGVLEVMLFCSLAKFRRKTHFSADILFAFLMLMIFVRSFDTKQEHGIS
FT                   PKPTYSRIKANYFSFGYFVGRVLPYQLFDLSKIPVFKQPAPSRIGQGSIQNIVLIMGES
FT                   ESAAHLKLFGYGRETSPFLTQLSQADFKPIVKQSYSAGFMTAVSLPSFFNVIPHANGLE
FT                   QISGGDIVDKYDNTIHKTDQMIQTVFEQLQKQPDGNWLFAYTSDHGQYVRQDIYNQGTV
FT                   QPDSYLVPLVLYSPDKAVQQAANQAFAPCEIAFHQQLSTFLIHTLGYDMPVSGCREGSV
FT                   TGNLITGDAGSLNIRDGKAEYVYPQ"
FT   CDS_pept        complement(406562..407689)
FT                   /transl_table=11
FT                   /locus_tag="NMA0432"
FT                   /product="hypothetical protein"
FT                   /note="NMA0432, hypothetical protein, len: 375aa;"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0432"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07719"
FT                   /db_xref="InterPro:IPR041494"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RHB5"
FT                   /protein_id="CAM07719.1"
FT                   /translation="MKHLLIDFENVQPQNLDKLPTENTHIWLFIGVLHKMLPISLVQSL
FT                   LRFGERVHLVQLQKTGKNALDFYLSYYLGQITATDPNAQIGILSRDGGYDVLVEHILKN
FT                   HQAKGIVRLANIDEVQHQKITTEPPSALLENTPQPETTLKPQQPLTSYFQAALTALRRP
FT                   DAFRPCRLHNLRQNLRKHILSDLFKEKTDEECEITTANVINKLKAQNFISIDEQETVSY
FT                   HLSDNDLLQRIQRHILSQRPKTYADFQAVVQNRADALHLTVGTNDIQSFARHLRDQNLI
FT                   RQNNGEIEYAPFTEPKPQPTPKQPKKTAWESDEIIWKKVIAALSLKNRPNKTKTLRNTI
FT                   QALTKSNAQETDKLLQHLQDTQVLRIDGTKIVYIK"
FT   CDS_pept        complement(407790..409181)
FT                   /transl_table=11
FT                   /locus_tag="NMA0433"
FT                   /product="ATP-dependent DNA helicase"
FT                   /note="NMA0433, hrpA', ATP-dependent DNA helicase, len:
FT                   495aa; similar to regions of many eg. SW:P43329
FT                   (HRPA_ECOLI) hrpA, ATP-dependent DNA helicase from
FT                   Escherichia coli (1281 aa) fasta scores; E(): 0, 64.5%
FT                   identity in 453 aa overlap. Contains Prosite match to
FT                   PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /db_xref="EnsemblGenomes-Gn:NMA0433"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07720"
FT                   /db_xref="GOA:A0A0U1RHB6"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010222"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042035"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RHB6"
FT                   /protein_id="CAM07720.1"
FT                   /translation="MSPNFAQTLSKDRHFLQSAFKNPNKYGGLSKVEEKYRKSHEIFLK
FT                   RLAALPKPEFDNTLPVHEKLDEIKKAIAEHQVTIICGETGSGKTTQLPKICLELGRGAA
FT                   GLIGHTQPRRLAARSVAERIAEELKSEIGSAVGYKVRFTDHTSRDACVKLMTDGILLAE
FT                   TQTDRYLAAYDTIIIDEAHERSLNIDFLLGYLKQLLPRRPDLKVIITSATIDAERFSQH
FT                   FNGAPVLEVSGRTYPVEILYRPLTGKDEDDAEVELTDAIVDAADELARHGEGDILVFLP
FT                   GEREIRETAEALRKSTLRRNDEILPLFARLSHAEQHKIFHPSGAKRRIVLATNVAETSL
FT                   TVPGIKYVIDTGLARVKRYSARAKVEQLHVEKISQAAARQRSGRCGRVSAGVCIRLFSE
FT                   EDFNSRPEFTDPEIVRSNLAAVILRMASLNLGDVAAFPFLEMPDSRYINDGFQVLLELG
FT                   AVEAV"
FT   CDS_pept        complement(409371..410780)
FT                   /transl_table=11
FT                   /locus_tag="NMA0434"
FT                   /product="hypothetical inner membrane protein"
FT                   /note="NMA0434, hypothetical inner membrane protein, len:
FT                   469aa; similar to SW:P37019 (YADQ_ECOLI) hypothetical
FT                   protein from Escherichia coli (436 aa) fasta scores; E():
FT                   1e-18, 29.2% identity in 449 aa overlap. Contains possible
FT                   membrane-spanning hydrophobic regions."
FT                   /db_xref="EnsemblGenomes-Gn:NMA0434"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07721"
FT                   /db_xref="GOA:A0A0U1RHB7"
FT                   /db_xref="InterPro:IPR001807"
FT                   /db_xref="InterPro:IPR014743"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RHB7"
FT                   /protein_id="CAM07721.1"
FT                   /translation="MTSTFPRRLARKIRQTRRLSRKSIAFLFLLAGSALVALTALFFAH
FT                   LADFALELNAKLVQQYPWFAWVALPLGLPLIAWLTRKFAPFTAGSGIPQVIASLSLPYG
FT                   AQKTRLIRLGQTLLKIPLTFLGMLFGASIGREGPSVQVGAAVMGAWGAWCKKHGLAFKG
FT                   MQENDLMAAGAAGGLAAAFNAPLAGVIFAIEELGRGIMLRWERQILLGVLASGFIQVAI
FT                   QGNNPYFSGFNGGVLEHIFLWVALSGLVCGAAGGLFGRLLYRGAAAFAPRKIRGFIRNR
FT                   PLLLAALMGLLLALLGTFYQGKTYGTGYHEAAQALHGIYEAPFGLAAAKWLATVFSYWA
FT                   GVPGGIFTPSLTIGAVLGEHIAAIADISQGANIIVLICMAAFLAGATQSPITSAVVVME
FT                   MTGGQSLLFWMLIACIFASQVSRQFSPRPFYHASGMRFRQRVLQETAAQTGNAPARPQT
FT                   ANSKTGMPSEN"
FT   CDS_pept        complement(410943..412163)
FT                   /transl_table=11
FT                   /locus_tag="NMA0435"
FT                   /product="arginine biosynthesis bifunctional protein"
FT                   /EC_number="2.3.1.35"
FT                   /EC_number="2.3.1.1"
FT                   /note="NMA0435, argJ, arginine biosynthesis bifunctional
FT                   protein, len: 406aa; similar to many eg. SW:P38434
FT                   (ARGJ_NEIGO) argJ, arginine biosynthesis bifunctional
FT                   protein from Neisseria gonorrhoeae (406 aa) fasta scores;
FT                   E(): 0, 98.0% identity in 406 aa overlap."
FT                   /db_xref="EnsemblGenomes-Gn:NMA0435"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07722"
FT                   /db_xref="GOA:P63573"
FT                   /db_xref="InterPro:IPR002813"
FT                   /db_xref="InterPro:IPR016117"
FT                   /db_xref="InterPro:IPR042195"
FT                   /db_xref="UniProtKB/Swiss-Prot:P63573"
FT                   /protein_id="CAM07722.1"
FT                   /translation="MAVNLTEKTAEQLPDIDGIALYTAQAGVKKPGHTDLTLIAVAAGS
FT                   TVGAVFTTNRFCAAPVHIAKSHLFDEDGVRALVINTGNANAGTGAQGRIDALAVCAAAA
FT                   RQIGCKPNQVLPFSTGVILEPLPADKIIAALPKMQPAFWNEAARAIMTTDTVPKAASRE
FT                   GKVGDKHTVRATGIAKGSGMIHPNMATMLGFIATDAKVSQPVLQLMTQEIADETFNTIT
FT                   VDGDTSTNDSFVIIATGKNSQSEIDNIADPRYAQLKELLCSLALELAQAIVRDGEGATK
FT                   FITVRVENAKTRDEARQAAYAVARSPLVKTAFFASDPNLGRLLAAIGYAGVADLDTDLV
FT                   EMYLDDILVAEHGGRAASYTEAQGQAVMSKAEITVRIKLHRGQAAATVYTCDLSHGYVS
FT                   INADYRS"
FT   CDS_pept        complement(412230..412922)
FT                   /transl_table=11
FT                   /locus_tag="NMA0436"
FT                   /product="hypothetical inner membrane protein"
FT                   /note="NMA0436, hypothetical inner membrane protein, len:
FT                   230aa; similar to many eg. SW:P33373 (YOHK_ECOLI)
FT                   hypothetical protein from Escherichia coli (231 aa) fasta
FT                   scores; E(): 4.3e-26, 39.0% identity in 218 aa overlap.
FT                   Contains possible membrane-spanning hydrophobic regions."
FT                   /db_xref="EnsemblGenomes-Gn:NMA0436"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07723"
FT                   /db_xref="GOA:A0A0U1RHB8"
FT                   /db_xref="InterPro:IPR007300"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RHB8"
FT                   /protein_id="CAM07723.1"
FT                   /translation="MNEILRQPSILLFLTLAVYALAIIVRTRTGNIFCNPVLVSTIVLI
FT                   AYLKILGIDYAVYHNAAQFIDFWLKPAVVVLAVPLYQNRRKIFNQWLPVIVSQLAGSVT
FT                   GIVTGMYFAKWLGAEREVVLSLASKSVTNPIAIEITRSIGGIPAITAATVIIAGLVGQI
FT                   AGYKMLKNTVVMPSSVGMSLGTASHAMGIAASLERSRRMAAYAGLGLTFNGVLTALIAP
FT                   LLIPVLGF"
FT   CDS_pept        complement(412922..413266)
FT                   /transl_table=11
FT                   /locus_tag="NMA0437"
FT                   /product="hypothetical inner membrane protein"
FT                   /note="NMA0437, hypothetical inner membrane protein, len:
FT                   114aa; similar to many eg. SW:P39591 (YWBH_BACSU)
FT                   hypothetical protein from Bacillus subtilis (128 aa) fasta
FT                   scores; E(): 1.9e-07, 36.0% identity in 111 aa overlap.
FT                   Contains possible membrane-spanning hydrophobic regions."
FT                   /db_xref="EnsemblGenomes-Gn:NMA0437"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07724"
FT                   /db_xref="GOA:A0A0U1RHB9"
FT                   /db_xref="InterPro:IPR005538"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RHB9"
FT                   /protein_id="CAM07724.1"
FT                   /translation="MNIIRALLIILGCLATGETAVFLAGIKLPGSIVGMGVLFALLQAG
FT                   WVKTSWLQQLTDALMANLTLFLVPPCVAVISYLDLIADDWFSILVSASASTLCVLLVTG
FT                   KVHRWIRSII"
FT   CDS_pept        complement(413411..413629)
FT                   /transl_table=11
FT                   /locus_tag="NMA0439"
FT                   /product="hypothetical protein"
FT                   /note="NMA0439, hypothetical protein, len: 72aa;"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0439"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07725"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RHC0"
FT                   /protein_id="CAM07725.1"
FT                   /translation="MSMPEMPKWYDDDGQIVSCTEKVKVMSENMAELYQTAQDAFEDAL
FT                   LMGCGERQLRDYLLALIEGLENPYRKV"
FT   CDS_pept        complement(413648..414490)
FT                   /transl_table=11
FT                   /locus_tag="NMA0440"
FT                   /product="hypothetical outer membrane protein"
FT                   /note="NMA0440, hypothetical outer membrane protein, len:
FT                   280aa; C-terminal region similar to many eg. SW:P76190
FT                   (YDHO_ECOLI) hypothetical protein from Escherichia coli
FT                   (271 aa) fasta scores; E(): 1.2e-18, 50.9% identity in 116
FT                   aa overlap, similar to NMA1645 fasta scores; E():
FT                   2.4e-20,45.8% identity in 120 aa overlap and contains Pfam
FT                   match to entry PF00877 NLPC_P60, NLP/P60 family, includes
FT                   several lipoproteins. N-terminal region contains 4 x
FT                   EQPVLP(V/I)NR(A/V)PARRAGNADELIG(N/S)AMGL(N/L) repeat."
FT                   /db_xref="EnsemblGenomes-Gn:NMA0440"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07726"
FT                   /db_xref="InterPro:IPR000064"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RHC1"
FT                   /protein_id="CAM07726.1"
FT                   /translation="MDSFFKPAVWAVLWLMFAVRPALADELTNLLSSREQILRQFAEDE
FT                   QPVLPINRAPARRAGNADELIGSAMGLNEQPVLPVNRVPARRAGNADELIGNAMGLNEQ
FT                   PVLPVNRVPARRAGNADELIGNAMGLNEQPVLPVNRAPARRAGNADELIGNAMGLLGIA
FT                   YRYGGTSISTGFDCSGFMQHIFKRAMGINLPRTSAEQARMGTPVARSELQPGDMVFFRT
FT                   LGGSRISHVGLYIGNNRFIHAPRTGKNIEITSLSHKYWSGKYAFARRVKKNDPSRFLN"
FT   CDS_pept        414657..415643
FT                   /transl_table=11
FT                   /locus_tag="NMA0441"
FT                   /product="conserved hypothetical protein"
FT                   /note="NMA0441, conserved hypothetical protein, len: 328aa;
FT                   similar to many eg. SW:P45803 (YRFI_ECOLI) hypothetical
FT                   protein from Escherichia coli (292 aa) fasta scores; E():
FT                   0, 38.6% identity in 272 aa overlap."
FT                   /db_xref="EnsemblGenomes-Gn:NMA0441"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07727"
FT                   /db_xref="GOA:Q9JWC8"
FT                   /db_xref="InterPro:IPR000397"
FT                   /db_xref="InterPro:IPR016153"
FT                   /db_xref="InterPro:IPR016154"
FT                   /db_xref="InterPro:IPR023212"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9JWC8"
FT                   /protein_id="CAM07727.1"
FT                   /translation="MHPPSVLFSRRPQPYSRHPNNQSEKIMNQTAINRADVRTRFIFDD
FT                   MPVRGLHVRLENVWQHIVKQKNYPAAIRRALGELLAAGVLLSGNLKNEGTLIVQVQGQG
FT                   RLKMLVAEATSDRTVRATARWDETAEIADDESLGDLLGEGGVFVLTLQPKDGEPWQGVV
FT                   PLEGDGIAQMLVNYMKRSEQLDTHIVLSASDEAAGGLLVQRLPEEVLDEEAWEHVSTLA
FT                   RTLTAEELAGLDAQHVLYRLFHETPPRVFEPETFEFSCTCSRGKVSDMLLMLGGEEVGG
FT                   VVVEQGSIEVDCDFCHSKYVFDETDVNALFGEDVVGVAKGLPRHTVQ"
FT   CDS_pept        complement(415729..417183)
FT                   /transl_table=11
FT                   /locus_tag="NMA0442"
FT                   /product="hypothetical inner membrane protein"
FT                   /note="NMA0442, hypothetical inner membrane protein, len:
FT                   484aa; similar to many proposed transporters eg. TR:P73368
FT                   (EMBL:D90905) proposed Mg2+ transporter from Synechocystis
FT                   sp. (strain PCC 6803) (463 aa) fasta scores; E(): 0, 30.6%
FT                   identity in 422 aa overlap. Contains two Pfam matches to
FT                   entry PF00571 CBS, CBS domain."
FT                   /db_xref="EnsemblGenomes-Gn:NMA0442"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07728"
FT                   /db_xref="GOA:A0A0U1RHC2"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR006667"
FT                   /db_xref="InterPro:IPR006668"
FT                   /db_xref="InterPro:IPR006669"
FT                   /db_xref="InterPro:IPR036739"
FT                   /db_xref="InterPro:IPR038048"
FT                   /db_xref="InterPro:IPR038076"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RHC2"
FT                   /protein_id="CAM07728.1"
FT                   /translation="MSIEPTPPNLENDGIENDVERVSADFDRVHSLCEILEPAFEQIEN
FT                   GTPLEDAPLRDKLTELTVLLSELHPADVAAVLESLPPRERNIVWILVKPEDDGEVLLEV
FT                   SDAVRETLIESMDKDELLAAVDDLDADELAELADDLPHQVVYEALQTRDEEERAQVKAA
FT                   MSYEDNQVGAIMDFELVSIRADVACEVVLRYLRRFDSLPDHTDKIFVVDENDVLQGVLP
FT                   IRKLLVADPEDLVENVMAKDVVRFRAEDDVEETAQAFERYDLVTAPVVDENKKLIGRVT
FT                   VDEMVDVIREESEADMLNMAGLQEEEDLFAPVLDSVKNRWMWLAVNLCTAFLASRVIGA
FT                   FEGSIEKIVALAALMPIVAGIGGNSGNQTITMIVRAMAMGQLTDMQAGRLLKKEVGVAL
FT                   VNGIIWGTVMGAVSWLLYGSLGIGLVMIAAMTLNLLLAATVGVLIPVVMEKFGRDPALG
FT                   SSVLITAVTDSGGFLIFLGLATLFLL"
FT   CDS_pept        complement(417417..418169)
FT                   /transl_table=11
FT                   /locus_tag="NMA0444"
FT                   /product="putative hydroxyacylglutathione hydrolase"
FT                   /EC_number="3.1.2.6"
FT                   /note="NMA0444, probable hydroxyacylglutathione
FT                   hydrolase,len: 250aa; similar to many eg. SW:Q47677
FT                   (GLO2_ECOLI) probable hydroxyacylglutathione hydrolase from
FT                   Escherichia coli (251 aa) fasta scores; E(): 2.6e-26, 37.5%
FT                   identity in 259 aa overlap. Contains Pfam match to entry
FT                   PF00753 lactamase_B, Metallo-beta-lactamase superfamily."
FT                   /db_xref="EnsemblGenomes-Gn:NMA0444"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07729"
FT                   /db_xref="GOA:A1IPQ8"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR017782"
FT                   /db_xref="InterPro:IPR032282"
FT                   /db_xref="InterPro:IPR035680"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1IPQ8"
FT                   /protein_id="CAM07729.1"
FT                   /translation="MKITPVKALTDNYIWMIQHGNHAVCVDPSEPSPVLEFLVRNRLML
FT                   AQTWVTHPHPDHEGGAAALWRGYMESPVYGESDIEAATHTVTAGTQFTFGDGQVTVWAT
FT                   PGHTDRHTSYLLETSDGIHVFCGDTLFSAGCGRVFTGTIEQLYDSFQRFNRLPENTLFY
FT                   PAHEYTAANLRFAAHIEPDNADIQTALKAAERTPTLPVTLAHERRVNPFLRTEIPAVRQ
FT                   RAEALVGKTLNSGLEVFAALRELKNAYC"
FT   CDS_pept        complement(418264..422226)
FT                   /transl_table=11
FT                   /locus_tag="NMA0445"
FT                   /product="phophoribosylformylglycinamidine synthase"
FT                   /EC_number="6.3.5.3"
FT                   /note="NMA0445, purL, phophoribosylformylglycinamidine
FT                   synthase, len: 1320aa; similar to many eg. similar to many
FT                   eg. SW:P15254 (PURL_ECOLI)
FT                   purL,phophoribosylformylglycinamidine synthase from
FT                   Escherichia coli (1295 aa) fasta scores; E(): 0, 56.3%
FT                   identity in 1324 aa overlap."
FT                   /db_xref="EnsemblGenomes-Gn:NMA0445"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07730"
FT                   /db_xref="GOA:Q9JWC5"
FT                   /db_xref="InterPro:IPR010073"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR036604"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="InterPro:IPR040707"
FT                   /db_xref="InterPro:IPR041609"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9JWC5"
FT                   /protein_id="CAM07730.1"
FT                   /translation="MSVVLPLRGVTALSDFRVEKLLQKAAALGLPEVKLSSEFWYFVGS
FT                   EKALDAATVEKLQALLAAQSVEQTPKAREGLHLFLVTPRLGTISPWASKATNIAENCGL
FT                   AGIERIERGMAVWLEGALTDEQQQQWAALLHDRMTESVLPDFQTASKLFHHLESETFST
FT                   VDVLGGGKEALVKANTEMGLALSADEIDYLVENYQALQRNPSDVELMMFAQANSEHCRH
FT                   KIFNADFILNGEKQPKSLFGMIRDTHNAHPEGTVVAYKDNSSVIEGAKVERFYPNAAEN
FT                   QGYRFHEEDTHIIMKVETHNHPTAIAPFAGAATGAGGEIRDEGATGKGSRPKAGLTGFT
FT                   VSNLNIPGLKQPWEQDYGKPEHISSPLDIMIEGPIGGAAFNNEFGRPNLLGYFRTFEEK
FT                   FDGQVRGYHKPIMIAGGLGSIQAQQTHKDEIPEGALLIQLGGPGMLIGLGGGAASSMDT
FT                   GTNDASLDFNSVQRGNPEIERRAQEVIDRCWQLGDKNPIISIHDVGAGGLSNAFPELVN
FT                   DAGRGAVFKLREVPLEEHGLNPLQIWCNESQERYVLSILEKDLDIFRSICERERCPFAV
FT                   VGTATDDGHLKVRDDLFSNNPVDLPLNVLLGKPPKTTRTDKTVAPSKKPFHAGDIDITE
FT                   AAYRVLRLPAVAAKNFLITIGDRSVGGMTHRDQMVGKYQTPVADCAVTMMGFNTYRGEA
FT                   MSMGEKPTVALFDAPASGRMCVGEAITNIAAANIGDIGNIKLSANWMAACGNEGEDEKL
FT                   YRTVEAVSKACQALDLSIPVGKDSLSMKTVWQDGEEKKSVVSPLSLIISAFAPVQDVRK
FT                   TVTPELKNVEDSVLLFVDLGFGKARMGGSAFGQVYNNMSGDAPDLDDTSRLKAFYNVIQ
FT                   QLVAEDKLLAYHDRSDGGLFAVLVEMAFAGRCGLDIDLNLLLAQTFITNHTALSQSLRT
FT                   EEVKALAEWQETIARTLFNEELGAVIQVRKQDVADIINLFYQQQLHHNVFEIGTLTDEN
FT                   TLIIRDGQTHLISDNLIKLQQTWQETSHQIQRLRDNPACADSEFALIGDNGRSALFANL
FT                   KFDVNEDIAAPFINSGAKPKIAILREQGVNGQIEMAAAFTRAGFDAYDVHMSDLMAGRV
FT                   HLADFKMLAACGGFSYGDVLGAGKGWAKSILFHPALRDQFAAFFTDPNTLTLGVCNGCQ
FT                   MVSNLAEIIPGTAGWPKFKRNLSEQFEARLSMVHVPKSASLILNEMQGSSLPVVVSHGE
FT                   GRADFALHGGNISADLGIALQYVDGQNQITQTYPLNPNGSPQGIAGVTNADGRVTIMMP
FT                   HPERVYRAAQMSWKPEDWTELSGWYRLFAGARKALG"
FT   CDS_pept        422690..423028
FT                   /transl_table=11
FT                   /locus_tag="NMA0447"
FT                   /product="nitrogen regulatory protein P-II 1"
FT                   /note="NMA0447, glnB, nitrogen regulatory protein P-II
FT                   1,len: 112aa; similar to many eg. SW:P05826 (GLNB_ECOLI)
FT                   glnB, nitrogen regulatory protein P-II 1 from Escherichia
FT                   coli (112 aa) fasta scores; E(): 1.9e-31, 74.1% identity in
FT                   112 aa overlap. Contains Pfam match to entry PF00543 P-II,
FT                   Nitrogen regulatory protein P-II; Prosite match to PS00496
FT                   P-II protein urydylation site and Prosite match to PS00638
FT                   P-II protein C-terminal region signature"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0447"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07731"
FT                   /db_xref="GOA:A0A0U1RHC3"
FT                   /db_xref="InterPro:IPR002187"
FT                   /db_xref="InterPro:IPR002332"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="InterPro:IPR017918"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RHC3"
FT                   /protein_id="CAM07731.1"
FT                   /translation="MKKIEAIVKPFKLDDVREALTEIGITGMTVSEVKGFGRQKGHTEI
FT                   YRGAEYAVDFLPKVKIELVLADDAVERAIDVIVEVARSGKIGDGKIFVLPVEEAIRIRT
FT                   GERADAAV"
FT   CDS_pept        complement(423084..423842)
FT                   /transl_table=11
FT                   /locus_tag="NMA0448"
FT                   /product="putative ABC transporter ATP-binding subunit"
FT                   /note="NMA0448, probable ABC transporter ATP-binding
FT                   subunit, len: 252aa; similar to many probable transporters
FT                   eg. TR:P94420 (EMBL:D50453) from Bacillus subtilis (252 aa)
FT                   fasta scores; E(): 0, 46.4% identity in 250 aa overlap.
FT                   Contains Pfam match to entry PF00005 ABC_tran,ABC
FT                   transporter; Prosite match to PS00211 ABC transporters
FT                   family signature and Prosite match to PS00017
FT                   ATP/GTP-binding site motif A (P-loop)."
FT                   /db_xref="EnsemblGenomes-Gn:NMA0448"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07732"
FT                   /db_xref="GOA:A0A0U1RHC4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RHC4"
FT                   /protein_id="CAM07732.1"
FT                   /translation="MITIRNVSYRIGTHPILDNISLDIPEGGITALIGPNGAGKSTLFS
FT                   FMARLRPLESGSIAYRGKNLAGTPTAELARTLSILTQENSIMSRITVRDLLMFGRYPYH
FT                   QGRPTAECRRIVNGAIEEFHLQDLSDRYLTELSGGQRQRAMIAMVFCQSTDYVLLDEPL
FT                   NNLDMYHARSLMQILQKLTREHKRTTVAVLHDINQAAAYADHVVAMKNGKAVLTGTPEE
FT                   VFTVHNIKELFDMDVDVLDYEGKKLIVHHI"
FT   CDS_pept        complement(423973..424554)
FT                   /transl_table=11
FT                   /locus_tag="NMA0449"
FT                   /product="hypothetical protein"
FT                   /note="NMA0449, hypothetical protein, len: 193aa;"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0449"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07733"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RHC5"
FT                   /protein_id="CAM07733.1"
FT                   /translation="MTQERFPSFFNQAPTITVRDPLAAFLGAAENGILTYRYADAVRLC
FT                   GHSCPTVAGAYLMVIKGLKALYGEELPERGGIEAAMQGVRDEGTVGVTASVVQLLTGAA
FT                   PETGFGGIGMQGRFARRNLLSFGAGEINGTLTLRRKDNGAKPLPSASTPPCNPLHPKRA
FT                   NLCPKPSAAAQAQKNSNASDNSGRHALKHF"
FT   CDS_pept        complement(424599..425546)
FT                   /transl_table=11
FT                   /locus_tag="NMA0450"
FT                   /product="putative inner membrane transport protein"
FT                   /note="NMA0450, possible inner membrane transport
FT                   protein,len: 315aa; similar to many transport proteins eg.
FT                   SW:P37737 (FATC_VIBAN) anguibactin transport protein from
FT                   Vibrio anguillarum (317 aa) fasta scores; E():
FT                   9.2e-27,29.3% identity in 307 aa overlap. Contains Pfam
FT                   match to entry PF01032 FecCD_family, FecCD transport
FT                   family; Prosite match to PS00013 Prokaryotic membrane
FT                   lipoprotein lipid attachment site and possible
FT                   membrane-spanning hydrophobic regions."
FT                   /db_xref="EnsemblGenomes-Gn:NMA0450"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07734"
FT                   /db_xref="GOA:A0A0U1RHC6"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RHC6"
FT                   /protein_id="CAM07734.1"
FT                   /translation="MAGSSRPLWVAFALLLVSCILFMTLNVKGDWDFVLHLRLTKLAAL
FT                   LMVAYAVGVSTQLFQTLTNNPILTPSILGFDSLYVFLQTLLVFTFGGVGYASLPLTGKF
FT                   GFELVVMMGGSLLLFYTLIKQGGRDLPRMILIGVIFGILFRSLSSLLSRMIDPEEFTAA
FT                   QANMFAGFNTVHSELLGIGALILLVSAAVVWRERYRLDVHLLGRDQAINLGISYTRNTL
FT                   WILLWIAALVATATAVVGPVSFFGLLAASLANHFSPSVKHSVRLPMTVCVGGILLVGGQ
FT                   TVFEHFLGMKAVLSVVVEFAGGLVFLYLVLRHKK"
FT   CDS_pept        complement(425563..426531)
FT                   /transl_table=11
FT                   /locus_tag="NMA0451"
FT                   /product="putative inner membrane transport protein"
FT                   /note="NMA0451, possible inner membrane transport
FT                   protein,len: 322aa; similar to many transport proteins eg.
FT                   SW:P37738 (FATD_VIBAN) anguibactin transport protein from
FT                   Vibrio anguillarum (314 aa) fasta scores; E(): 0, 38.1%
FT                   identity in 310 aa overlap. Contains Pfam match to entry
FT                   PF01032 FecCD_family, FecCD transport family and possible
FT                   membrane-spanning hydrophobic regions."
FT                   /db_xref="EnsemblGenomes-Gn:NMA0451"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07735"
FT                   /db_xref="GOA:A0A0U1RHC7"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RHC7"
FT                   /protein_id="CAM07735.1"
FT                   /translation="MTAKPFSLNLTNLLLLAVLFAVSLSVGVADFRWSDVFSLSDSQQV
FT                   MFISRLPRTFAIVLTGASMAVAGMIMQILMRNRFVEPSMAGAGQSAALGLLLMSLLLPA
FT                   APLPVKMSVAAVAALIGMLVFMMLIRRLPPTAQLMVPLVGIIFGGVVEAVATFIAYENE
FT                   MLQMLGVWQQGDFSGVLLGRYELLWATGILALFAYLIADQLTILGLGETVSVNLGLNRT
FT                   AILWSGLIIVALITSLVIVTVGNIPFIGLVVPNIISRLIGDRLRQSLPAVALLGASLVL
FT                   LCDIIGRVIVFPFEIPVSTVFGVLGTALFLWLLLRKPAHAV"
FT   CDS_pept        complement(426802..427767)
FT                   /transl_table=11
FT                   /locus_tag="NMA0452"
FT                   /product="putative membrane transport solute-binding
FT                   protein"
FT                   /note="NMA0452, fetB, probable ferric enterobactin
FT                   periplasmic binding protein, len: 321aa; similar to many
FT                   eg. SW:P11460 (FATB_VIBAN) anguibactin binding protein from
FT                   Vibrio anguillarum (322 aa) fasta scores; E(): 3.7e-22,
FT                   30.8% identity in 302 aa overlap and TR:AAD29611
FT                   (EMBL:AF115385) putative ferric enterobactin periplasmic
FT                   binding protein from Neisseria gonorrhoeae (323 aa) fasta
FT                   scores; E(): 0, 96.3% identity in 323 aa overlap. Contains
FT                   Prosite match to PS00013 Prokaryotic membrane lipoprotein
FT                   lipid attachment site,"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0452"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07736"
FT                   /db_xref="GOA:A0A0U1RHC8"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="InterPro:IPR033870"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RHC8"
FT                   /protein_id="CAM07736.1"
FT                   /translation="MLRLTALAVCTALALGACSPQNSDSAPQAKEQAVSAAQSEGVSVT
FT                   VKTARGDVQIPQNPERIAVYDLGMLDTLSKLGVKTGLSVDKNRLPYLEEYFKTTKPAGT
FT                   LFEPDYETLNAYKPQLIIIGSRAAKAFDKLNEIAPTIEMTADTANLKESAKERIDALAQ
FT                   IFGKKAEADKLKAEIDASFEAAKTAAQGKGKGLVILVNGGKMSAFGPSSRLGGWLHKDI
FT                   GVPAVDEAIKEGSHGQPISFEYLKEKNPDWLFVLDRSAAIGEEGQAAKDVLNNPLVAET
FT                   TAWKKGQVVYLVPETYLAAGGAQELLNASKQVADAFNAAK"
FT   CDS_pept        complement(428465..430609)
FT                   /transl_table=11
FT                   /locus_tag="NMA0453"
FT                   /product="putative iron-regulated outer membrane protein"
FT                   /note="NMA0453, fetA, probable ferric enterobactin
FT                   receptor, len: 714aa; similar to many eg. TR:AAD29612
FT                   (EMBL:AF115385) FetA, ferric enterobactin receptor from
FT                   Neisseria gonorrhoeae (713 aa) fasta scores; E(): 0, 95.0%
FT                   identity in 714 aa overlap. Contains two Prosite match to
FT                   PS01156 TonB-dependent receptor proteins signature 2."
FT                   /db_xref="EnsemblGenomes-Gn:NMA0453"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07737"
FT                   /db_xref="GOA:A0A0U1RHC9"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR010105"
FT                   /db_xref="InterPro:IPR010917"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039426"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RHC9"
FT                   /protein_id="CAM07737.1"
FT                   /translation="MNAPFFRLSLLSLTLAAGFAHAAENNANVALDTVTVKGDRQGSKI
FT                   RTNIVTLQQKDESTATDMRELLKEEPSIDFGGGNGTSQFLTLRGMGQNSVDIKVDNAYS
FT                   DSQILYHQGRFIVDPALVKVVSVQKGAGSASAGIGATNGAIIAKTVDAQDLLKGLDKNW
FT                   GVRLNSGFASNEGVSYGASVFGKEGNFDGLFSYSRNDEKDYEAGKGFRNNFNGGKTVPY
FT                   SALDKRSYLAKIGTSFGDGDHRIVLSHMKDQHRGIRTVREEFTVGGDKERISMKRQAPS
FT                   YRETTQSNTNLAYTGKDLGFVEKLDANAYVLEKKRYSADDSGSGYAGNVKGPNHTQITT
FT                   RGANFNFDSRLAEQTLLKYGINYRHQEIKPQAFLNSQFKIEDKEKATDEEKNKNRENEK
FT                   IAKAYRLTNPTKTDAGAYIEAIHEIDGFTLTGGLRYDRFKVKTHDGKTVSSSSLNPSFG
FT                   VIWQPHEHWSFSASHNYASRSPRLYDALQTHGKRGIISIADGTKAERARNTEIGFNYND
FT                   GTFAANGSYFWQTIKDALANPQNRHDSVAVREAVNAGYIKNHGYELGASYRTGGLTAKV
FT                   GVSHSKPRFYDTHKDKLLSANPEFGAQVGRTWTASLAYRFKNPNLEIGWRGRYVQKAVG
FT                   SILVAGQKDRSGKLENVVRQGFGVNDVFANWKPLGKDTLNVNLSVNNVFNTFYYPHSQR
FT                   WTNTLPGVGRDVRLGVNYKF"
FT   CDS_pept        complement(432471..433817)
FT                   /transl_table=11
FT                   /locus_tag="NMA0454"
FT                   /product="probable thiophene and furan oxidation protein"
FT                   /note="NMA0454, thdF, probable thiophene and furan
FT                   oxidation protein, len: 448aa; similar to many eg.
FT                   SW:P25522 (THDF_ECOLI) thiophene and furan oxidation
FT                   protein from Escherichia coli (454 aa) fasta scores; E():
FT                   0, 54.7% identity in 455 aa overlap."
FT                   /db_xref="EnsemblGenomes-Gn:NMA0454"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07738"
FT                   /db_xref="GOA:Q9JWB7"
FT                   /db_xref="InterPro:IPR004520"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR018948"
FT                   /db_xref="InterPro:IPR025867"
FT                   /db_xref="InterPro:IPR027266"
FT                   /db_xref="InterPro:IPR027368"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031168"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9JWB7"
FT                   /protein_id="CAM07738.1"
FT                   /translation="MSDNVPTIAAVATAPGRGGVGVIRISGKNLLPMAQALCGKTPKPR
FT                   VATYADFTDEDGQAIDSGLLLFFAAPASFTGEDVIELQGHGGPVVMDMLLNRCLELGAR
FT                   LAEPGEFTKRAFLNDKLDLAQAEGVADLIDASSRSAARLALRSLKGDFSRRIHGLVEDL
FT                   ITLRMLVEATLDFPEEDIDFLEAADARGKLDGLRRAVDDVLANAQQGAILREGLNVVLV
FT                   GAPNVGKSSLLNALAGDEVAIVTDIAGTTRDAVRERILIDGVPVHIVDTAGLRETDDVV
FT                   ERIGIERSRKAVSEADVALVLVDPREGLNEKTRAILDALPLELKRIEIHSKSDLHAHAA
FT                   GGFGTGAETVIALSAKTGDGLDALKRTLLREAGWQGESEGLFLARTRHVNALKAAQEEL
FT                   SLAALCGNHQIELFAEHLRLAQVACGEITGEFTADDLLGVIFSRFCIGK"
FT   CDS_pept        433948..434103
FT                   /transl_table=11
FT                   /locus_tag="NMA0455"
FT                   /product="hypothetical protein"
FT                   /note="NMA0455, hypothetical protein, len: 51aa;"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0455"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07739"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RHD0"
FT                   /protein_id="CAM07739.1"
FT                   /translation="MEKRNTYALLLGISSLLGLFHPAKTAIRPNPADDLKNIGGDFQRA
FT                   IEKARK"
FT   CDS_pept        434100..434531
FT                   /transl_table=11
FT                   /locus_tag="NMA0456"
FT                   /product="putative inner membrane protein"
FT                   /note="NMA0456, possible inner membrane protein, len:
FT                   143aa; contains possible membrane-spanning hydrophobic
FT                   regions."
FT                   /db_xref="EnsemblGenomes-Gn:NMA0456"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07740"
FT                   /db_xref="GOA:A0A0U1RHD1"
FT                   /db_xref="InterPro:IPR019284"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RHD1"
FT                   /protein_id="CAM07740.1"
FT                   /translation="MTENAQDKARQAVETVVKSPELVEQILSDEYVQIMIARRFHSGPL
FT                   PPPSDLAQYNDIISNGADRIMAMAEKEQAVRHETIRQDQTFNRRGQLYGFISVILILLF
FT                   AVFLVWSGYPATAASLAGGTVFALACAFVIGRSRDQGKN"
FT   CDS_pept        434665..439014
FT                   /transl_table=11
FT                   /locus_tag="NMA0457"
FT                   /product="IgA-specific serine endopeptidase"
FT                   /EC_number="3.4.21.72"
FT                   /note="NMA0457, iga2, IgA-specific serine
FT                   endopeptidase,len: 1449aa; similar to many eg. SW:P09790
FT                   (IGA_NEIGO) iga, IgA-specific serine endopeptidase from
FT                   Neisseria gonorrhoeae (1532 aa) fasta scores; E(): 0, 28.8%
FT                   identity in 1594 aa overlap. Contains Prosite match to
FT                   PS00135 Serine proteases, trypsin family, serine active
FT                   site. Also similar to NMA0905, iga (29.9% identity in 1339
FT                   aa overlap)"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0457"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07741"
FT                   /db_xref="GOA:A0A0U1RHD2"
FT                   /db_xref="InterPro:IPR000710"
FT                   /db_xref="InterPro:IPR004899"
FT                   /db_xref="InterPro:IPR005546"
FT                   /db_xref="InterPro:IPR006315"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012332"
FT                   /db_xref="InterPro:IPR030396"
FT                   /db_xref="InterPro:IPR033116"
FT                   /db_xref="InterPro:IPR036709"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RHD2"
FT                   /protein_id="CAM07741.1"
FT                   /translation="MKTTDKRTTETHRKAPKTGRIRFSPAYLAICLSFGILPQAWAGHT
FT                   YFGINYQYYRDFAENKGKFAVGAKDIEVYNKKGELVGKSMTKAPMIDFSVVSRNGVAAL
FT                   VGDQYIVSVAHNGGYNNVDFGAEGRNPDQHRFSYQIVKRNNYKPDNSHPYNGDYHMPRL
FT                   HKFVTDAEPVEMTSDMRGNTYSDKEKYPERVRIGSGHHYWRYDDDKHGDLSYSGAWLIG
FT                   GNTHMQGWGNNGVVSLSGDVRHANDYGPMPIAGAAGDSGSPMFIYDKTNNKWLLNGVLQ
FT                   TGYPYSGRENGFQLIRKDWFYDDIYRGDTHTVFFEPRSNGHFSFTSNNNGTGTVTETNE
FT                   KVSNPKLKVQTVRLFDESLNETDKEPVYAAGGVNQYRPRLNNGENLSFIDYGNGKLILS
FT                   NNINQGAGGLYFEGDFTVSPENNETWQGAGVHISEDSTVTWKVNGVANDRLSKIGKGTL
FT                   HVQAKGENQGSISVGDGTVILDQQADDKGKKQAFSEIGLVSGRGTVQLNADNQFNPDKL
FT                   YFGFRGGRLDLNGHSLSFHRIQNTDEGAMIVNHNATTTSTVTITGNESITQPSGKNINR
FT                   LNYSKEIAYNGWFGEKDTTKTNGRLNLVYQPAAEDRTLLLSGGTNLNGNITQTNGKLFF
FT                   SGRPTPHAYNHLGSGWSKMEGIPQGEIVWDNDWINRTFKAENFHIQGGQAVISRNVAKV
FT                   EGDWHLSNHAQAVFGVAPHQSHTICTRSDWTGLTNCVEKTITDDKVIASLTKTDISGNV
FT                   SLADHAHLNLTGLATLNGNLSANGDTRYTVSHNATQNGNLSLVGNAQATFNQATLNGNT
FT                   SASGNASFNLSNNAAQNGSLTLSDNAKANVSHSALNGNVSLADKAVFHFENSRFTGQLS
FT                   GSKDTALHLKDSEWTLPSGTELGNLNLDNATITLNSAYRHDAAGAQTGSVSDTPRRRSR
FT                   RSLLSVTPPTSVESRFNTLTVNGKLNGQGTFRFMSELFGYRSDKLKLAESSEGTYTLAV
FT                   NNTGNEPVSLDQLTVVEGKDNKPLSENLNFTLQNEHVDAGAWRYQLIRKDGEFRLHNPV
FT                   KEQELSDKLGKAEAKKQAEKDNAQSLDALIAAGRDAAEKTESVAEPARQAGGENVGIMQ
FT                   AEEEKKRVQADKDSALAKQREAETRPATTAFPRARRARRDLPQPQPQPQPQPQPQRDLI
FT                   SRYANSGLSEFSATLNSVFAVQDELDRVFAEDRRNAVWTSGIRDTKHYRSQDFRAYRQQ
FT                   TDLRQIGMQKNLGSGRVGILFSHNRTENTFDDGIGNSARLAHGAVFGQYGIGRFDIGIS
FT                   TGAGFSSGSLSDGIGGKIRRRVLHYGIQARYRAGFGGFGIEPYIGATRYFVQKADYRYE
FT                   NVNIATPGLAFNRYRAGIKADYSFKPAQHISITPYLSLSYTDAASGKVRTRVNTAVLAQ
FT                   DFGKTRSAEWGVNAEIKGFTLSLHAAAAKGPQLEAQHSAGIKLGYRW"
FT   CDS_pept        complement(439330..440442)
FT                   /transl_table=11
FT                   /locus_tag="NMA0458"
FT                   /product="transposase for insertion element IS1106A3"
FT                   /note="NMA0458, transposase for insertion element IS1106A3,
FT                   len: 370aa; similar to many eg. TR:CAB44967 (EMBL:AJ242841)
FT                   transposase for insertion element IS1106A3 from Neisseria
FT                   meningitidis serogroup A strain Z2491 (this strain) (335
FT                   aa) fasta scores; E(): 0, 84.6% identity in 370 aa overlap.
FT                   Also similar to many others on this chromosome eg. NMA1115
FT                   (fasta scores; E(): 0, 85.7% identity in 370 aa overlap)."
FT                   /db_xref="EnsemblGenomes-Gn:NMA0458"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07742"
FT                   /db_xref="GOA:A0A0U1RHD3"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR008490"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RHD3"
FT                   /protein_id="CAM07742.1"
FT                   /translation="MSTFFQQTAQAMIAKHIDRFPLLKLDQVIDWQPIEQYLNRQKNRY
FT                   LRDHRGRPAYPLLSMFKAVLLGQWHSLSDPELEHSLITRIDFNLFCRFDELSIPDYSTL
FT                   CRYRNWLAQDDTLSELLKLINRQLTEKGLKIEKASAAVVDATIIQTAGSEQRQAIEVDE
FT                   EGQVSGQTTLSKDKNARWTKKNSLYKLGYKQHTRTDAEGYIEKLYITPTNAHECTHLSP
FT                   LLEGLPKGTTVYADKGYDSKENRQHLKEHRLQNGIMRKACRNRPLTETQTKRNRYLSKT
FT                   RYSGLNLNQDKATKPQTVQIVRQGEATPYWFKFNPLYVVEQSFGTLHRKFRYARAAYFG
FT                   LSKVSAQSHLKAMCLNLLKAANRLSAPAAA"
FT   CDS_pept        complement(440504..441175)
FT                   /transl_table=11
FT                   /locus_tag="NMA0459"
FT                   /product="hypothetical protein"
FT                   /note="NMA0459, hypothetical protein, len: 223aa; similar
FT                   to TRNEW:AAD39623 (EMBL:AF069302) hypothetical protein from
FT                   Pediococcus pentosaceus (231 aa) fasta scores; E():
FT                   2.6e-27, 38.1% identity in 223 aa overlap."
FT                   /db_xref="EnsemblGenomes-Gn:NMA0459"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07743"
FT                   /db_xref="InterPro:IPR003812"
FT                   /db_xref="InterPro:IPR036597"
FT                   /db_xref="InterPro:IPR040198"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RHD4"
FT                   /protein_id="CAM07743.1"
FT                   /translation="MFPDKYKLSLKENIFLAKKVLVAQIHNLSRFENCQTTLLQTEQII
FT                   HGKNVASASLEDIQTILNLKRAYQYVISHISNGEPVDISLLKKINNIVAKDDSLAPGDF
FT                   RTGSVGVTLLDGSRHAPNPVKEIEVARVLQNIGLQSGSTTEAAVRFMLYCMRQQVFWDG
FT                   NKRTATLFANGLMMAGGCGILEISEMQMPQFNEKLSAFYRSGDDTDISKFVYQNCISGI
FT                   D"
FT   CDS_pept        complement(441995..444811)
FT                   /transl_table=11
FT                   /locus_tag="NMA0462"
FT                   /product="DNA polymerase I"
FT                   /EC_number="2.7.7.7"
FT                   /note="NMA0462, polA, DNA polymerase I, len: 938aa; similar
FT                   to many eg. SW:P00582 (DPO1_ECOLI) polA, DNA polymerase I
FT                   from Escherichia coli (928 aa) fasta scores; E(): 0, 52.5%
FT                   identity in 946 aa overlap. Contains Pfam match to entry
FT                   PF00476 DNA_pol_A, DNA polymerase family A; Pfam match to
FT                   entry PF01367 5_3_exonuclease, 5'-3' exonuclease and
FT                   Prosite match to PS00447 DNA polymerase family A
FT                   signature."
FT                   /db_xref="EnsemblGenomes-Gn:NMA0462"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07744"
FT                   /db_xref="GOA:A0A0U1RHD5"
FT                   /db_xref="InterPro:IPR001098"
FT                   /db_xref="InterPro:IPR002298"
FT                   /db_xref="InterPro:IPR002421"
FT                   /db_xref="InterPro:IPR002562"
FT                   /db_xref="InterPro:IPR008918"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR018320"
FT                   /db_xref="InterPro:IPR019760"
FT                   /db_xref="InterPro:IPR020045"
FT                   /db_xref="InterPro:IPR020046"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="InterPro:IPR036279"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RHD5"
FT                   /protein_id="CAM07744.1"
FT                   /translation="MSNRPTLLLVDGSSYLYRAYHAMGQNLTAPDGAPTGALYGVLNML
FT                   RRLRSEYPHDYCAVVFDAKGKNFRHQMFEEYKATRPPMPDDLRPQAEALPDLVRLTGWP
FT                   VLVIGQVEADDVIGTLAKQGAEHGLRVIVSTGDKDMAQLVDERVTLVNTMSSETLDIEG
FT                   VKAKFGVRPDQIRDYLALMGDKVDNVPGVEKCGPKTAVKWLEAYGSLQGVIEHASEIKG
FT                   KVGENLQAALPQLPLSYDLVTIKTDVDLHAELSDGIESLRCTTPKWAQLVVDFKRWGFR
FT                   TWLKEAESNMNTGSTDDLFGSDSIGEQAALNAEMPFEKQAEKATAPEKLDYQAVTTEAQ
FT                   FAALLDKLSRADTIGIDTETTSLDAMNASLVGISIAFQAGEAVYIPVGHSLTAAPEQLD
FT                   LQDVLGRLKPHLENPALKKIGQNLKYDQHVFANYGIALNGIAGDAMLASYIIESHLGHG
FT                   LDELSERWLGLETITYESLCGKGAKQISFADVAIGQATEYAAQDADFALRLEAHLRAQM
FT                   DAKQLEMYEKMELPVAQVLFEMERNGVQIDRAELARQSAELGAELMKLEQEAYAAAGQP
FT                   FNLNSPKQLQEILFDKMGIPTKGLKKTAKGGISTNEAVLEQLAPDYPLPKIILQNRSLA
FT                   KLKSTYTDKLPEMISPKDGRVHTTYAQAVAITGRLASNNPNLQNIPIRTAEGRRVRRAF
FT                   TAPQGSVIVSADYSQIELRIMAHLSGDKTLIAAFQNGEDVHRRTAAEVFGIAPENVSSE
FT                   QRRYAKTINFGLIYGMGQYGLAKSLGIDNISAKNFIDRYFARYPGVAEYMQRTKEQAAA
FT                   QGFVETLFGRRLYLPDIRNKNTNARAGAERAAINAPMQGTASDLIKRAMIDVSRWLSEC
FT                   EASPWDELLQSKLIMQVHDELVLEVVETELDFVKEKLPQIMAKVDGGLLDVPLVAEVGV
FT                   GENWEEAH"
FT   CDS_pept        complement(444957..445463)
FT                   /transl_table=11
FT                   /locus_tag="NMA0463"
FT                   /product="conserved hypothetical protein"
FT                   /note="NMA0463, conserved hypothetical protein, possibly
FT                   involved in autoinducer production, len: 168aa; similar to
FT                   many egs. SW:P45578 (YGAG_ECOLI) hypothetical protein from
FT                   Escherichia coli (170 aa) fasta scores; E(): 0, 81.3%
FT                   identity in 160 aa overlap and TR:Q9Z5X1 (EMBL:AF120098)
FT                   autoinducer-2 production protein LuxS from Vibrio harveyi
FT                   (172 aa) fasta scores; E(): 0, 80.7% identity in 166 aa
FT                   overlap."
FT                   /db_xref="EnsemblGenomes-Gn:NMA0463"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07745"
FT                   /db_xref="GOA:Q9JWB0"
FT                   /db_xref="InterPro:IPR003815"
FT                   /db_xref="InterPro:IPR011249"
FT                   /db_xref="InterPro:IPR037005"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9JWB0"
FT                   /protein_id="CAM07745.1"
FT                   /translation="MPLLDSFKVDHTRMHAPAVRVAKTMTTPKGDTITVFDLRFCVPNK
FT                   EILPEKGIHTLEHLFAGFMRDHLNGNGVEIIDISPMGCRTGFYMSLIGTPSEQQVADAW
FT                   LASMQDVLNVKDQSKIPELNEYQCGTYQMHSLAEAQQIAQNVLARKVAVNKNEELTLDE
FT                   GLLNA"
FT   CDS_pept        complement(445485..445904)
FT                   /transl_table=11
FT                   /locus_tag="NMA0464"
FT                   /product="hypothetical protein"
FT                   /note="NMA0464, hypothetical protein, len: 139aa; similar
FT                   to SW:P44078 (Y931_HAEIN) hypothetical protein from
FT                   Haemophilus influenzae (161 aa) fasta scores; E(): 7.7e-13,
FT                   40.7% identity in 123 aa overlap."
FT                   /db_xref="EnsemblGenomes-Gn:NMA0464"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07746"
FT                   /db_xref="InterPro:IPR014449"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RHD6"
FT                   /protein_id="CAM07746.1"
FT                   /translation="MAQLPLYLTSEIKDFTVGTPKVLESFSKHIPYGVVFEDDGDTGYF
FT                   YAASQDGILDALHIYNVEDVSDKHIPNHVLILWDDACTIAELCVNDYIHAVYDFVEQAG
FT                   YCRNGFPEAHGEWVKVENRVLDDELLDKILSREPT"
FT   CDS_pept        complement(445930..446946)
FT                   /transl_table=11
FT                   /locus_tag="NMA0465"
FT                   /product="hypothetical inner membrane protein"
FT                   /note="NMA0465, hypothetical inner membrane protein, len:
FT                   338aa; similar to SW:P45290 (YEIH_HAEIN) hypothetical
FT                   protein from Haemophilus influenzae (338 aa) fasta scores;
FT                   E(): 0, 93.2% identity in 338 aa overlap. Contains possible
FT                   membrane-spanning hydrophobic regions. Lies in a region of
FT                   unusually low GC content."
FT                   /db_xref="EnsemblGenomes-Gn:NMA0465"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07747"
FT                   /db_xref="GOA:Q9JWA8"
FT                   /db_xref="InterPro:IPR004630"
FT                   /db_xref="InterPro:IPR018383"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9JWA8"
FT                   /protein_id="CAM07747.1"
FT                   /translation="MNTRPFYFGLIFIAIIAILANYLGNTDFSHHYHISALIIAILLGM
FT                   AIGNTIYPQFSTQVEKGVLFAKGALLRTGIVLYGFRLTFGDIADVGLNAVVTDAIMLIS
FT                   TFFFTVLLGIRYLKMDKQLVYLTGAGCSICGAAAVMAAESVTKAESHKVSVAIAIVVIF
FT                   GTLAIFTYPLFYTWSQDLINAHQFGIYVGSSVHEVAQVYAIGENIDPIVANTAVISKMI
FT                   RVMMLAPFLLMLSWLLTRSDGVSENTSHKITIPWFAVLFIGVAIFNSFDLLPKELVKLF
FT                   VEIDSFLLISSMAALGLTTHASAIKKAGLKPFVLGILTYLWLVVGGFLVNYGISKLI"
FT   CDS_pept        complement(446973..447296)
FT                   /transl_table=11
FT                   /locus_tag="NMA0466"
FT                   /product="conserved hypothetical protein"
FT                   /note="NMA0466, conserved hypothetical protein, len: 107aa;
FT                   similar to many eg. SW:P27838 (CYAY_ECOLI) CyaY protein
FT                   from Escherichia coli (106 aa) fasta scores; E(): 1.8e-13,
FT                   39.0% identity in 105 aa overlap."
FT                   /db_xref="EnsemblGenomes-Gn:NMA0466"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07748"
FT                   /db_xref="GOA:P56993"
FT                   /db_xref="InterPro:IPR002908"
FT                   /db_xref="InterPro:IPR020895"
FT                   /db_xref="InterPro:IPR036524"
FT                   /db_xref="UniProtKB/Swiss-Prot:P56993"
FT                   /protein_id="CAM07748.1"
FT                   /translation="MMTESEFIRASEALFEHIEDQIDENGWDFDCRFAGNVLTIEAGDG
FT                   TQIIVNRHTPNQELWIAAKSGGYHFAEQNGKWLATRDSRDFYDVLNEALSAASGEAVKI
FT                   AEL"
FT   CDS_pept        447367..447537
FT                   /transl_table=11
FT                   /locus_tag="NMA0467"
FT                   /product="putative lipoprotein"
FT                   /note="NMA0467, possible lipoprotein, len: 56aa; similar to
FT                   SW:P17323 (LPPL_PSEAE) lipopeptide from Pseudomonas
FT                   aeruginosa (46 aa) fasta scores; E(): 1.2, 44.4% identity
FT                   in 45 aa overlap. Contains Prosite match to PS00013
FT                   Prokaryotic membrane lipoprotein lipid attachment site."
FT                   /db_xref="EnsemblGenomes-Gn:NMA0467"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07749"
FT                   /db_xref="InterPro:IPR032831"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RHD7"
FT                   /protein_id="CAM07749.1"
FT                   /translation="MKYGVFFAAATALLLSACGYKGDLYLPKEGDKARFGVIQTGLQLQ
FT                   GKPQSAPPTQK"
FT   CDS_pept        447548..448768
FT                   /transl_table=11
FT                   /locus_tag="NMA0468"
FT                   /product="diaminopimelate decarboxylase"
FT                   /EC_number="4.1.1.20"
FT                   /note="NMA0468, lysA, diaminopimelate decarboxylase, len:
FT                   406aa; similar to many eg. SW:P19572 (DCDA_PSEAE)
FT                   lysA,diaminopimelate decarboxylase from Pseudomonas
FT                   aeruginosa (415 aa) fasta scores; E(): 0, 59.0% identity in
FT                   400 aa overlap. Contains Pfam match to entry PF00278
FT                   Orn_DAP_Arg_deC, Pyridoxal-dependent decarboxylase and
FT                   Prosite match to PS00879 Orn/DAP/Arg decarboxylases family
FT                   2 signature 2."
FT                   /db_xref="EnsemblGenomes-Gn:NMA0468"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07750"
FT                   /db_xref="GOA:Q9JWA6"
FT                   /db_xref="InterPro:IPR000183"
FT                   /db_xref="InterPro:IPR002986"
FT                   /db_xref="InterPro:IPR009006"
FT                   /db_xref="InterPro:IPR022643"
FT                   /db_xref="InterPro:IPR022644"
FT                   /db_xref="InterPro:IPR022657"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9JWA6"
FT                   /protein_id="CAM07750.1"
FT                   /translation="MTLFCEQVPYPRLAEAFGTPLYVYSQSALTEAFEHYQTAFAELSP
FT                   LVCYAVKANGNLSIIKHFASLGSGFDIVSGGELARVLAAGGDAAKTIFSGVGKSEAEIE
FT                   FALNAGVKCFNMESIPEIDRIQKVAARLGKTASVSLRVNPDVDAKTHPYISTGLKANKF
FT                   GIAYADALEAYRHAAQQPNLKIIGIDCHIGSQLTDLSPLVEACERILILVDALAAEGIV
FT                   LEHLDLGGGVGIVYQDEDVPDLGAYAQAVQKLIGTRRLKLILEPGRSLVGNAGALLTRV
FT                   EFVKYGEEKNFVMVDAAMNDLMRPALYDAYHHIEAVEPKNIAPLTANIVGPICETGDFL
FT                   GKDRTIACEEGDLLLIRSAGAYGASMASNYNARNRAAEVLVDGNEYRLIRRRETLEQQM
FT                   ANELACL"
FT   CDS_pept        complement(448917..450452)
FT                   /transl_table=11
FT                   /locus_tag="NMA0470"
FT                   /product="putative sodium-dependent inner membrane
FT                   transport protein"
FT                   /note="NMA0470, possible sodium-dependent inner membrane
FT                   transport protein, len: 511aa; similar to many eg.
FT                   SW:P44849 (Y736_HAEIN) hypothetical sodium-dependent
FT                   transporter (508 aa) fasta scores; E(): 0, 59.7% identity
FT                   in 506 aa overlap. Contains possible membrane-spanning
FT                   hydrophobic regions; two Pfam matches to entry PF00209 SNF,
FT                   Sodium:neurotransmitter symporter family and Prosite match
FT                   to PS00610 Sodium:neurotransmitter symporter family
FT                   signature 1."
FT                   /db_xref="EnsemblGenomes-Gn:NMA0470"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07751"
FT                   /db_xref="GOA:A0A0U1RHD8"
FT                   /db_xref="InterPro:IPR000175"
FT                   /db_xref="InterPro:IPR037272"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RHD8"
FT                   /protein_id="CAM07751.1"
FT                   /translation="MSDSKTKERATFGTRRAFMIAAIGSAVGLGNIWRFPYIAFENGGG
FT                   AFILPYLVALLTAGIPLLLLDYAIGHRYRGSAPLAFRRLGRWFEPVGWWNVMTNIVICI
FT                   YYAVIIGWAASYTYYSVNAAWGADPQGFFFKDFLQMAGPEALGLDFVGKVAGPLAGVWV
FT                   FTAAIMALGVQKGVARASSFFMPLLLVMFLIMVGISLTLPGAAKGLDALFTPDWSKLAD
FT                   SKVWVAAYGQIFFSLSICFGIMVTYSSYLKKKTDLGGTGLVVGFANSSFELLAGIGVFA
FT                   ALGFMAQAGGKAVNEVASGGIGLAFIAFPTIINQAPMGWLIGILFFGSLVFAGVTSMIS
FT                   ILEVIVAAIQDKLNIGRVNATLLVCIPMGIVSTLLFGTATGLPVLDVMDKFVNTYGIVA
FT                   AGFVYVAAIIISGRLPELRKHLNALSSIRIGGLWTVCVVVTVVMLGYMLFKDTSGLMEK
FT                   NYEGYPDGFLSIFGWGMSAALVVFGLLLSLLPWKHGQDFNVKDEHEHEQGDEK"
FT   CDS_pept        complement(450665..451318)
FT                   /transl_table=11
FT                   /locus_tag="NMA0471"
FT                   /product="insertion element IS1016 transposase"
FT                   /note="NMA0471, insertion element IS1016 transposase, len:
FT                   217 aa; similar to many eg. TR:Q48234 (EMBL:X59756)
FT                   insertion sequence IS1016-V6 from Haemophilus influenzae
FT                   (191 aa) fasta scores; E(): 0, 70.3% identity in 175 aa
FT                   overlap. Also similar to many others on this chromosome eg.
FT                   NMA2185 (fasta scores; E(): 0, 97.7% identity in 217 aa
FT                   overlap)."
FT                   /db_xref="EnsemblGenomes-Gn:NMA0471"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07752"
FT                   /db_xref="InterPro:IPR024445"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RHD9"
FT                   /protein_id="CAM07752.1"
FT                   /translation="MKITHCKLKKKVQKELLRFFVLEVTARSAADILGIHPNSAALFYR
FT                   KIRTVINHHLALAADEVFEDPVEPDESDFGGRRKGRRGRGAAGKVVVFGILKRNGRVYT
FT                   VVVDNAKSETLLPVIKKKIMPDSIVYTDSLSSCDKLDVSGFIHYRINHSKEFADRQNHI
FT                   NGIENFWNQAKRVLRKYNGIDCKSFPLFLKECEFRFNFGTPSQQLKILRDWCGI"
FT   CDS_pept        451547..451837
FT                   /transl_table=11
FT                   /locus_tag="NMA0472"
FT                   /product="chaperonin 10 Kd subunit"
FT                   /note="NMA0472, groES, chaperonin 10 Kd subunit, len: 96aa;
FT                   strongly similar to many eg. SW:P77913 (CH10_NEIGO) groES,
FT                   chaperonin from Neisseria gonorrhoeae (96 aa) fasta scores;
FT                   E(): 0, 99.0% identity in 96 aa overlap. Contains Pfam
FT                   match to entry PF00166 cpn10, Chaperonins 10 Kd subunit and
FT                   Prosite match to PS00681 Chaperonins cpn10 signature."
FT                   /db_xref="EnsemblGenomes-Gn:NMA0472"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07753"
FT                   /db_xref="GOA:Q9JWA3"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR018369"
FT                   /db_xref="InterPro:IPR020818"
FT                   /db_xref="InterPro:IPR037124"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9JWA3"
FT                   /protein_id="CAM07753.1"
FT                   /translation="MTIRPLHDRVVVKRLEAEEKTASGIVLPGAAAEKPDMGEVIAVGA
FT                   GKIGKDGARRPLDVKVGDKIIFGKYSGQTVKADGEELLVMREEDIFGIVEK"
FT   CDS_pept        451930..453564
FT                   /transl_table=11
FT                   /locus_tag="NMA0473"
FT                   /product="chaperonin 60kD subunit"
FT                   /note="NMA0473, groEL, chaperonin 60kD subunit, len: 544aa;
FT                   similar to many eg. SW:P29842 (Z23008) groEL,chaperonin
FT                   60kD subunit from Neisseria gonorrhoeae (544 aa) fasta
FT                   scores; E(): 0, 98.3% identity in 544 aa overlap. Contains
FT                   Pfam match to entry PF00118 cpn60_TCP1,TCP-1/cpn60
FT                   chaperonin family and Prosite match to PS00296 Chaperonins
FT                   cpn60 signature. Also contains possible coiled-coil
FT                   (approx. 300-350aa)."
FT                   /db_xref="EnsemblGenomes-Gn:NMA0473"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07754"
FT                   /db_xref="GOA:P57006"
FT                   /db_xref="InterPro:IPR001844"
FT                   /db_xref="InterPro:IPR002423"
FT                   /db_xref="InterPro:IPR018370"
FT                   /db_xref="InterPro:IPR027409"
FT                   /db_xref="InterPro:IPR027410"
FT                   /db_xref="InterPro:IPR027413"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57006"
FT                   /protein_id="CAM07754.1"
FT                   /translation="MAAKDVQFGNEVRQKMVNGVNILANAVRVTLGPKGRNVVVDRAFG
FT                   GPHITKDGVTVAKEIELKDKFENMGAQMVKEVASKTNDVAGDGTTTATVLAQSIVAEGM
FT                   KYVTAGMNPTDLKRGIDKAVAALVEELKNIAKPCDTSKEIAQVGSISANSDEQVGAIIA
FT                   EAMEKVGKEGVITVEDGKSLENELDVVEGMQFDRGYLSPYFINDAEKQIAGLDNPFVLL
FT                   FDKKISNIRDLLPVLEQVAKASRPLLIIAEDVEGEALATLVVNNIRGILKTVAVKAPGF
FT                   GDRRKAMLQDIAILTGGTVISEEVGLSLEKATLDDLGQAKRIEIGKENTTIIDGFGDAA
FT                   QIEARVAEIRQQIETATSDYDKEKLQERVAKLAGGVAVIKVGAATEVEMKEKKDRVEDA
FT                   LHATRAAVEEGVVAGGGVALLRARAALENLHTGNADQDAGVQIVLRAVESPLRQIVANA
FT                   GGEPSVVVNKVLEGKGNYGYNAGSGEYGDMIEMGVLDPAKVTRSALQHAASIAGLMLTT
FT                   DCMIAEIPEDKPAMPDMGGMGGMGGMM"
FT   CDS_pept        complement(454152..456584)
FT                   /transl_table=11
FT                   /locus_tag="NMA0474"
FT                   /product="haemoglobin-haptoglobin-utilization protein"
FT                   /note="NMA0474, hpuB, haemoglobin-haptoglobin-utilization
FT                   protein, len: 810aa; strongly similar to many eg. SW:P96949
FT                   (U73112) hpuB,haemoglobin-haptoglobin-utilization protein
FT                   from Neisseria meningitidis strain DNM2 (810 aa) fasta
FT                   scores; E(): 0,96.5% identity in 810 aa overlap. Contains
FT                   Pfam match to entry PF00593 TonB_boxC, TonB dependent
FT                   receptor C-terminal region."
FT                   /db_xref="EnsemblGenomes-Gn:NMA0474"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07755"
FT                   /db_xref="GOA:Q9JWA2"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR010917"
FT                   /db_xref="InterPro:IPR010949"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039426"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9JWA2"
FT                   /protein_id="CAM07755.1"
FT                   /translation="MPIPFKPVLAAAAIAQAFPAFAADPAPQSAQTLNEITVTGTHKTQ
FT                   KLGEEKIRRKTLDKLLVNDEHDLVRYDPGISVVEGGRAGSNGFTIRGVDKDRVAINVDG
FT                   LAQAESRSSEAFQELFGAYGNFNANRNTSEPENFSEVTITKGADSLKSGSGALGGAVNY
FT                   QTKSASDYVSEDKPYHLGIKGGSVGKNSQKFSSITAAGRLFGLDALLVYTRRFGKETKN
FT                   RSTEGDIEIKNDGYVYNPTDTGGPSKYLTYVATGVARSQPDPQEWVNKSTLFKLGYNFN
FT                   DQNRIGWIFEDSRTDRFTNELSNLWTGTTTSAATGDYRHRQDVSYRRRSGVEYKNELEH
FT                   GPWDSLKLRYDKQRIDMNTWTWDIPKNYDKRGINGEVYHSFRHIRQNTAQWTADFEKQL
FT                   DFSKAVWAAQYGLGGGKGDNANSDYSYFAKLYDPKILASNQAKITMLIENRSKYKFAYW
FT                   NNAFHLGGNDRFRLNAGIRYDKNSSSAKDDPKYTTAIRGQIPHLGSERAHAGFSYGTGF
FT                   DWRFTKHLHLLAKYSTGFRAPTSDETWLLFPHPDFYLKANPNLKAEKAKNWELGLAGSG
FT                   KAGNFKLSGFKTKYRDFIELTYMGVSSDDKNNPRYAPLSDGTALVSSPVWQNQNRSAAW
FT                   VKGIEFNGTWNLDSIGLPKGLHTGLNVSYIKGKATQNNGKETPINALSPWTAVYSLGYD
FT                   APSKRWGINAYATRTAAKKPSDTVHSNDDLNNPWPYAKHSKAYTLFDLSAYLNIGKQVT
FT                   LRAAAYNITNKQYYTWESLRSIREFGTVNRVDNKTHAGIQRFTSPGRSYNFTIEAKF"
FT   CDS_pept        complement(456615..457688)
FT                   /transl_table=11
FT                   /locus_tag="NMA0475"
FT                   /product="haemoglobin-haptoglobin-utilization protein"
FT                   /note="NMA0475, hpuA, haemoglobin-haptoglobin-utilization
FT                   protein, len: 357aa; similar to many eg. TR:P96948
FT                   (EMBL:U73112) hpuA, haemoglobin-haptoglobin-utilization
FT                   protein from Neisseria meningitidis strain DNM2 (341 aa)
FT                   fasta scores; E(): 0, 77.4% identity in 359 aa overlap."
FT                   /db_xref="EnsemblGenomes-Gn:NMA0475"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07756"
FT                   /db_xref="InterPro:IPR011250"
FT                   /db_xref="InterPro:IPR031586"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RHE0"
FT                   /protein_id="CAM07756.1"
FT                   /translation="MKYKALSLLPLAAALAACAGGGVAEPHVPVSIPTATPLTGEVKLS
FT                   SDNSKIENINTANTETHPPRRTRRSLYASPQNTSSGISIQQREVEKIYFGVKSPEKSFI
FT                   FQTPGGAQYALSSYADPIVPSYSSPDFKIPDRHAGQRLADGSRIFICCSDSGATSYAEI
FT                   TKQDYMKFGAWIGPNGEIDLFAGGFPIGKTPPPAFSWGSPTTETALSKGKITYQVWGIR
FT                   VRNGQFVTSSYTPPKGSSWSGYQNTPVLSFITANFNSNKLAGEIIGNSDYGPNVKIENA
FT                   TIDGLSFSGDATSNGKTGNLEGKFFGKFNSTRSSDTGIGGKITFKDDRSLDTVFGGVIY
FT                   EKKLDDKTSQDTNHLKK"
FT   CDS_pept        458956..460473
FT                   /transl_table=11
FT                   /locus_tag="NMA0476"
FT                   /product="hypothetical periplasmic protein"
FT                   /note="NMA0476, hypothetical periplasmic protein, len:
FT                   505aa; weakly similar to hypothetical proteins eg.
FT                   TR:Q9ZF57 (EMBL:AF118122) putative outer membrane protein
FT                   from Neisseria meningitidis (488 aa) fasta scores; E():
FT                   5e-16, 26.3% identity in 452 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0476"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07757"
FT                   /db_xref="InterPro:IPR007655"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RHE1"
FT                   /protein_id="CAM07757.1"
FT                   /translation="MLYFRYGFLVVWCAAGVSAAYGADAPAILDDKALLQVQRSVSDKW
FT                   AESDWKVDNDAPRVVDGDFLLAHPKMLEHSLRDVLNGNQADLIASLADLYAKLPDYDAV
FT                   LYGRARALLAKLAGRPAEAVARYRELHGENAADERILLDLAAAEFDDFRLKSAERHFAE
FT                   AEKLDLPAPVLENVGRFRKKAEGLTGWRFSGGISPAVNRNANNAAPQYCRQNGGRQICS
FT                   VSRAERAAGLNYEIEAEKLTALADNHYLLFRSNIGGTSYYFSKKSAYDDGFGRAYLGWQ
FT                   YKNARQTAGILPFYQVQLSGSDGFDAKTKRVNNRRLPPYMLAHGVGVQLSHTYRPNPGW
FT                   QFSVALEHYRQRYREQDRAEYNNGRQDGFYVSSAKRLGESATVFGGWQFVRFVPKRETV
FT                   GGAVNNAAYRRNGVYAGWAQEWRQLGGLNSRVSASYARRNYKGVAAFSTEAQRNREWNV
FT                   SLALSHDKLSYKGIVPALNYRFGRTESNVPYAKRRNSEVFVSADWRF"
FT   CDS_pept        complement(460532..462328)
FT                   /transl_table=11
FT                   /locus_tag="NMA0477"
FT                   /product="putative para-aminobenzoate synthase component I"
FT                   /note="NMA0477, possible para-aminobenzoate synthase
FT                   component I, len: 598aa; regions similar to many eg.
FT                   SW:P05041 (PABB_ECOLI) para-aminobenzoate synthase
FT                   component I from Escherichia coli (453 aa) fasta scores;
FT                   E(): 8.5e-29, 41.2% identity in 284 aa overlap. Contains
FT                   Pfam match to entry PF01063 aminotran_4, Aminotransferase
FT                   class IV and"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0477"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07758"
FT                   /db_xref="GOA:A0A0U1RHE2"
FT                   /db_xref="InterPro:IPR001544"
FT                   /db_xref="InterPro:IPR005801"
FT                   /db_xref="InterPro:IPR015890"
FT                   /db_xref="InterPro:IPR019999"
FT                   /db_xref="InterPro:IPR036038"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RHE2"
FT                   /protein_id="CAM07758.1"
FT                   /translation="MPRIAMPYFALFDDAVSGRAKRYQNHVESRFFRPEELDALDGALQ
FT                   SGWQKGLHAVLFADYGFGLPLTGVESERGGNLALHWFADCADTDAASWLARHSDGLPAG
FT                   ISTPQSSVSEADYLDHIRQIHEAIRRGDTYQINYTTRLHLQAYGNPVKLYQRLRQPVPY
FT                   AVLSHLPDAQGQSAWTLCFSPELFLKIGSDGTISTEPMKGTAPILGDGQDERRAAELQA
FT                   DPKNRAENVMIVDLLRNDLGKIAQTGTVCVPEPFKVSRFGSVWQMTSTIQAQALPHTSF
FT                   ADILRAAFPCGSITGAPKKMSMQIIESLEAEARGLYTGSIGYLNPCSGGLGFEGTFNVV
FT                   IRTLSLTPLSDGIYQGVYGVGSGIVIDSDPAAEYRECGWKARFLNELRPDFGIFETLRV
FT                   ENGRCALLDRHLCRLKTSAQALNLPLPDGCENQIKQYIARLPDGAFRIKALLASDGISL
FT                   SRAVLNRLTDKQRVIISPTILPAQNYLRRFKTTCRTVFDQAWQTAETQGAFDSLFFNSD
FT                   GILLEGGRSNVFVKHRGQWLTPSLDLDILNGIMRQAVLDEPQKYLQTNQVIETHITQKT
FT                   LQEAEEIRLSNALRGVFAAALA"
FT   CDS_pept        complement(463713..466919)
FT                   /transl_table=11
FT                   /locus_tag="NMA0478"
FT                   /product="putative outer membrane peptidase"
FT                   /EC_number="3.4.21.-"
FT                   /note="NMA0478, possible outer membrane peptidase, len:
FT                   1068aa; similar to many eg. similar to a group of proteins
FT                   described as outer membrane antigens or peptidases egs.
FT                   SW:P31631 (SSA1_PASHA) serotype-specific antigen I from
FT                   Pasteurella haemolytica (932 aa) fasta scores; E():
FT                   5.7e-22, 26.1% identity in 509 aa overlap and SW:P09489
FT                   (PRTS_SERMA) extracellular serine protease from Serratia
FT                   marcescens (1045 aa) fasta scores; E(): 1.8e-10, 23.7%
FT                   identity in 1074 aa overlap. Contains two Pfam matches to
FT                   entry PF00082 Peptidase_S8, Subtilase family; and Prosite
FT                   match to PS00138 Serine proteases, subtilase family,serine
FT                   active site."
FT                   /db_xref="EnsemblGenomes-Gn:NMA0478"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07759"
FT                   /db_xref="GOA:A0A0U1RHE3"
FT                   /db_xref="InterPro:IPR000209"
FT                   /db_xref="InterPro:IPR005546"
FT                   /db_xref="InterPro:IPR013425"
FT                   /db_xref="InterPro:IPR015500"
FT                   /db_xref="InterPro:IPR023828"
FT                   /db_xref="InterPro:IPR034061"
FT                   /db_xref="InterPro:IPR036709"
FT                   /db_xref="InterPro:IPR036852"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RHE3"
FT                   /protein_id="CAM07759.1"
FT                   /translation="MRTTPTFPTKTFKPAAMALAVATTLSACLGGGGGGTSAPDFNAGG
FT                   TGIGSNSRATTAKSAAISYAGIKNEMCKDRSMLCAGRDDVAVTDRDAKINAPPPNLHTG
FT                   DFTNPNDAYKNLINLKPAIEAGYTGRGVEVGIVDTGESVGSISFPELYGRKEHGYNENY
FT                   KNYTAYMRKEAPEDGDGKDIEASFDDEAVIETEAKPTDIRHVKEIGHIDVVSHIIGGRS
FT                   VDGRPAGGIAPDATLHIMNTHDGTKNEIMSAAIRNAWVKLGERGVRIVNNSFGTTSRAG
FT                   TADHFQIANSEEQYRQALLAYSGGDKTDEGIRLMQQSDYGNLSYHIRNKNMLFIFSASN
FT                   DAQAQPNTLTLLPFYEKDAQKGIITVAGVDRSGEKFNGSNHCGITAMWCLSAPYEASVR
FT                   FTRTNPIQIAGTSFSAPIVTGTAALLLQKYPWMSNDNLRTTLLTTAQDIGAVGVDSKFG
FT                   WGLLDTGKAMNGPASFPFGDFTADTKGTSDIAYSFRNDISGTGGLIKKGGSQLQLHGNN
FT                   TYTGKTVIEGGSLVLYGNNKSDMHVETKGALIYNGAASGGSLNSDGIVYLADTDRSGAN
FT                   ETVHIKGDLQLGGEGTLYTRLGKLLKVDGTAMTGGKLYMSAGGKGAGYLNRTGQRVPFL
FT                   SAAKIGRDYSFFTNIETDGGLLASLDSVEKTAGSEGDTLSYYVRRGNAARTASAAAHSA
FT                   PAGLKHAVEQGGSNLENLMVELDASESSATPETVETAAADRTDMPGIRPYGATFRAAAA
FT                   VQHANAADGVRIFNNLAATVYADSTAAHADMQGRRLKAVSDGLDHNATGLRVIAQTQQD
FT                   GGTWEQGGVEGKMRGSTQTVGIAAKTGENTTAAATLGMGHSTWSENSANAKTDSISLFA
FT                   GIRHDAGDIGYLKGLFSYGRYKNSISRSTGADEHAEGSVNGTLMQLGALGGVNVPFAAT
FT                   GDLTVEGGLRYDLLKQDAFAEKGSALGWSGNSITEGTLVGLAGLKLSQPLSDKAVLFAT
FT                   AGVERDLNGRDYTVTGGFTGATAATGKTGARNMPHTRLVAGLGADVEFGNGWNGLARYS
FT                   YAGSKQYGNHSGRVGVGYRF"
FT   CDS_pept        complement(468118..469560)
FT                   /transl_table=11
FT                   /locus_tag="NMA0480"
FT                   /product="aldehyde dehydrogenase A"
FT                   /EC_number="1.2.1.22"
FT                   /note="NMA0480, aldA, aldehyde dehydrogenase A, len: 480aa;
FT                   similar to many aldehyde dehydrogenases eg. SW:P25553
FT                   (ALDA_ECOLI) aldA, aldehyde dehydrogenase A from
FT                   Escherichia coli (478 aa) fasta scores; E(): 0, 63.7%
FT                   identity in 476 aa overlap. Contains Pfam match to entry
FT                   PF00171 aldedh, Aldehyde dehydrogenase; Prosite match to
FT                   PS00070 Aldehyde dehydrogenases cysteine active site and
FT                   Prosite match to PS00687 Aldehyde dehydrogenases glutamic
FT                   acid active site."
FT                   /db_xref="EnsemblGenomes-Gn:NMA0480"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07760"
FT                   /db_xref="GOA:A0A0U1RHE4"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR015657"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RHE4"
FT                   /protein_id="CAM07760.1"
FT                   /translation="MKQLAMYINGRFENDFNGEWRNVLNPSTEEAIAREPKGGKADVDR
FT                   AVAAARAAQPAWERLPAVERGAYLRKIAQGIRERADELTDTIVAEGGKTKDLARVEVMF
FT                   TADYLDYQAEWARRYEGEIIQSDRPRENILLFKRPLGVIAGILPWNFPFFLIARKMGPA
FT                   LVTGNTIVVKPSSVTPINCHIFAEIVDAVGLPAGVFNVVNGPGAEIGNALSAHPQVDMV
FT                   SLTGSVEAGRQVMEAASANITKVSLELGGKAPAIVLKDADLDLAVKSILASRVGNTGQI
FT                   CNCAERVYVHSSLKDAFIEKMTAAMKGVRYGNPAEAEAGALEMGPLIEERAVKAVAEKV
FT                   ERAVKQGAKLVCGGKRAEGRGYFFEPTLLTDTDNSMDIMKEETFGPVLPVSAFDTLDQV
FT                   IALANDCEFGLTSSVYTTNLNEAFYVTRRLQFGETYINRENFEAMQGFHAGWKKSGIGG
FT                   ADGKHGLEEYLQTQVVYLETDI"
FT   CDS_pept        complement(469595..469795)
FT                   /transl_table=11
FT                   /locus_tag="NMA0481"
FT                   /product="hypothetical protein NMA0481"
FT                   /note="NMA0481, unknown, len: 66 aa"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0481"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07761"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RHE5"
FT                   /protein_id="CAM07761.1"
FT                   /translation="MDTVGSLAIGYATGGNAGAFTGANADWNNRQLHSSEYKLAEQYAD
FT                   IVASRLNISKETCTVVYLGIN"
FT   CDS_pept        complement(469804..470193)
FT                   /transl_table=11
FT                   /locus_tag="NMA0482"
FT                   /product="hypothetical protein NMA0482"
FT                   /note="NMA0482, unknown, len: 129 aa"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0482"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07762"
FT                   /db_xref="InterPro:IPR016767"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RHE6"
FT                   /protein_id="CAM07762.1"
FT                   /translation="MLYKCKIKKLDNTIEEAVLIEINGYELHCFISYCPFKIFENQFYE
FT                   VELSYEIFNDYILDKSTSNIGFRKIDDSFKYEITAELKNNHLTLQNIQFEEDEYLINYS
FT                   YLDNCLVTLTVDRISVSFIREIQAA"
FT   CDS_pept        complement(470401..471318)
FT                   /transl_table=11
FT                   /locus_tag="NMA0483"
FT                   /product="putative transcriptional regulator"
FT                   /note="NMA0483, possible transcriptional regulator, len:
FT                   305aa; C-terminal region weakly similar to that of many eg.
FT                   SW:Q00753 (MSMR_STRMU) msm operon regulatory protein from
FT                   Streptococcus mutans (278 aa) fasta scores; E(): 9.4e-05,
FT                   30.2% identity in 96 aa overlap. Contains Pfam match to
FT                   entry PF00165 HTH_2, Bacterial regulatory helix-turn-helix
FT                   proteins, araC family and Prosite match to PS00041
FT                   Bacterial regulatory proteins, araC family signature."
FT                   /db_xref="EnsemblGenomes-Gn:NMA0483"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07763"
FT                   /db_xref="GOA:A0A0U1RHE7"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RHE7"
FT                   /protein_id="CAM07763.1"
FT                   /translation="MEKAEHLNSSRFVNLVKSGGGSYVEGSYRFDTLSNGISIHGGTVT
FT                   ARCDFCSSRLAEPYVSFVLLLEGSLDFGINRCRFQIDADGGKIVLIAVGEEVLFSRYLY
FT                   RGGKTVKMTIKGMEQWLLRPEYARFAPLLYREPVRIWDLPPNLRGLAASCLKAVPKGHL
FT                   GETLRREADVLRLLSDLWDTVSDGIGPAAGQTAEADAMPSEDFSRILNAAFAGGAHQVN
FT                   RLADTLNISERTLQRRMRDHFGITASEWLHHKQMQHALYLLQNGGKSIGETAYLCGYRH
FT                   VSSFTQAFRQYFGSTPAETKKENR"
FT   CDS_pept        471431..472291
FT                   /transl_table=11
FT                   /locus_tag="NMA0485"
FT                   /product="putative ABC transport ATP-binding protein"
FT                   /note="NMA0485, probable ABC transport ATP-binding subunit,
FT                   len: 286aa; similar to many eg. TR:Q9Z402 (EMBL:AF106002)
FT                   toluene tolerance protein from Pseudomonas putida (269 aa)
FT                   fasta scores; E(): 0, 50.8% identity in 260 aa overlap.
FT                   Contains Pfam match to entry PF00005 ABC_tran, ABC
FT                   transporter; Prosite match to PS00017 ATP/GTP-binding site
FT                   motif A (P-loop) and Prosite match to PS00211 ABC
FT                   transporters family signature."
FT                   /db_xref="EnsemblGenomes-Gn:NMA0485"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07764"
FT                   /db_xref="GOA:A0A0U1RHE8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030296"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RHE8"
FT                   /protein_id="CAM07764.1"
FT                   /translation="MPVFPISLKIHAVKPTVRPYMSPSPFIEMKDVAFAYGDRPILNDI
FT                   NFSIPQGNFAAVMGGSGSGKTTLMRLITGQIRPQSGKVLIEGRDLAGFSADELYEHRRR
FT                   MGVLFQHGALFTDLSVFDNIAFPMRELTRLPEAVIRDLVLLKLNAVGLRGVENLMPSEL
FT                   SGGMSRRVALARTIALDPEIMLYDEPFTGLDPISLGVIAHLISRVNKALRSTSVMVTHD
FT                   IEKSLEIVDQVIFLAHGEIMFSGSPQEMRELDSPWVRQFVGGLADGPVAYRYPAQTSLQ
FT                   QDLLG"
FT   CDS_pept        472339..473115
FT                   /transl_table=11
FT                   /locus_tag="NMA0486"
FT                   /product="putative ABC transport inner membrane subunit"
FT                   /note="NMA0486, possible ABC transport inner membrane
FT                   subunit, len: 258aa; similar to many eg. TR:Q9Z401
FT                   (EMBL:AF106002) toluene tolerance protein from Pseudomonas
FT                   putida (265 aa) fasta scores; E(): 0, 51.0% identity in 255
FT                   aa overlap. Lies downstream from an putative ABC transport
FT                   ATP-binding subunit (NMA0485) and contains possible
FT                   membrane-spanning hydrophobic regions."
FT                   /db_xref="EnsemblGenomes-Gn:NMA0486"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07765"
FT                   /db_xref="GOA:A0A0U1RHE9"
FT                   /db_xref="InterPro:IPR003453"
FT                   /db_xref="InterPro:IPR030802"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RHE9"
FT                   /protein_id="CAM07765.1"
FT                   /translation="MNFIRSVGAKTLGLIQSLGSITLFLLNILAKSGTAFVRPRLSVRQ
FT                   VYFAGVLSVLIVAVSGLFVGMVLGLQGYTQLSKFKSADILGYMVAASLLRELGPVLAAI
FT                   LFASSAGGAMTSEIGLMKTTEQLEAMNVMAVNPVARVVAPRFWAGVFSMPLLASIFNVA
FT                   GIFGAYLVGVTWLGLDSGIFWSQMQNNITIHYDVINGLIKSAAFGVAVTLIAVHQGFHC
FT                   VPTSEGILRASTRTVVSSALTILAVDFILTAWMFTD"
FT   CDS_pept        473166..473660
FT                   /transl_table=11
FT                   /locus_tag="NMA0487"
FT                   /product="putative outer membrane transport protein"
FT                   /note="NMA0487, possible outer membrane transport
FT                   protein,len: 164aa; similar to many eg. TR:Q9Z400
FT                   (EMBL:AF106002) toluene tolerance protein from Pseudomonas
FT                   putida (161 aa) fasta scores; E(): 1.3e-19, 51.7% identity
FT                   in 147 aa overlap. Appears to lie in an operon downstream
FT                   of an possible ABC transporter (NMA0485 and NMA0486).
FT                   Contains Contains a possible cleavable N-terminal signal
FT                   sequence and possible membrane-spanning hydrophobic
FT                   regions."
FT                   /db_xref="EnsemblGenomes-Gn:NMA0487"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07766"
FT                   /db_xref="GOA:A0A0U1RHF0"
FT                   /db_xref="InterPro:IPR003399"
FT                   /db_xref="InterPro:IPR030970"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RHF0"
FT                   /protein_id="CAM07766.1"
FT                   /translation="MKKNILEFWVGLFVLIGAAAVAFLAFRVAGGAAFGGSDKTYAVYA
FT                   DFGDIGGLKVNAPVKSAGVLVGRVGAIGLDPKSYQARVRLDLDGKYQFSSDVSAQILTS
FT                   GLLGEQYIGLQQGGDTENLAAGDTISVTSSAMVLENLIGKFMTSFAEKNADGGNAEKAA
FT                   E"
FT   CDS_pept        473697..474287
FT                   /transl_table=11
FT                   /locus_tag="NMA0488"
FT                   /product="putative periplasmic transport protein"
FT                   /note="NMA0488, possible periplasmic transport protein,len:
FT                   196aa; weakly similar to many eg. TR:Q9Z3Z9 (EMBL:AF106002)
FT                   toluene tolerance protein from Pseudomonas putida (215 aa)
FT                   fasta scores; E(): 0.0041, 24.2% identity in 211 aa
FT                   overlap. Contains a possible cleavable N-terminal signal
FT                   sequence and appears to lie in a transport operon."
FT                   /db_xref="EnsemblGenomes-Gn:NMA0488"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07767"
FT                   /db_xref="InterPro:IPR008869"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RHF1"
FT                   /protein_id="CAM07767.1"
FT                   /translation="MKKSSFISALGIGILSIGMAFAAPADAVNQIRQNATQVLSILKSG
FT                   DANTARQKAEAYAIPYFDFQRMTALAVGNPWRTASDAQKQALAKEFQTLLIRTYSGTML
FT                   KLKNANVNVKDNPIVNKGGKEIIVRAEVGVPGQKPVNMDFTTYQSGGKYRTYNVAIEGA
FT                   SLVTVYRNQFGEIIKAKGVDGLIAELKAKNGSK"
FT   CDS_pept        474320..474622
FT                   /transl_table=11
FT                   /locus_tag="NMA0489"
FT                   /product="hypothetical protein"
FT                   /note="NMA0489, hypothetical protein, len: 100aa; similar
FT                   to SW:Q57407 (YA83_HAEIN) hypothetical protein from
FT                   Haemophilus influenzae (105 aa) fasta scores; E():
FT                   0.65,29.5% identity in 88 aa overlap."
FT                   /db_xref="EnsemblGenomes-Gn:NMA0489"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07768"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RHF2"
FT                   /protein_id="CAM07768.1"
FT                   /translation="MDFFLPNTMHTELNNGTLHISGDVTVKTLTAAAFTRFRQQCRLKD
FT                   TRAVDLSGVGRADSACVSLLLEVLRGCKGSVRLTGIPESVRALSELYEIKDWLKS"
FT   CDS_pept        474619..475458
FT                   /transl_table=11
FT                   /locus_tag="NMA0490"
FT                   /product="putative periplasmic/outer membrane protein"
FT                   /note="NMA0490, possible periplasmic/outer membrane
FT                   protein, len: 279aa; similar to many eg. SW:P43262
FT                   (VACJ_SHIFL) lipoprotein required for intercellular
FT                   spreading of Shigella flexneri (251 aa) fasta scores; E():
FT                   1.8e-14, 31.7% identity in 221 aa overlap. Seems to have a
FT                   cleavable N-term signal seq."
FT                   /db_xref="EnsemblGenomes-Gn:NMA0490"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07769"
FT                   /db_xref="GOA:A0A0U1RHF3"
FT                   /db_xref="InterPro:IPR007428"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RHF3"
FT                   /protein_id="CAM07769.1"
FT                   /translation="MKKTAYAFLLLIGFASAPAFAETRPADPYEGYNRAVFKFNDQADR
FT                   YIFAPAARGYRKVAPKPVRAGVSNFFNNLCDVVSFGSNILRLDIKRASEDLVRVGINTT
FT                   FGLGGLIDIAGAGGIPDNKNTLGDTFASWGWKNSNYFVLPVLGPSTVRDALGTGITSVY
FT                   SPKNIVFRTPVGRWGTTAVSAVSTREGLLDLTDSLDEAAIDKYSYTRDLYMKVRARQTG
FT                   ATPAEGTEDNIDIDELVESAETGAAETAVQEDSVSETQAEAAGEAETQPGTQPGTQP"
FT   CDS_pept        475463..475945
FT                   /transl_table=11
FT                   /locus_tag="NMA0491"
FT                   /product="hypothetical protein"
FT                   /note="NMA0491, hypothetical protein, len: 160aa;"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0491"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07770"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RHF4"
FT                   /protein_id="CAM07770.1"
FT                   /translation="MPSENPCSDGIPFCRNGQSETTDWAIISFLRIPRDSKGKTMYEVN
FT                   RSVFVLIPLEPFWNWLQTLPGNHLDGLTLEDIQADANSYLVRPCETADEVWDEIEARFE
FT                   DIFAAELADWCEDEREWPALDADIFNEWFDIQLSTVITDLEHEPLAREAFQPINLN"
FT   CDS_pept        475945..476328
FT                   /transl_table=11
FT                   /locus_tag="NMA0492"
FT                   /product="conserved hypothetical protein"
FT                   /note="NMA0492, conserved hypothetical protein, len: 127aa;
FT                   similar to many eg. SW:P77712 (YBAW_ECOLI) hypothetical
FT                   protein from Escherichia coli (132 aa) fasta scores; E():
FT                   3.1e-15, 40.2% identity in 127 aa overlap."
FT                   /db_xref="EnsemblGenomes-Gn:NMA0492"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07771"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RHF5"
FT                   /protein_id="CAM07771.1"
FT                   /translation="MKLTVRNYHLDGYGHVNNARYLEFFEEARWAFFEERGLLHELAGL
FT                   ILIVARIDIRYSRPAVEGDVLQFSCRLKTPGTRRIVLTQTITLPNGKTAAEADITLMPV
FT                   HAATQRTVSLPATLARALEALSE"
FT   CDS_pept        476325..476813
FT                   /transl_table=11
FT                   /locus_tag="NMA0493"
FT                   /product="putative periplasmic protein"
FT                   /note="NMA0493, possible periplasmic protein, len: 162aa;
FT                   similar to many of undefined function eg. TR:O66542
FT                   (EMBL:AE000675) from Aquifex aeolicus (146 aa) fasta
FT                   scores; E(): 1.3e-06, 32.0% identity in 128 aa overlap.
FT                   Contains a possible cleavable N-terminal signal sequence."
FT                   /db_xref="EnsemblGenomes-Gn:NMA0493"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07772"
FT                   /db_xref="GOA:A0A0U1RHF6"
FT                   /db_xref="InterPro:IPR013740"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RHF6"
FT                   /protein_id="CAM07772.1"
FT                   /translation="MKKILTAAVVALIGILLAIVLIPDSKTAPAFSLSDLHGKTVSNAD
FT                   LQGKVTLINFWFPSCPGCVSEMPKIIKTANDYKNKNFQVLAVAQPIDPIESVRQYVKDY
FT                   GLPFTVMYDADKAVGQAFGTQVYPTSVLIGKKGEILKTYVGEPDFGKLYQEIDTALAQ"
FT   CDS_pept        complement(476895..477407)
FT                   /transl_table=11
FT                   /locus_tag="NMA0494"
FT                   /product="putative acetyltransferase"
FT                   /note="NMA0494, possible acetyltransferase, len: 170aa;
FT                   similar to many eg. SW:P07464 (THGA_ECOLI) thiogalactoside
FT                   transacetylase from Escherichia coli (203 aa) fasta scores;
FT                   E(): 6.3e-10, 32.1% identity in 140 aa overlap. Contains
FT                   two Pfam match to entry PF00132 hexapep,Bacterial
FT                   transferase hexapeptide (four repeats)."
FT                   /db_xref="EnsemblGenomes-Gn:NMA0494"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07773"
FT                   /db_xref="GOA:A0A0U1RHF7"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RHF7"
FT                   /protein_id="CAM07773.1"
FT                   /translation="MMGSKFFFLLLRFAGSVLPPSHMRGIVGRRVRGFLARRVSPHIGR
FT                   GVNIERGAYVFPDTVLGDGSGIGANCEICRGPVVGKNVMMEPECLLYSTNHKFDRENKR
FT                   FEGYTEIRPITLEDDVWPGRRVIVMAGVTVGRGSVVGAGAVVTKDIPPYSLAAGNPAVV
FT                   KKNLPEG"
FT   CDS_pept        477642..477857
FT                   /transl_table=11
FT                   /locus_tag="NMA0495"
FT                   /product="50S ribosomal protein L31"
FT                   /note="NMA0495, rpmE, 50S ribosomal protein L31, len: 71aa;
FT                   similar to many eg. SW:Q03223 (RL31_BACSU) rpmE, 50S
FT                   ribosomal protein L31 (66 aa) asta scores; E():
FT                   3.8e-15,56.1% identity in 66 aa overlap. Contains Pfam
FT                   match to entry PF01197 Ribosomal_L31, Ribosomal protein L31
FT                   and Prosite match to PS01143 Ribosomal protein L31
FT                   signature."
FT                   /db_xref="EnsemblGenomes-Gn:NMA0495"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07774"
FT                   /db_xref="GOA:P66189"
FT                   /db_xref="InterPro:IPR002150"
FT                   /db_xref="InterPro:IPR027491"
FT                   /db_xref="InterPro:IPR034704"
FT                   /db_xref="InterPro:IPR042105"
FT                   /db_xref="UniProtKB/Swiss-Prot:P66189"
FT                   /protein_id="CAM07774.1"
FT                   /translation="MKQGIHPNYHEVNVTCSCGNKFATKSAMEKENFNIEVCSLCHPFY
FT                   TGTQKIVDTTGRVDKFNNKFGNLFKR"
FT   CDS_pept        478160..478801
FT                   /transl_table=11
FT                   /locus_tag="NMA0496"
FT                   /product="cadmium resistance protein"
FT                   /note="NMA0496, cad, cadmium resistance protein, len:
FT                   213aa; strongly similar to TR:O05469 (EMBL:U76550)
FT                   cadD,cadmium resistance protein from Staphylococcus aureus
FT                   (209 aa) fasta scores; E(): 0, 55.5% identity in 209 aa
FT                   overlap. Lies in a region of unusually low GC content."
FT                   /db_xref="EnsemblGenomes-Gn:NMA0496"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07775"
FT                   /db_xref="GOA:A0A0U1RHF8"
FT                   /db_xref="InterPro:IPR004676"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RHF8"
FT                   /protein_id="CAM07775.1"
FT                   /translation="MRCFMIQNVVTSIILYSGTAVDLLIILMLFFAKRKSRKDIINIYL
FT                   GQFLGSVSLILLSLLFAFVLDYIPSKEILGLLGLIPIFLGLKVLLLGDSDGEAIAKEGL
FT                   RKDNKNLIFLVAMITFASCGADNIGVFVPYFTTLNLVNLIVALLTFLVMIYLLVFSAQK
FT                   LAQVPSVGETLEKYSRWFVAVVYLGLGVYILIENNSFDMLWTVSGQEKIL"
FT   CDS_pept        478957..480633
FT                   /transl_table=11
FT                   /locus_tag="NMA0497"
FT                   /product="putative inner membrane protein"
FT                   /note="NMA0497, probable inner membrane protein, len:
FT                   558aa; similar to many eg. TR:P76473 (EMBL:AE000315)
FT                   hypothetical protein from Escherichia coli (550 aa) fasta
FT                   scores; E(): 5.4e-05, 25.1% identity in 379 aa overlap.
FT                   Contains possible membrane-spanning hydrophobic regions."
FT                   /db_xref="EnsemblGenomes-Gn:NMA0497"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07776"
FT                   /db_xref="GOA:A0A0U1RHF9"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RHF9"
FT                   /protein_id="CAM07776.1"
FT                   /translation="MLTYTPPDARPPAKTHEKPWLLLLMAFAWLWPGVFSHDLWNPDEP
FT                   AVYTAVEALAGSPTPLVAHLFGQIDFGIPPVYLWVAAAFKHLLSPWAADPYDAARFAGV
FT                   FFAVVGLTSCGFAGFNFLGRHHGRSVVLILIGCIGLIPTVHFLNPAAAAFAAAGLVLHG
FT                   YSLARRRVIAASFLLGTGWTLMSLAAAYPAAFALMLPLPVLMFFRPWQSRRLMLTAVAS
FT                   LAFALPLMTVYPLLLAKTQPALFAQWLDDHVFGTFGGVRHIQTAFSLFYYLKNLLWFAL
FT                   PALPLAVWTVCRTRLFSTDWGILGVVWMLAVLVLLAVNPQRFQDNLVWLLPPLALFGAA
FT                   QLDSLRRGAAAFVNWFGIMAFGLFAVFLWTGFFAMNYGWPAKLAERAAYFSPYYVPDID
FT                   PIPMAVAVLFTPLWLWAITRKNIRGRQAVTNWAAGVTLTWALLMTLFLPWLDAAKSHAP
FT                   VVRSMEASLSPELKRELSDGIECIDIGGGDLHTRIVWTQYGTLPHRVGDVQCRYRIVRL
FT                   PQNADAPQGWQTVWQGARPRNKDSKFALIRKTGENILKTTD"
FT   CDS_pept        480735..481340
FT                   /transl_table=11
FT                   /locus_tag="NMA0498"
FT                   /product="putative regulator of pilE expression"
FT                   /note="NMA0498, regF, probable regulator of pilE
FT                   expression, len: 201aa; similar to TR:O33374 (EMBL:X99693)
FT                   regF, regulator of pilE expression from Neisseria
FT                   gonorrhoeae (201 aa) fasta scores; E(): 0, 98.0% identity
FT                   in 201 aa overlap and SW:P05838 (SSPA_ECOLI) stringent
FT                   starvation protein A from Escherichia coli (211 aa) fasta
FT                   scores; E(): 3.3e-32, 45.8% identity in 201 aa overlap.
FT                   Also similar to many glutathione transferases eg. TR:O24595
FT                   (EMBL:Y12862) glutathione transferase from Zea mays (Maize)
FT                   (224 aa) fasta scores; E(): 2.3e-13, 32.3% identity in 195
FT                   aa overlap. Contains Pfam match to entry PF00043 GST,
FT                   Glutathione S-transferases."
FT                   /db_xref="EnsemblGenomes-Gn:NMA0498"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07777"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR004046"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR034341"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="InterPro:IPR040079"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RHG0"
FT                   /protein_id="CAM07777.1"
FT                   /translation="MMTLYSGITCPFSHRCRFVLYEKGMDFEIKDVDIYNKPEDLAVMN
FT                   PYNQVPVLVERDLVLHESNIINEYIDERFPHPQLMPGDPVMRGRGRLVLYRMEKELFNH
FT                   VQVLENPAATNKEQAKAREAIGNGLTMLAPSFSKSKYILGEDFSMIDVALAPLLWRLGH
FT                   YDVKLGKSAAPLLKYAERIFQREAFIEALTPAEKAMRK"
FT   CDS_pept        481412..481804
FT                   /transl_table=11
FT                   /locus_tag="NMA0499"
FT                   /product="putative regulator of pilE expression"
FT                   /note="NMA0499, regG, possible regulator of pilE
FT                   expression, may act in concert with regF (NMA0498) len:
FT                   130aa; similar to TR:O33375 (EMBL:X99693) regG
FT                   (FRAGMENT),possible regulator of pilE expression from
FT                   Neisseria gonorrhoeae (65 aa) fasta scores; E(): 2.6e-25,
FT                   98.5% identity in 65 aa overlap and SW:P25663 (SSPB_ECOLI)
FT                   stringent starvation protein B from Escherichia coli (165
FT                   aa) fasta scores; E(): 6.7e-17, 46.6% identity in 118 aa
FT                   overlap."
FT                   /db_xref="EnsemblGenomes-Gn:NMA0499"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07778"
FT                   /db_xref="InterPro:IPR007481"
FT                   /db_xref="InterPro:IPR036760"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RHG1"
FT                   /protein_id="CAM07778.1"
FT                   /translation="MPTSTKPYILRALCEWCSDNSLTPHILVWVNEHTRVPMQYVRDNE
FT                   IMLNIGATATQNLQIDNDWISFSARFGGQAHDIWIPVGHVLSLFARETGEGMGFELEAY
FT                   RPDTSPENTSAETAPRPAKKGLKLVK"
FT   CDS_pept        complement(482129..482575)
FT                   /transl_table=11
FT                   /locus_tag="NMA0501"
FT                   /product="conserved hypothetical protein"
FT                   /note="NMA0501, conserved hypothetical protein, len: 148aa;
FT                   similar to many eg. TR:P71480 (EMBL:U63641) hypothetical
FT                   protein from Legionella pneumophila (146 aa) fasta scores;
FT                   E(): 1.3e-19, 46.3% identity in 147 aa overlap."
FT                   /db_xref="EnsemblGenomes-Gn:NMA0501"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07779"
FT                   /db_xref="GOA:A0A0U1RHG2"
FT                   /db_xref="InterPro:IPR003789"
FT                   /db_xref="InterPro:IPR019004"
FT                   /db_xref="InterPro:IPR023168"
FT                   /db_xref="InterPro:IPR042184"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RHG2"
FT                   /protein_id="CAM07779.1"
FT                   /translation="MSLKIRLTEDMKTAMRAKDQVSLGTIRLINAAVKQFEVDERTEAD
FT                   DAKITAILTKMVKQRKDSVKIYTEAGRQDLADKENAEIEVLHRYLPQMLSAGEIRTAVD
FT                   AAVAETGAAGMADMGKVMGVLKTRLAGKADMGEVNKILKAVLTA"
FT   CDS_pept        complement(482707..482919)
FT                   /transl_table=11
FT                   /locus_tag="NMA0502"
FT                   /product="30S ribosomal protein S21"
FT                   /note="NMA0502, rpsU, 30S ribosomal protein S21, len: 70aa;
FT                   similar to many eg. SW:P02379 (RS21_ECOLI) rpsU, 30S
FT                   ribosomal protein S21 from Escherichia coli (70 aa) fasta
FT                   scores; E(): 1.3e-13, 69.5% identity in 59 aa overlap.
FT                   Contains Pfam match to entry PF01165
FT                   Ribosomal_S21,Ribosomal protein S21."
FT                   /db_xref="EnsemblGenomes-Gn:NMA0502"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07780"
FT                   /db_xref="GOA:P66518"
FT                   /db_xref="InterPro:IPR001911"
FT                   /db_xref="InterPro:IPR038380"
FT                   /db_xref="UniProtKB/Swiss-Prot:P66518"
FT                   /protein_id="CAM07780.1"
FT                   /translation="MPAIRVKENEPFEVAMRRFKRAVEKTGLLTELRAREAYEKPTTER
FT                   KRKKAAAVKRLQKRLRSQQLPPKMY"
FT   CDS_pept        complement(483208..485058)
FT                   /transl_table=11
FT                   /locus_tag="NMA0503"
FT                   /product="putative transglycosylase"
FT                   /note="NMA0503, possible transglycosylase, len: 616aa;
FT                   weakly similar to many eg. SW:P03810 (SLT_ECOLI) soluble
FT                   lytic transglycosylase from Escherichia coli (645 aa) fasta
FT                   scores; E(): 9.8e-21, 24.8% identity in 592 aa overlap.
FT                   Contains Pfam match to entry PF01464 SLT,Transglycosylase
FT                   SLT domain and Prosite match to PS00013 Prokaryotic
FT                   membrane lipoprotein lipid attachment site."
FT                   /db_xref="EnsemblGenomes-Gn:NMA0503"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07781"
FT                   /db_xref="GOA:A0A0U1RHG3"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="InterPro:IPR008939"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RHG3"
FT                   /protein_id="CAM07781.1"
FT                   /translation="MYPPSLKHSLPLLVALVLAACSSTNTLSADKTPADNIETADLSAS
FT                   VPTRPAEPEGKTLADYGGYPSALDAVKQKNDAAVAAYLENAGDSAMAENVRNEWLKSLG
FT                   ARRQWTLFAQEYAKLEPAGRAQEVECYADSSRNDYTRAAELVKNTGKLPSGCTKLLEQA
FT                   AASGLLDGNDAWRRVRGLLAGRQTTDARNLAAALGSPFDGGTQGSREYALLNVIGKEAR
FT                   KSPNAAALLSEMESGLSLEQRSFAWGVLGHYQSQNLNVPAALDYYGKVADRRQLTDDQI
FT                   EWYARAALRARRWDELASVISHMPEKLQKSPTWLYWLARSRAATGNTQEAEKLYKQAAA
FT                   TGRNFYAVLAGEELGRKIDTRNNVPDAGKNSVLRMAEDGAIKRALVLFRNSRTAGDAKM
FT                   RRQAQAEWRFATRGFDEDKLLTAAQTAFDHGFYDMAVNSAERTDRKLNYTLRYISPFKD
FT                   TVIRHAQNVNVDPAWVYGLIRQESRFVMGAQSRVGAQGLMQVMPATAREIAGKIGMDAA
FT                   QLYTADGNIRMGTWYMADTKRRLQNNEVLATAGYNAGPGRARRWQADTPLEGAVYAETI
FT                   PFSETRDYVKKVMANAAYYASLFGAPHIPLKQRMGIVPAR"
FT   CDS_pept        485588..486325
FT                   /transl_table=11
FT                   /locus_tag="NMA0504"
FT                   /product="putative ABC transport ATP-binding subunit"
FT                   /note="NMA0504, probable ABC transport ATP-binding subunit,
FT                   len: 249aa; similar to many eg. SW:P30750 (ABC_ECOLI)
FT                   ATP-binding protein ABC from Escherichia coli (343 aa)
FT                   fasta scores; E(): 0, 50.6% identity in 243 aa overlap.
FT                   Contains Pfam match to entry PF00005 ABC_tran,ABC
FT                   transporter; Prosite match to PS00017 ATP/GTP-binding site
FT                   motif A (P-loop) and Prosite match to PS00211 ABC
FT                   transporters family signature."
FT                   /db_xref="EnsemblGenomes-Gn:NMA0504"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07782"
FT                   /db_xref="GOA:A0A0U1RHG4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR026253"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041701"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RHG4"
FT                   /protein_id="CAM07782.1"
FT                   /translation="MIILDKVSKHYQTRDKTRFAAVEPTSLEIRDGEIFGLMGYSGAGK
FT                   STLLRLINLLERPDTGKVNVCGQELTALDAAALRQARQNIGMVFQQFNLLSNRTVADNV
FT                   AFPLEIAGWPSEKIKARVAECLEIVGLTERAGHYPAQLSGGQKQRVGIARALAPKPQVI
FT                   LADEPTSALDPATTRSVLECLEDINKRFNVTIVIVTHEMSVIRRLCDRAALLDKGKVVE
FT                   IVEVRGNQIHARSDIGRELIRED"
FT   CDS_pept        486327..487013
FT                   /transl_table=11
FT                   /locus_tag="NMA0505"
FT                   /product="putative inner membrane transport protein"
FT                   /note="NMA0505, probable inner membrane transport
FT                   protein,len: 228aa; similar to many eg. SW:P31547
FT                   (YAEE_ECOLI) hypothetical ABC transporter permease protein
FT                   from Escherichia coli (217 aa) fasta scores; E(): 7e-28,
FT                   43.1% identity in 209 aa overlap. Lies immediately
FT                   downstream of a putative ABC transport ATP-binding subunit
FT                   and contains Pfam match to entry PF00528
FT                   BPD_transp,Binding-protein-dependent transport systems
FT                   inner membrane component."
FT                   /db_xref="EnsemblGenomes-Gn:NMA0505"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07783"
FT                   /db_xref="GOA:A0A0U1RHG5"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RHG5"
FT                   /protein_id="CAM07783.1"
FT                   /translation="MADLTFQQAVSNIIGMKGEIVRALGETFVMVGLSTTFAVIFGTLL
FT                   GVLLFVTSSRQLHYNKLVNFLLDNLVNLMRAFPFVILMIAMIPATRAIVGSTIGPVAAS
FT                   LVLSVSGLFYFARLVEQNLREVPKGVIEAAAAMGAPPVAIIRKVLLNEARAGMVSSITV
FT                   LAIGLLSYSAAAGMIGGGGLGDLAIRYGYYRYQTEVIVFIVALLVLLVILIQSTGNALA
FT                   RKLDKR"
FT   CDS_pept        487103..487966
FT                   /transl_table=11
FT                   /locus_tag="NMA0506"
FT                   /product="putative lipoprotein"
FT                   /note="NMA0506, possible lipoprotein, len: 287aa; similar
FT                   to many eg. SW:P28635 (YAEC_ECOLI) hypothetical lipoprotein
FT                   from Escherichia coli (271 aa) fasta scores; E(): 4.7e-27,
FT                   39.4% identity in 277 aa overlap. Contains PS00013
FT                   Prokaryotic membrane lipoprotein lipid attachment site."
FT                   /db_xref="EnsemblGenomes-Gn:NMA0506"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07784"
FT                   /db_xref="InterPro:IPR004872"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RHG6"
FT                   /protein_id="CAM07784.1"
FT                   /translation="MKTFFKTLSAAALALILAACGGQKDSAPAASASAAADNGAAKKEI
FT                   VFGTTVGDFGDMVKEQIQPELEKKGYTVKLVEFTDYVRPNLALAEGELDINVFQHKPYL
FT                   DDFKKEHNLDITEVFQVPTAPLGLYPGKLKSLEEVKDGSTVSAPNDPSNFARVLVMLDE
FT                   LGWIKLKDGINPLTASKADIAENLKNIKIVELEAAQLPRSRADVDFAVVNGNYAISSGM
FT                   KLTEALFQEPSFAYVNWSAVKTADKDSQWLKDVTEAYNSDAFKAYAHKRFEGYKSPAAW
FT                   NEGAAK"
FT   CDS_pept        complement(488028..488597)
FT                   /transl_table=11
FT                   /locus_tag="NMA0507"
FT                   /product="putative decarboxylase"
FT                   /EC_number="4.1.1.-"
FT                   /note="NMA0507, probable decarboxylase, len: 189aa; similar
FT                   to many eg. SW:P33751 (PAD1_YEAST) phenylacrylic acid
FT                   decarboxylase from Saccharomyces cerevisiae (Baker's yeast)
FT                   (242 aa) fasta scores; E(): 1e-30, 42.2% identity in 185 aa
FT                   overlap."
FT                   /db_xref="EnsemblGenomes-Gn:NMA0507"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07785"
FT                   /db_xref="GOA:Q9JW78"
FT                   /db_xref="InterPro:IPR003382"
FT                   /db_xref="InterPro:IPR004507"
FT                   /db_xref="InterPro:IPR036551"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9JW78"
FT                   /protein_id="CAM07785.1"
FT                   /translation="MVRRLIIGISGASGFQYGVKALELLRAQDIETHLVVSKGAEMARA
FT                   SETAYARDEVYALADFVHPIGNIGACIASGTFKTDGMLVAPCSMRTLASVVHGFGDNLL
FT                   TRAADVVLKERRRLVLMVRETPLNLAHLDNMKRVTEMGGVVFPPVPAMYRKPQTADDIV
FT                   AHSVAHALSLFGIDTPDSAEWQGMAD"
FT   CDS_pept        488755..489615
FT                   /transl_table=11
FT                   /locus_tag="NMA0508"
FT                   /product="putative chromosome segregation proteins"
FT                   /note="NMA0508, possible chromosome segregation
FT                   proteins,len: 286aa; similar to many eg. SW:P26497
FT                   (SP0J_BACSU) stage 0 sporulation protein from Bacillus
FT                   subtilis (282 aa) fasta scores; E(): 0, 41.3% identity in
FT                   286 aa overlap. Contains possible helix-turn-helix motifs
FT                   132-153aa (+5.12 SD) and 143-164aa (+5.01 SD)."
FT                   /db_xref="EnsemblGenomes-Gn:NMA0508"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07786"
FT                   /db_xref="GOA:Q9JW77"
FT                   /db_xref="InterPro:IPR003115"
FT                   /db_xref="InterPro:IPR004437"
FT                   /db_xref="InterPro:IPR036086"
FT                   /db_xref="InterPro:IPR041468"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9JW77"
FT                   /protein_id="CAM07786.1"
FT                   /translation="MAKVKGGLGRGLDSLLANGADNSSGDRLTTVAVKDIRPGRYQARV
FT                   QIDDEALQELADSIKAQGVIQPVIVREHGLSRYELIAGERRWRAAQIAGLTEIPAVIKT
FT                   ISDETALAMGLIENLQRENLNPIEEAQGLKRLADEFGLTHETIAQAVGKSRSAISNSLR
FT                   LLSLPEPVQEMLYQRRLEMGHARALLTLPVVEQLELAQKAVKNGWSVREVERRSQAALQ
FT                   NKRPEPKKTAAADIGRLNDLLTEKLGVNAEIKTANHKKGKIILHFDTPETFDHILKQLG
FT                   IDYRP"
FT   CDS_pept        489750..490088
FT                   /transl_table=11
FT                   /locus_tag="NMA0510"
FT                   /product="hypothetical protein"
FT                   /note="NMA0510, hypothetical protein, len: 112aa; contains
FT                   Prosite match to PS00013 Prokaryotic membrane lipoprotein
FT                   lipid attachment site and a possible helix-turn-helix motif
FT                   32-53aa (+2.63 SD)."
FT                   /db_xref="EnsemblGenomes-Gn:NMA0510"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07787"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RHG7"
FT                   /protein_id="CAM07787.1"
FT                   /translation="MNTRIIVSAAFVALALAGCGSINNVTVSDQKLQERAAFALGVSPN
FT                   AVKISNRSNEGIRINFTATVGKRVSQCYVTSVISTIGVTTSDAICLGGGTHKGKSQCNA
FT                   LLKAAGRC"
FT   CDS_pept        490197..490961
FT                   /transl_table=11
FT                   /locus_tag="NMA0511"
FT                   /product="insertion element IS1655 transposase"
FT                   /note="NMA0511, insertion element IS1655 transposase, len:
FT                   254aa; similar to many eg. SW:P37247 (TRA4_BACFR) insertion
FT                   element IS4351 transposase from Bacteroides fragilis (326
FT                   aa) fasta scores; E(): 3e-29, 38.5% identity in 252 aa
FT                   overlap. Also similar to many others on this chromosome eg.
FT                   NMA1486 (fasta scores; E(): 0, 100.0% identity in 254 aa
FT                   overlap). Contains Pfam match to entry PF01460
FT                   Transposase_4, Transposase IS30 family. Contains possible
FT                   helix-turn-helix motif 22-43aa (+4.99 SD)."
FT                   /db_xref="EnsemblGenomes-Gn:NMA0511"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07788"
FT                   /db_xref="GOA:A0A0U1RHG8"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025246"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RHG8"
FT                   /protein_id="CAM07788.1"
FT                   /translation="MSYTQLTQGERYHIQYLFRHCTVTEIAKQLNRHKSTISREIRRHR
FT                   TQGQQYSAEKAQRQSRTIKQRKRQPYKLDSQLIQHIDTLIRRKLSPEQVCAYLRKHHQI
FT                   TLHHSTIYRYLRQDKSNGSTLWQHLRICSKPYRKRYGSTWTRGKVPNRVGIENRPAIVD
FT                   QKSRIGDWEADTIVGKGQKSALLTLVERVTRYTIICKLDSLKAEDTARAAVRALKAHKD
FT                   RVHTITMDNGKEFYQHTKITKALKAETYFCRP"
FT   CDS_pept        491540..491893
FT                   /transl_table=11
FT                   /locus_tag="NMA0512"
FT                   /product="putative ATP synthase I"
FT                   /note="NMA0512, atpI, probable ATP synthase I, inner
FT                   membrane protein, len: 117aa; weakly similar to many eg.
FT                   SW:P03808 (ATPZ_ECOLI) atpI, probable ATP synthase I from
FT                   Escherichia coli (125 aa) fasta scores; E(): 0.93, 25.5%
FT                   identity in 102 aa overlap. Contains possible
FT                   membrane-spanning hydrophobic regions."
FT                   /db_xref="EnsemblGenomes-Gn:NMA0512"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07789"
FT                   /db_xref="GOA:A0A0U1RHG9"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RHG9"
FT                   /protein_id="CAM07789.1"
FT                   /translation="MKQIIILQSAVLSICAAVAFAVWGFAGFLSAVGGGLSYLLPTFVA
FT                   VLLLKLFRGNPFLQSRMFVFGEILKVVLSLLSMLAVFAVWHQSLVFAPFLMGLLGVSHL
FT                   VFLVLLRVKDYGR"
FT   CDS_pept        491883..492749
FT                   /transl_table=11
FT                   /locus_tag="NMA0513"
FT                   /product="ATP synthase A chain"
FT                   /EC_number="3.6.1.34"
FT                   /note="NMA0513, atpB, ATP synthase A chain, len: 288aa;
FT                   similar to many eg. SW:P00855 (ATP6_ECOLI) atpB, ATP
FT                   synthase A chain from Escherichia coli (271 aa) fasta
FT                   scores; E(): 0, 47.2% identity in 290 aa overlap. Contains
FT                   Pfam match to entry PF00119 ATP-synt_A, ATP synthase A
FT                   chain and Prosite match to PS00449 ATP synthase a subunit
FT                   signature."
FT                   /db_xref="EnsemblGenomes-Gn:NMA0513"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07790"
FT                   /db_xref="GOA:A0A0U1RHH0"
FT                   /db_xref="InterPro:IPR000568"
FT                   /db_xref="InterPro:IPR023011"
FT                   /db_xref="InterPro:IPR035908"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RHH0"
FT                   /protein_id="CAM07790.1"
FT                   /translation="MAGETITAADYIKHHLQSLTSLSDVTQGQGLKNIADFSFINLDAV
FT                   FFAVLLGVIGSFLLWRGAKKATAGVPGRFQAAVEILFEFVDDMCKSIIHNEKSRKAVAP
FT                   LGLTLFVWIFLMNAMDMLPVDLLPMVWQGITGNHHALLRVVPTADLNTTLALAVGVLLI
FT                   CIYYNIKIKGLGGWFHELFSAPFGAKLAPANFLLNLVEFLSKTVSHGMRLFGNMYAGEL
FT                   VFLLIALLGGAWAASGSVEVMDPILFVFHIIAGLAWAIFHILVITLQAFIFMALAFVYI
FT                   GQAHDAH"
FT   CDS_pept        492806..493042
FT                   /transl_table=11
FT                   /locus_tag="NMA0514"
FT                   /product="ATP synthase C chain"
FT                   /EC_number="3.6.1.34"
FT                   /note="NMA0514, atpE, ATP synthase C chain, len: 78aa;
FT                   similar to many eg. SW:P00844 (ATPL_ECOLI) atpE, ATP
FT                   synthase C chain from Escherichia coli (79 aa) fasta
FT                   scores; E(): 1.3e-08, 43.7% identity in 71 aa overlap.
FT                   Contains Pfam match to entry PF00137 ATP-synt_C, ATP
FT                   synthase subunit C and Prosite match to PS00605 ATP
FT                   synthase c subunit signature."
FT                   /db_xref="EnsemblGenomes-Gn:NMA0514"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07791"
FT                   /db_xref="GOA:A0A0U1RHH1"
FT                   /db_xref="InterPro:IPR000454"
FT                   /db_xref="InterPro:IPR002379"
FT                   /db_xref="InterPro:IPR005953"
FT                   /db_xref="InterPro:IPR020537"
FT                   /db_xref="InterPro:IPR035921"
FT                   /db_xref="InterPro:IPR038662"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RHH1"
FT                   /protein_id="CAM07791.1"
FT                   /translation="MGLIAIACGLIVALGALGASIGIAMVGSKYLESSARQPELIGPLQ
FT                   TKLFLIAGLIDAAFLIGVAIALLFAFVNPFAGA"
FT   CDS_pept        493113..493583
FT                   /transl_table=11
FT                   /locus_tag="NMA0515"
FT                   /product="ATP synthase B chain"
FT                   /EC_number="3.6.1.34"
FT                   /note="NMA0515, atpF, ATP synthase B chain, len: 156aa;
FT                   similar to many eg. SW:P00859 (ATPF_ECOLI) atpF, ATP
FT                   synthase B chain from Escherichia coli (156 aa) fasta
FT                   scores; E(): 1.1e-17, 41.7% identity in 156 aa overlap.
FT                   Contains Pfam match to entry PF00430 ATP-synt_B, ATP
FT                   synthase B/B', and PS00017 ATP/GTP-binding site motif A
FT                   (P-loop)."
FT                   /db_xref="EnsemblGenomes-Gn:NMA0515"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07792"
FT                   /db_xref="GOA:A1IPX1"
FT                   /db_xref="InterPro:IPR002146"
FT                   /db_xref="InterPro:IPR005864"
FT                   /db_xref="InterPro:IPR028987"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1IPX1"
FT                   /protein_id="CAM07792.1"
FT                   /translation="MNINATLFAQIIVFFGLVWFTMKFVWPPIAKALDERAAKVAEGLA
FT                   AAERGKSDFEQAEKKVAELLAEGRNQVSEMVANAEKRAAKIVEEAKEQASSEAARIAAQ
FT                   AKADVEQELFRARESLREQVAVLAVKGAESILRSEVDASKHAKLLDTLKQEL"
FT   CDS_pept        493588..494121
FT                   /transl_table=11
FT                   /locus_tag="NMA0516"
FT                   /product="ATP synthase delta chain"
FT                   /EC_number="3.6.1.34"
FT                   /note="NMA0516, atpH, ATP synthase delta chain, len: 177aa;
FT                   similar to many eg. SW:P00831 (ATPD_ECOLI) atpH,ATP
FT                   synthase delta chain from Escherichia coli (177 aa) fasta
FT                   scores; E(): 9.1e-13, 32.0% identity in 175 aa overlap.
FT                   Contains Pfam match to entry PF00213 OSCP, ATP synthase
FT                   delta (OSCP) subunit and Prosite match to PS00389 ATP
FT                   synthase delta (OSCP) subunit signature."
FT                   /db_xref="EnsemblGenomes-Gn:NMA0516"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07793"
FT                   /db_xref="GOA:A1IPX2"
FT                   /db_xref="InterPro:IPR000711"
FT                   /db_xref="InterPro:IPR020781"
FT                   /db_xref="InterPro:IPR026015"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1IPX2"
FT                   /protein_id="CAM07793.1"
FT                   /translation="MAEFATIARPYAKALFGLAQEKSQIESWLGGLEKLAAVVQEGKVA
FT                   SLIDRPETNASEKADILIDLVGLKDKELKNFVIVLAGQKRLSILPEVYAQYQDLTLSFN
FT                   HIKSAVIYSAYPLTDKQVGELAQMLNKRFDSELKISVEIEPELIGGIKVEVGDQVLDLS
FT                   VQGKLSALYTTMTN"
FT   CDS_pept        494132..495679
FT                   /transl_table=11
FT                   /locus_tag="NMA0517"
FT                   /product="ATP synthase alpha chain"
FT                   /EC_number="3.6.1.34"
FT                   /note="NMA0517, atpA, ATP synthase alpha chain, len: 515aa;
FT                   similar to many eg. SW:P00822 (ATPA_ECOLI) atpA,ATP
FT                   synthase alpha chain from Escherichia coli (513 aa) fasta
FT                   scores; E(): 0, 69.4% identity in 513 aa overlap. Contains
FT                   Pfam match to entry PF00006 ATP-synt_ab, ATP synthase alpha
FT                   and beta subunits; Pfam match to entry PF00422
FT                   ATP-synt_A-c, ATP synthase Alpha chain, C terminal; Prosite
FT                   match to PS00017 ATP/GTP-binding site motif A (P-loop) and
FT                   Prosite match to PS00152 ATP synthase alpha and beta
FT                   subunits signature."
FT                   /db_xref="EnsemblGenomes-Gn:NMA0517"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07794"
FT                   /db_xref="GOA:Q9JW72"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR000793"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005294"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR023366"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033732"
FT                   /db_xref="InterPro:IPR036121"
FT                   /db_xref="InterPro:IPR038376"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9JW72"
FT                   /protein_id="CAM07794.1"
FT                   /translation="MQLNPAEISDLIKAKIENLSVNAEVRTRGTVISVTDGIVRIHGLS
FT                   DAMQGEMLEFPGNTFGLAMNLERDSVGAVVLGEHEHIKEGDTVTCTGRILEVPVGRELV
FT                   GRVVDALGRPIDGKGPINTTLTAPIEKIAPGVIARKSVDQPMQTGLKAIDSMVPVGRGQ
FT                   RELIIGDRQTGKTAVALDAIVNQKGTGVICIYVAIGQKASSIANVVRKLEEHGAMEHTI
FT                   VVAATASEAAALQYIAPYSGCTMGEFFRDRGEDALIVYDDLSKQAVAYRQISLLLRRPP
FT                   GREAYPGDVFYLHSRLLERAARVNEHEVEKLTNGEVKGKTGSLTALPIIETQAGDVSAF
FT                   VPTNVISITDGQIFLETDLFNAGIRPAINAGISVSRVGGAAQTKVIKKLGGGIRLALAQ
FT                   YRELAAFSQFASDLDEATRKQLEHGEVVTELMKQKQFSTLNTAEMALTLWAINNGSYSD
FT                   VPVAKALAFESEFLSFVRTQHPEVLEAVNASGAMSDESEKTLEAAMKSFKSSYAYQA"
FT   CDS_pept        495704..496579
FT                   /transl_table=11
FT                   /locus_tag="NMA0518"
FT                   /product="ATP synthase gamma chain"
FT                   /EC_number="3.6.1.34"
FT                   /note="NMA0518, atpG, ATP synthase gamma chain, len: 291aa;
FT                   similar to many eg. SW:P00837 (ATPG_ECOLI) atpG,ATP
FT                   synthase gamma chain from Escherichia coli (287 aa) fasta
FT                   scores; E(): 0, 52.2% identity in 291 aa overlap. Contains
FT                   Pfam match to entry PF00231 ATP-synt, ATP synthase and
FT                   PS00153 ATP synthase gamma subunit signature."
FT                   /db_xref="EnsemblGenomes-Gn:NMA0518"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07795"
FT                   /db_xref="GOA:Q9JW71"
FT                   /db_xref="InterPro:IPR000131"
FT                   /db_xref="InterPro:IPR023632"
FT                   /db_xref="InterPro:IPR035968"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9JW71"
FT                   /protein_id="CAM07795.1"
FT                   /translation="MAVGKEILTKIRSVQNTQKITKAMQMVSTSKMRKTQERMRLARPY
FT                   AEKVRMVMSHLAQTNTDHGIPLLESHREIRRVGFILITSDKGLCGGLNANVLKKFLAQV
FT                   QEYQNQGIEEEIVCLGSKGLMACQSIGLNVVASAVNLGDTPKMEMLLGPLTELFQRYEK
FT                   HEIDRIHLVYSGFVNTMRQEPRMEVLLPIGENVIGDSAPKSPFSWEYRYEPTALAVLEY
FT                   LVRRYLESVVYQALSDNMASEQAARMVAMKAATDNAGNAIKELRLVYNKSRQAAITTEL
FT                   SEIVAGAAAV"
FT   CDS_pept        496617..498014
FT                   /transl_table=11
FT                   /locus_tag="NMA0519"
FT                   /product="ATP synthase beta chain"
FT                   /EC_number="3.6.1.34"
FT                   /note="NMA0519, atpD, ATP synthase beta chain, len: 465aa;
FT                   similar to many eg. SW:P00824 (ATPB_ECOLI) atpD, ATP
FT                   synthase beta chain from Escherichia coli (459 aa) fasta
FT                   scores; E(): 0, 81.9% identity in 464 aa overlap. Contains
FT                   Pfam match to entry PF00006 ATP-synt_ab, ATP synthase alpha
FT                   and beta subunits; Pfam match to entry PF00306
FT                   ATP-synt_A-c, ATP synthase Alpha chain, C terminal; Prosite
FT                   match to PS00017 ATP/GTP-binding site motif A (P-loop) and
FT                   Prosite match to PS00152 ATP synthase alpha and beta
FT                   subunits signature."
FT                   /db_xref="EnsemblGenomes-Gn:NMA0519"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07796"
FT                   /db_xref="GOA:Q9JW70"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005722"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR024034"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036121"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9JW70"
FT                   /protein_id="CAM07796.1"
FT                   /translation="MSQGKIVQIIGAVVDVEFPRDMIPRVYDALKLDENGLTLEVQQLL
FT                   GDGVVRTIAMGSSDGLKRGMTVSNTGAPITVPVGKGTLGRIVDVLGTPVDEAGPIDTDK
FT                   SRAIHQAAPKFDELSSTTELLETGIKVIDLLCPFAKGGKVGLFGGAGVGKTVNMMELIN
FT                   NIAKAHSGLSVFAGVGERTREGNDFYHEMKDSNVLDKVAMVYGQMNEPPGNRLRVALTG
FT                   LTMAEYFRDEKDENGKGRDVLFFVDNIYRYTLAGTEVSALLGRMPSAVGYQPTLAEEMG
FT                   CLQERITSTQTGSITSIQAVYVPADDLTDPSPATTFAHLDATVVLSRDIASLGIYPAVD
FT                   PLDSTSRQLDPMVLGQEHYDVARGVQSTLQKYKELRDIIAILGMDELSDEDKLTVMRAR
FT                   KIQRFLSQPFHVAEVFTGSPGKYVALRDTIAGFKAILNGEYDYLPEQAFYMVGSIEEAV
FT                   EKAKTLN"
FT   CDS_pept        498025..498447
FT                   /transl_table=11
FT                   /locus_tag="NMA0520"
FT                   /product="ATP synthase epsilon chain"
FT                   /EC_number="3.6.1.34"
FT                   /note="NMA0520, atpC, ATP synthase epsilon chain, len:
FT                   140aa; similar to many eg. SW:P00832 (ATPE_ECOLI) atpC,ATP
FT                   synthase epsilon chain from Escherichia coli (138 aa) fasta
FT                   scores; E(): 1.8e-16, 44.7% identity in 132 aa overlap.
FT                   Contains Pfam match to entry PF00401 ATP-synt_DE,ATP
FT                   synthase, Delta/Epsilon chain."
FT                   /db_xref="EnsemblGenomes-Gn:NMA0520"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07797"
FT                   /db_xref="GOA:Q9JW69"
FT                   /db_xref="InterPro:IPR001469"
FT                   /db_xref="InterPro:IPR020546"
FT                   /db_xref="InterPro:IPR020547"
FT                   /db_xref="InterPro:IPR036771"
FT                   /db_xref="InterPro:IPR036794"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9JW69"
FT                   /protein_id="CAM07797.1"
FT                   /translation="MSIMQVEVVSSEQKIYSGEATFIVVPTVQGELGIYPRHEPIMSLV
FT                   RLGALRLTVLGEDKEVLVAVSGGVLEVQPDKVTVLADVAVRSAEMDQARAEEAKKAAEA
FT                   GISQAKDDKALAEAHKALAAAIAQLKTLDYIRSHKK"
FT   CDS_pept        498802..499707
FT                   /transl_table=11
FT                   /locus_tag="NMA0521"
FT                   /product="glycyl-tRNA synthetase alpha chain"
FT                   /EC_number="6.1.1.14"
FT                   /note="NMA0521, glyQ, glycyl-tRNA synthetase alpha
FT                   chain,len: 301aa; similar to many eg. SW:P00960
FT                   (SYGA_ECOLI) glyQ, glycyl-tRNA synthetase alpha chain from
FT                   Escherichia coli (303 aa) fasta scores; E(): 0, 73.7%
FT                   identity in 293 aa overlap. Contains Prosite match to
FT                   PS00339 Aminoacyl-transfer RNA synthetases class-II
FT                   signature 2."
FT                   /db_xref="EnsemblGenomes-Gn:NMA0521"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07798"
FT                   /db_xref="GOA:P67028"
FT                   /db_xref="InterPro:IPR002310"
FT                   /db_xref="InterPro:IPR006194"
FT                   /db_xref="UniProtKB/Swiss-Prot:P67028"
FT                   /protein_id="CAM07798.1"
FT                   /translation="MLTFQQIIFKLQTFWADKGCTVIQPFDMEVGAGTSHPATCLRALG
FT                   PEPWFAAYVQPSRRPKDGRYGDNPNRLQHYYQFQVALKPAPANIQDLYLDSLRELGIDP
FT                   KVHDIRFVEDDWENPTLGAWGLGWEVWLNGMEVTQFTYFQQVGGIDCTPVLGEITYGIE
FT                   RLAMYLQGVENVYDLVWAKTLDGNTVTYGDVYHQNEVEQSTYNFEYSDADWLLRQFNDY
FT                   EAQAKRLLAEENAALALPAYELVLKAGHTFNLLDARGAISVTERATYIGRIRALSRAVA
FT                   QKYVESREKLGFPLMKANAA"
FT   CDS_pept        499784..500194
FT                   /transl_table=11
FT                   /locus_tag="NMA0522"
FT                   /product="hypothetical protein"
FT                   /note="NMA0522, hypothetical protein, len: 136aa; similar
FT                   to SW:P44649 (YGGL_HAEIN) hypothetical protein from
FT                   Haemophilus influenzae (114 aa) fasta scores; E():
FT                   0.015,32.1% identity in 106 aa overlap."
FT                   /db_xref="EnsemblGenomes-Gn:NMA0522"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07799"
FT                   /db_xref="InterPro:IPR007416"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RHH2"
FT                   /protein_id="CAM07799.1"
FT                   /translation="MPVYFRTPSRKRLHKMNRRQHKKLHLGEFQALIFGVQGSLHQAED
FT                   DAEAFGRFMDELIAYLVVNGLEMAGGGDCGDFSCLFQKSGARSLGETEKKAIISWLADR
FT                   EDVATLHATPLVDGFYGDDGWENYSETYKQAD"
FT   CDS_pept        500215..502278
FT                   /transl_table=11
FT                   /locus_tag="NMA0523"
FT                   /product="putative glycyl-tRNA synthetase beta subunit"
FT                   /EC_number="6.1.1.14"
FT                   /note="NMA0523, glyS, probable glycyl-tRNA synthetase beta
FT                   subunit, len: 687 aa; similar to many e.g. SW:SYGB_ECOLI
FT                   (EMBL:J01622), glyS, Escherichia coli glycyl-tRNA
FT                   synthetase beta subunit (EC 6.1.1.14) (688 aa), fasta
FT                   scores; E(): 0, 45.7% identity in 687 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0523"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07800"
FT                   /db_xref="GOA:Q9JW67"
FT                   /db_xref="InterPro:IPR006194"
FT                   /db_xref="InterPro:IPR008909"
FT                   /db_xref="InterPro:IPR015944"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9JW67"
FT                   /protein_id="CAM07800.1"
FT                   /translation="MMTQTLLIELLTEELPPKALNNLGNHFAAAVAEGLEKAQLVDGAA
FT                   EYTAYASPRRLAVQVKNVKAVQADQKIVKKGPAVANAVKDGAPTKALEGFARGAGAKIE
FT                   DLTIVHDGKQDVYAYEYVQTGKLLGELLEDIINAAVKKLPIPKVMRWGSSTFTFVRPVH
FT                   GLIVLHGGDIVNVSVLGLQSGNKTLGHRFLSDGEITIENADSYAEQMREQGKVVASFAE
FT                   RKAAIQTALEGQARRLNAAVAADEALLDEVTALVEWPVVLEAGFEEHFLAVPQECLILT
FT                   MQQNQKYFPLLDQNGKLMNRFLLVSNLQTEDPSHIIQGNERVLRARLSDAEFFYKQDQK
FT                   ATLESRLPKLSGVVYHNKIGSQAERIERLQSIAAHIAKALGADAAAAERAARLAKADLV
FT                   TEMVGEFPELQGTMGKYYARLDGETEEIAEAVEQHYQPRFAGDKLPESKIATAVALADK
FT                   LETLVGIWGIGLIPTSDKDPYALRRSALGILRMLMQYGLDVNELIQTAFDSFPKGLLNE
FT                   KTPSETADFMQARLAVLLQNDYPQDIVAAVLAKQPRRLDDVVAKLQAVASFKQLPEAAA
FT                   LAAANKRVQNLLKKADAELGVVNESLLQQDEEKALFAAAQGLQPKIAAAVAEGNFQTAL
FT                   SELASVKPQVDAFFDGVMVMAEDAAVKQNRLNLLNRLAEQMNAVADIALLGE"
FT   CDS_pept        502343..503383
FT                   /transl_table=11
FT                   /locus_tag="NMA0524"
FT                   /product="lacto-N-neotetraose biosynthesis glycosyl
FT                   tranferase"
FT                   /note="NMA0524, lgtA, lacto-N-neotetraose biosynthesis
FT                   glycosyl tranferase, len: 346 aa; highly similar to
FT                   TR:Q51115 (EMBL:U25839), lgtA, Neisseria meningitidis
FT                   lacto-N-neotetraose biosynthesis glycosyl tranferase (333
FT                   aa), fasta scores; E(): 0, 94.3% identity in 333 aa
FT                   overlap. Contains Pfam match to entry PF00535
FT                   Glycos_transf_2, Glycosyl transferases"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0524"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07801"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RHH3"
FT                   /protein_id="CAM07801.1"
FT                   /translation="MQPLVSVLICAYNVEKYFAQSLATVVNQTWRNLEILIVDDGSTDG
FT                   TLAIAKDFQKRDSRIKILAQAQNSGLIPSLNIGLDELAKSGMGEYIARTDADDIAAPDW
FT                   IEKIVGEMEKDRSIIAMGAWLEVLSEEKDGNRLARHHRHGKIWKKPTRHEDIADFFPFG
FT                   NPIHNNTMIMRRSVIDGGLRYNTERDWAEDYQFWYDVSKLGRLAYYPEALVKYRLHANQ
FT                   VSSKYSIRQHEIAQGIQKTARNDFLQSMGFKTRFDSLEYRQIKAVAYELLEKHLPEEDF
FT                   ERARRFLYQCFKRTDTPPAGAWLDFAADGKMRRLFTMRQYFGILHRLIKNRRQARSDSA
FT                   GKEQEI"
FT   CDS_pept        503383..504222
FT                   /transl_table=11
FT                   /locus_tag="NMA0525"
FT                   /product="lacto-N-neotetraose biosynthesis glycosyl
FT                   tranferase"
FT                   /note="NMA0525, lgtB, lacto-N-neotetraose biosynthesis
FT                   glycosyl tranferase, len:279 aa; highly similar to
FT                   SW:LGTB_NEIME (EMBL:U25839), lgtB, Neisseria meningitidis
FT                   MC58 lacto-N-neotetraose biosynthesis glycosyl tranferase
FT                   (275 aa), fasta scores; E(): 0, 92.5% identity in 279 aa
FT                   overlap. Highly similar to NMA0527, fasta scores; E():
FT                   0,75.7% identity in 280 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0525"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07802"
FT                   /db_xref="GOA:P57033"
FT                   /db_xref="InterPro:IPR002654"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57033"
FT                   /protein_id="CAM07802.1"
FT                   /translation="MQNHVISLASAAERRAHITDTFGVRGIPFQFFDALMPSERLEQAM
FT                   AELVPGLSAHPYLSGVEKACFMSHAVLWKQALDEGLPYIAVFEDDVLLGEGAEKFLAED
FT                   AWLQERFDPDSAFIVRLETMFMHVLTSPSGVADYCGRAFPLLESEHWGTAGYIISRKAM
FT                   WFFLDRFAALPSEGLHPVDWMMFGNPDDRERMPVCQLNPALCAQELHYAKFHDQNSALG
FT                   SLIEHDRCLNSKQQRRDSPANTFKHRLIRALTKISREREKRRQRREQLIGKIIVPFQ"
FT   CDS_pept        504246..504368
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="NMA0526"
FT                   /product="lacto-N-neotetraose biosynthesis glycosyl
FT                   tranferase (pseudogene)"
FT                   /note="NMA0526, lgtA2', pseudogene, lacto-N-neotetraose
FT                   biosynthesis glycosyl tranferase, len: 123 bp; highly
FT                   similar to the C-terminus of TR:Q51115 (EMBL:U25839),lgtA,
FT                   Neisseria meningitidis MC58 glycosyl tranferase (333 aa),
FT                   fasta scores; E(): 1.9e-16, 97.6% identity in 41 aa
FT                   overlap"
FT   CDS_pept        504371..505177
FT                   /transl_table=11
FT                   /locus_tag="NMA0527"
FT                   /product="lacto-N-neotetraose biosynthesis glycosyl
FT                   tranferase"
FT                   /note="NMA0527, lgtB2, lacto-N-neotetraose biosynthesis
FT                   glycosyl tranferase, len: 268 aa; highly similar to
FT                   SW:LGTB_NEIME (EMBL:U25839), lgtB, Neisseria meningitidis
FT                   MC58 lacto-N-neotetraose biosynthesis glycosyl tranferase
FT                   (275 aa), fasta scores; E(): 0, 72.9% identity in 280 aa
FT                   overlap. Highly similar to NMA0525, fasta scores; E():
FT                   0,75.7% identity in 280 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0527"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07804"
FT                   /db_xref="InterPro:IPR002654"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RHH4"
FT                   /protein_id="CAM07804.1"
FT                   /translation="MQNHVISLASAAERRAHITDTFGVRGIPFQFFDALMPSERLEQAM
FT                   AELVPGLSAHPYLSGVEKACFMSHAVLWKQALDEGLPYIAVFEDDVLLGEGAEKFLAED
FT                   AWLQERFDPDSAFIVRLETMFMHVLTSPSGVADYCGRAFPLLESEHWGTAGYIISRKAM
FT                   RFFLDRFAVLPSERLKAVDWMLFSSFLDKGGMTVCQLTPALCVQSETLPSQLKNGRQES
FT                   YRNRRSPKVLLKRALGKIGREIERARERKRQKKLEKHLGRHVVPFE"
FT   CDS_pept        complement(507126..507851)
FT                   /transl_table=11
FT                   /locus_tag="NMA0528"
FT                   /product="hypothetical protein NMA0528"
FT                   /note="NMA0528, len: 241 aa; unknown, similar to many
FT                   bacterial hypothetical proteins e.g. SW:YGGJ_ECOLI
FT                   (EMBL:U28377), yggJ, Escherichia coli hypothetical protein
FT                   (243 aa), fasta scores; E(): 0, 40.2% identity in 241 aa
FT                   overlap"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0528"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07805"
FT                   /db_xref="GOA:A0A0U1RHH5"
FT                   /db_xref="InterPro:IPR006700"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RHH5"
FT                   /protein_id="CAM07805.1"
FT                   /translation="MPRFYLPENLSVGQTVALPDNIVRHLNVLRVRPNENITLFDGKGK
FT                   AHAAQLTVLEKRRAEAEILHEDTTDNESPLNITLIQSISSGDRMDFTLQKSVELGVTAI
FT                   QPVISERCIVRLDGERAAKRLARWQEIVISACEQSGRNTVPPVLPIIGYREALDKMPSE
FT                   STKLIMSINRARKLGDIRHPSGAIVFMVGPEGGWTEQEEQQAFDAGFQTVTLGKRILRT
FT                   ETVALAALAAMQTLWGDFA"
FT   CDS_pept        508060..508854
FT                   /transl_table=11
FT                   /locus_tag="NMA0529"
FT                   /product="hypothetical protein NMA0529"
FT                   /note="NMA0529, len: 264 aa; unknown, similar to
FT                   SW:SUHB_ECOLI (EMBL:M34828), suhB, Escherichia coli protein
FT                   which affects sigma 32 synthesis (267 aa), fasta scores;
FT                   E(): 4e-18, 34.8% identity in 184 aa overlap and to
FT                   putative homologues from other bacteria. Also similar to
FT                   eukaryotic myo-inositol-1(or 4)-monophosphatases e.g.
FT                   SW:MYOP_RAT (EMBL:U84038), impA1, Rattus norvegicus
FT                   myo-inositol-1(or 4)-monophosphatase (277 aa), fasta
FT                   scores; E(): 4.2e-17, 34.8% identity in 204 aa overlap.
FT                   Also similar to NMA1559, fasta scores; E(): 5e-19, 35.2%
FT                   identity in 179 aa overlap. Contains Pfam match to entry
FT                   PF00459 inositol_P, Inositol monophosphatase family and
FT                   PS00629 Inositol monophosphatase family signature 1"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0529"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07806"
FT                   /db_xref="GOA:A0A0U1RHH6"
FT                   /db_xref="InterPro:IPR000760"
FT                   /db_xref="InterPro:IPR020583"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RHH6"
FT                   /protein_id="CAM07806.1"
FT                   /translation="MLHRLQKVVRHIAQTEIMPRFLNTPSHRKEDGSMLSEADIAAQTA
FT                   FAAALPLLIDCPMLGEEMSRQEQSALWEQYSGEKGLWIVDPIDGTNNFVNGLPHFAVSV
FT                   AFVRNGRAELGVIYNPVSGECFYAERGQGAFLNGTRLPLRLVDKKLNEAIAGVEIKYLR
FT                   SGKLSSRMSTLAPFGTIRSMGSSTLDWCYLACGRYDVYVHGGQKLWDYAAGALIFEEAG
FT                   GRLTTLEGDGFWSGEHVFKRSVVAALEPKLFERWVGWIRENQ"
FT   CDS_pept        complement(509074..509403)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="NMA0530"
FT                   /product="hypothetical protein NMA0530 (pseudogene)"
FT                   /note="NMA0530, possible pseudogene, len: 588 bp; similar
FT                   to bacterial hypothetical proteins e.g. SW:YCHJ_HAEIN
FT                   (EMBL:U32714), HI0277, Haemophilus influenzae hypothetical
FT                   protein (161 aa), fasta scores; E(): 9.1e-20, 50.9%
FT                   identity in 106 aa overlap. Continues from
FT                   NMA0530A,interrupted by Correia element"
FT   CDS_pept        complement(509817..510664)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="NMA0531"
FT                   /product="putative transposase (pseudogene)"
FT                   /note="NMA0531, pseudogene, probable transposase
FT                   remnant,len: 848 bp; similar to TR:CAB44967 (EMBL:AJ242841)
FT                   Neisseria meningitidis putative transposase for insertion
FT                   sequence element IS1106A3 (335 aa), fasta scores; E():
FT                   0,95.6% identity in 180 aa overlap (frame 4), E():
FT                   1.3e-31,96.3% identity in 80 aa overlap (frame 4), E():
FT                   1.2e-07,100.0% identity in 21 aa overlap (frame 6)"
FT   CDS_pept        join(511314..511805,511842..512104)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="NMA0532"
FT                   /product="hypothetical protein NMA0532"
FT                   /product="putative transposase (pseudogene)"
FT                   /note="NMA0532, len: 163 aa; unknown, similar to
FT                   SW:YAFM_ECOLI (EMBL:D38582), yafM, Escherichia coli
FT                   hypothetical protein (165 aa), fasta scores; E(): 0, 50.3%
FT                   identity in 161 aa overlap and SW:YAFM_HAEIN (EMBL:U32706),
FT                   HI0217, Haemophilus influenzae hypothetical protein (176
FT                   aa), fasta scores; E(): 1.6e-16, 42.5% identity in 174 aa
FT                   overlap. Highly similar to NMA1675,fasta scores; E(): 0,
FT                   99.3% identity in 138 aa overlap and similar to NMA1155,
FT                   fasta scores; E(): 2.8e-07, 42.7% identity in 103 aa
FT                   overlap"
FT                   /note="NMA0532a, pseudogene, probable transposase
FT                   remnant,len: 263 aa; almost identical to part of
FT                   SW:TRA6_NEIME (EMBL:Z11857) Neisseria meningitidis
FT                   transposase for insertion sequence element IS1106 (ORF 1)
FT                   (288 aa), fasta scores; E(): 4.1e-25, 96.7% identity in 61
FT                   aa overlap (frame 3) and E(): 9.4e-11, 100.0% identity in
FT                   27 aa overlap (frame 2)"
FT   CDS_pept        complement(512369..513115)
FT                   /transl_table=11
FT                   /locus_tag="NMA0533"
FT                   /product="putative 3-oxoacyl-[acyl-carrier protein]
FT                   reductase"
FT                   /EC_number="1.1.1.100"
FT                   /note="NMA0533, fabG, probable 3-oxoacyl-[acyl-carrier
FT                   protein] reductase, len: 248 aa; similar to many e.g.
FT                   SW:FABG_ECOLI (EMBL:M84991), fabG, Escherichia coli
FT                   3-oxoacyl-[acyl-carrier protein] reductase (EC 1.1.1.100)
FT                   (244 aa), fasta scores; E(): 0, 70.0% identity in 243 aa
FT                   overlap. Contains Pfam matches to entry PF00106
FT                   adh_short,short chain dehydrogenase and to entry PF00678
FT                   adh_short_C2, Short chain dehydrogenase/reductase
FT                   C-terminus. Contains PS00061 Short-chain
FT                   dehydrogenases/reductases family signature"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0533"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07810"
FT                   /db_xref="GOA:A0A0U1RHH7"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR011284"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RHH7"
FT                   /protein_id="CAM07810.1"
FT                   /translation="MSTQDLSGKIALVTGASRGIGAAIADTLAAAGAKVIGTATSESGA
FT                   AAISERLAQWGGEGRALDSAEPETIESLIADIEKAFGKLDILVNNAGITRDNLLMRMKE
FT                   EEWDDIMQVNLKSVFRASKAVLRGMMKQRSGRIINITSVVGVMGNAGQTNYAAAKAGLI
FT                   GFAKSMAREVGSRGITVNCVAPGFIDTDMTRALPEETRQAFTAQTALGRFGDAQDIADA
FT                   VLFLASDQAKYITGQTLHVNGGMLMP"
FT   CDS_pept        complement(513177..514742)
FT                   /transl_table=11
FT                   /locus_tag="NMA0534"
FT                   /product="putative GMP synthetase"
FT                   /EC_number="6.3.5.2"
FT                   /note="NMA0534, guaA, probable GMP synthetase, len: 521 aa;
FT                   similar to many e.g.SW:GUAA_ECOLI (EMBL:M10101),
FT                   guaA,Escherichia coli GMP synthase [glutamine-hydrolyzing]
FT                   (EC 6.3.5.2) (525 aa), fasta scores; E(): 0, 65.5% identity
FT                   in 525 aa overlap. Contains Pfam matches to entry PF00117
FT                   GATase, Glutamine amidotransferase class-I and to entry
FT                   PF00958 GMP_synt_C, GMP synthase, C-terminal domain.
FT                   Contains PS00442 Glutamine amidotransferases class-I active
FT                   site"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0534"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07811"
FT                   /db_xref="GOA:Q9JW60"
FT                   /db_xref="InterPro:IPR001674"
FT                   /db_xref="InterPro:IPR004739"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR022310"
FT                   /db_xref="InterPro:IPR022955"
FT                   /db_xref="InterPro:IPR025777"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9JW60"
FT                   /protein_id="CAM07811.1"
FT                   /translation="MTQDKILILDFGSQVTQLIARRVREAHVYCELHSFDMPLDEIKAF
FT                   NPKGIILSGGPNSVYESDYQADTGIFDLGIPILGICYGMQFMAHHLGGEVQPGNQREFG
FT                   YAQVKTIDSELTRGIQDDTPNTLDVWMSHGDKVSKLPTGFTVIGDTPSCPIAMMENAEK
FT                   QFYGIQFHPEVTHTKQGRALLNRFVLDICGAQPGWTMPNYIEEAVAKIREQVGSDEVIL
FT                   GLSGGVDSSVAAALIHRAIGDQLTCVFVDHGLLRLNEGKMVMDMFARNLGVKVIHVDAE
FT                   GQFMAKLAGVTDPEKKRKIIGAEFIEVFDAEEKKLTNAKWLAQGTIYPDVIESAGAKTK
FT                   KAHAIKSHHNVGGLPENMKLKLLEPLRDLFKDEVRELGVALGLPREMVYRHPFPGPGLG
FT                   VRILGEVKKEYADLLRQADDIFIQELRNTTDENGTSWYDLTSQAFAVFLPVKSVGVMGD
FT                   GRTYDYVVALRAVITSDFMTAHWAELPYSLLGRVSNRIINEVKGINRVVYDVSGKPPAT
FT                   IEWE"
FT   CDS_pept        complement(514842..516707)
FT                   /transl_table=11
FT                   /locus_tag="NMA0535"
FT                   /product="putative ABC transporter ATP-binding protein"
FT                   /note="NMA0535, probable ABC transporter ATP-binding
FT                   protein, len: 621 aa; similar to many e.g. SW:MSBA_ECOLI
FT                   (EMBL:Z11796), msbA, Escherichia coli essential ABC
FT                   transporter involved in lipid A and phospholipid
FT                   biosynthesis (582 aa), fasta scores; E(): 0, 35.2% identity
FT                   in 597 aa overlap. Contains Pfam matches to entry PF00664
FT                   ABC_membrane, ABC transporter transmembrane region and to
FT                   entry PF00005 ABC_tran, ABC transporter, PS00211 ABC
FT                   transporters family signature and PS00017 ATP/GTP-binding
FT                   site motif A (P-loop). Contains hydrophobic, probable
FT                   membrane-spanning regions"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0535"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07812"
FT                   /db_xref="GOA:Q9JW59"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR011917"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9JW59"
FT                   /protein_id="CAM07812.1"
FT                   /translation="MIEKLTFGLFKKEDARSFMRLMAYVRPYKIRIVAALIAIFGVAAT
FT                   ESYLAAFIAPLINHGFSAPAAPPELSAAAGILSTLQNWREQFTYMVWGTENKIWTVPLF
FT                   LIILVVIRGICRFTSTYLMTWVSVMTISKIRKDMFAKMLTLSSRYHQETPSGTVLMNML
FT                   NLTEQSVSNASDIFTVLTRDTMIVTGLTIVLLYLNWQLSLIVVLMFPLLSLLSRYYRDR
FT                   LKHVISDSQKSIGTMNNVIAETHQGHRVVKLFNGQAQAANRFDAINRTIVRLSKKITQA
FT                   TAAHSPFSELIASIALAVVIFIALWQSQNGYTTIGEFMAFIVAMLQMYAPIKSLANISI
FT                   PMQTMFLAADGVCAFLDTPPEQDKGTLAPQRVEGRISFRNVDVEYRSDGIKALDGFNLD
FT                   IRQGERVALVGRSGSGKSTVVNLLPRFVEPSAGNICIDGIDIADIKLDCLRAQFALVSQ
FT                   DVFLFDDTLFENVRYSRPDAGEAEVLSALQAANLQSLIDASPLGLHQPIGSNGSNLSGG
FT                   QRQRVAIARAILKDAPILLLDEATSALDNESERLVQQALERLMENRTGIIVAHRLTTIE
FT                   GADRIIVMDDGKIIEQGTHEQLMSQNGYYTMLRNISNKDAAVRTA"
FT   CDS_pept        complement(516845..517771)
FT                   /transl_table=11
FT                   /locus_tag="NMA0536"
FT                   /product="putative malonyl CoA-acyl carrier protein
FT                   transacylase"
FT                   /EC_number="2.3.1.39"
FT                   /note="NMA0536, fabD, probable malonyl CoA-acyl carrier
FT                   protein transacylase, len: 308 aa; similar to many e.g.
FT                   SW:FABD_ECOLI (EMBL:M87040), fabD, Escherichia coli malonyl
FT                   CoA-acyl carrier protein transacylase (EC 2.3.1.39) (308
FT                   aa), fasta scores; E(): 0, 57.0% identity in 305 aa
FT                   overlap. Contains Pfam match to entry PF00698 Acyl_transf,
FT                   Acyl transferase domain"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0536"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07813"
FT                   /db_xref="GOA:A0A0U1RHH8"
FT                   /db_xref="InterPro:IPR001227"
FT                   /db_xref="InterPro:IPR004410"
FT                   /db_xref="InterPro:IPR014043"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="InterPro:IPR016036"
FT                   /db_xref="InterPro:IPR020801"
FT                   /db_xref="InterPro:IPR024925"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RHH8"
FT                   /protein_id="CAM07813.1"
FT                   /translation="MSFAFFFPGQGSQSLGMMNGFAEHAIVKNTFAEASAILGQDLWAM
FT                   INGSDAEIIGQTVNTQPIMLAAGVAVYRAYSEAGGKTPAAVAGHSLGEYTALVAAGALD
FT                   FADAVKLVRLRAELMQSAVPQGVGAMAAILGLEDEQVKQICAESAQDEVVEAVNFNSPG
FT                   QVVIAGNAAAVERAMLAAKEAGAKRALPLPVSVPSHCSLMKPAADKLAEALKTVEIKQP
FT                   QIRVIHNADVAAYDDADKIKDALVRQLYSPVRWTETVNALVSDGIAESAECGPGKVLAG
FT                   LAKRINKAAACSALTDAGQVAAFIEAH"
FT   CDS_pept        complement(517957..518322)
FT                   /transl_table=11
FT                   /locus_tag="NMA0537"
FT                   /product="putative integral membrane protein"
FT                   /note="NMA0537, possible integral membrane protein, len:
FT                   121 aa; unknown, in part similar to TR:P94519
FT                   (EMBL:Z75208), ysdA, Bacillus subtilis hypothetical protein
FT                   (89 aa), fasta scores; E(): 3.1e-05, 39.3% identity in 84
FT                   aa overlap. Contains hydrophobic, possible
FT                   membrane-spanning regions"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0537"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07814"
FT                   /db_xref="GOA:A0A0U1RHH9"
FT                   /db_xref="InterPro:IPR010718"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RHH9"
FT                   /protein_id="CAM07814.1"
FT                   /translation="MKRQAFFKLMACAAFLSAVSLRLPVLGACYAILSLYAFALYGIDK
FT                   RRAVRGKRRIPEHRLLLPALFGGWAGAYLGSRIFRHKTAKKRFVVLFRLTVSGNVLATL
FT                   ILIYSGLNLNQYGVASP"
FT   CDS_pept        complement(518369..519331)
FT                   /transl_table=11
FT                   /locus_tag="NMA0538"
FT                   /product="putative 3-oxoacyl-[acyl-carrier-protein]
FT                   synthase III"
FT                   /EC_number="2.3.1.41"
FT                   /note="NMA0538, fabH, probable
FT                   3-oxoacyl-[acyl-carrier-protein] synthase III, len: 320 aa;
FT                   similar to many e.g. SW:FABH_ECOLI (EMBL:M77744),fabH,
FT                   Escherichia coli 3-oxoacyl-[acyl-carrier-protein] synthase
FT                   III (EC 2.3.1.41) (317 aa), fasta scores; E(): 0,53.1%
FT                   identity in 318 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0538"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07815"
FT                   /db_xref="GOA:Q9JW56"
FT                   /db_xref="InterPro:IPR004655"
FT                   /db_xref="InterPro:IPR013747"
FT                   /db_xref="InterPro:IPR013751"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9JW56"
FT                   /protein_id="CAM07815.1"
FT                   /translation="MQYAKISGTGSYLPANRVSNDDLAQKVDTSDEWITARTGIKFRHI
FT                   AAENEKTSDLAAEAARRALDAAGLNGNEIDLIIVATATPDMQFPSTATIVQQKLGITNG
FT                   CPAFDVQAVCAGFMYALTTANAYIKSGMAKNALVIGAETFSRIVDWNDRTTCVLFGDGA
FT                   GAVVLSASDTPGIIHSKLKADGNYLKLLNVPGQIACGKVSGSPYISMDGPGVFKFAVKM
FT                   LSKIADDVIEEAGYTAAQIDWIVPHQANRRIIESTAKHLGLSMDKVVLTVQDHGNTSAA
FT                   SIPLALDTGIRSGQIKRGQNLLLEGIGGGFAWGAVLLQY"
FT   CDS_pept        complement(519581..520006)
FT                   /transl_table=11
FT                   /locus_tag="NMA0540"
FT                   /product="hypothetical protein NMA0540"
FT                   /note="NMA0540, len: 141 aa; unknown, lies within a region
FT                   of unusually low GC content"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0540"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07816"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RHI0"
FT                   /protein_id="CAM07816.1"
FT                   /translation="MIRMKTSTVVFGGFFMADNGERIQIPVLENPDIREINHFFSVSNF
FT                   EKKAGVLVFRIIPEPEFGHTELTVYFEKGYYLPMIQTILEGGDIEVKNLKTENYSGKAR
FT                   EILGDSYPIEHTSKNISTIQNIISEFMIQKQTPAPII"
FT   CDS_pept        complement(520024..520275)
FT                   /transl_table=11
FT                   /locus_tag="NMA0541"
FT                   /product="hypothetical protein NMA0541"
FT                   /note="NMA0541, len: 83 aa, unknown, lies within a region
FT                   of unusually low GC content"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0541"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07817"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RHI1"
FT                   /protein_id="CAM07817.1"
FT                   /translation="MKTLEKRMKALDKRIMKFGKSLEGRLDARLIESALDYIHYSERFL
FT                   AFEILCTYIEDFDVRLTEQESREISFINKEFEIESTSD"
FT   CDS_pept        complement(520411..521466)
FT                   /transl_table=11
FT                   /locus_tag="NMA0542"
FT                   /product="putative fatty acid/phospholipid biosynthesis
FT                   protein"
FT                   /note="NMA0542, plsX, possible fatty acid/phospholipid
FT                   biosynthesis protein, len: 351 aa; similar to many e.g.
FT                   SW:PLSX_ECOLI (EMBL:M96793), plsX, Escherichia coli protein
FT                   of undefined function shown to be involved in fatty
FT                   acid/phospholipid biosynthesis (346 aa), fasta scores; E():
FT                   0, 38.9% identity in 337 aa overlap. An alternative start
FT                   codon is present at codon 9. Homologues of this protein
FT                   have been predicted to use one or the other"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0542"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07818"
FT                   /db_xref="GOA:Q9JW54"
FT                   /db_xref="InterPro:IPR003664"
FT                   /db_xref="InterPro:IPR012281"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9JW54"
FT                   /protein_id="CAM07818.1"
FT                   /translation="MITLAVDAMGGDQGLAVTVPGATAFLQAHPDVHLIMTGDETQLRQ
FT                   ALTAAGAPMERIDICHTAQIVGMDEAPQSALKNKKDSSMRVAVNQVKEGKAQAAVSAGN
FT                   TGALMATARFVLKTIPGIERPAIAKFLPSDTDHVTLALDLGANVDCTPEQLAQFAVIGS
FT                   ELVHALHPQKGQPRVGLVNVGTEDIKGTDTVKQTYKLLQNSKLNFIGNIESNSILYGEA
FT                   DVVVADGFVGNVMLKTIEGAVKFMSGAIRREFQSNLFNKLAAVAALPALKGLKNKLDPR
FT                   KFNGAILLGLRGIVIKSHGGTDETGFRYALEEAYHEAKSASLSKIEQGVAEQLAALETA
FT                   KAVQNENVGGL"
FT   CDS_pept        complement(521554..522081)
FT                   /transl_table=11
FT                   /locus_tag="NMA0543"
FT                   /product="hypothetical protein NMA0543"
FT                   /note="NMA0543, len: 175 aa; shows very weak similarity to
FT                   TR:P74916 (EMBL:D37928), gpt, Thermus aquaticus purine
FT                   phosphoribosyltransferase (154 aa), fasta scores; E():
FT                   8.7e-05, 27.8% identity in 158 aa overlap and to
FT                   hypothetical proteins e.g. TR:CAB49024 (EMBL:AJ248283)
FT                   purine phosphoribosyltransferase related protein (153
FT                   aa),fasta scores; E(): 2.5e-09, 30.1% identity in 163 aa
FT                   overlap"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0543"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07819"
FT                   /db_xref="GOA:A0A0U1RHI2"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RHI2"
FT                   /protein_id="CAM07819.1"
FT                   /translation="MKQKIWYTYDDIHRVIKALAEKIRNADIKYDAMIAIGGGGFIPAR
FT                   MLRCFLEIPIYAVTTAYYDSDNEGQVTEEVKKVQWLDPVPEALRGKNVLVVDEVDDSRV
FT                   TMEFCLTELLKEDFGTIGVAVLHEKIKAKAGKIPEGIPYFSGITVEDWWINYPWDALDI
FT                   DEHNRLAESSRG"
FT   CDS_pept        complement(522409..522588)
FT                   /transl_table=11
FT                   /locus_tag="NMA0544"
FT                   /product="50S ribosomal protein L32"
FT                   /note="NMA0544, rpmF, 50S ribosomal protein L32, len: 59
FT                   aa; highly similar to many e.g. SW:RL32_ECOLI
FT                   (EMBL:M29698), rpmF, Escherichia coli 50S ribosomal protein
FT                   L32 (56 aa), fasta scores; E(): 6e-12, 68.5% identity in 54
FT                   aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0544"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07820"
FT                   /db_xref="GOA:Q9JW52"
FT                   /db_xref="InterPro:IPR002677"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9JW52"
FT                   /protein_id="CAM07820.1"
FT                   /translation="MAVQQNKKSPSKRGMHRSHDALTAPALSVDSTTGEVHRPHHISPN
FT                   GMYRGRKVVKVKGE"
FT   CDS_pept        complement(522622..523125)
FT                   /transl_table=11
FT                   /locus_tag="NMA0545"
FT                   /product="hypothetical protein NMA0545"
FT                   /note="NMA0545, len: 167 aa; unknown, shows weak similarity
FT                   to SW:YCED_ECOLI (EMBL:M29698), yceD,Escherichia coli
FT                   hypothetical protein (17=3 aa), fasta scores; E(): 1.3e-07,
FT                   32.0% identity in 172 aa overlap and SW:YCED_HAEIN
FT                   (EMBL:U20229), HI0159, Haemophilus influenzae hypothetical
FT                   protein (174 aa), fasta scores; E(): 4.5e-06,30.6% identity
FT                   in 173 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0545"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07821"
FT                   /db_xref="InterPro:IPR003772"
FT                   /db_xref="InterPro:IPR039255"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RHI3"
FT                   /protein_id="CAM07821.1"
FT                   /translation="MSDPNLIDPEIFAAEGQNLQGSFLLEELDERVSSHDYPADRQTKI
FT                   SFTLTGGRDRLQHLFLDLNVKADMPLICQRCIKPMPFMLDESSRIVLFSNEESLDESML
FT                   ADEELEGILIEKELDVRTLVEDQILMSLPFSPRHEDCGDNGTLEEVNRDKPNPFAVLAG
FT                   LKSN"
FT   CDS_pept        523273..523863
FT                   /transl_table=11
FT                   /locus_tag="NMA0546"
FT                   /product="hypothetical protein NMA0546"
FT                   /note="NMA0546, len: 196 aa; unknown, similar to many e.g.
FT                   SW:MAF_BACSU (EMBL:L08793), maf, Bacillus subtilis maf
FT                   protein (189 aa), fasta scores; E(): 1.1e-10, 29.6%
FT                   identity in 186 aa overlap and TR:BAA35895
FT                   (EMBL:D90744),yceF, Escherichia coli hypothetical protein
FT                   (207 aa),fasta scores; E(): 8.8e-28, 41.6% identity in 197
FT                   aa overlap. Also similar to NM802, fasta scores; E():
FT                   1.1e-08, 27.3% identity in 194 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0546"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07822"
FT                   /db_xref="GOA:Q9JW50"
FT                   /db_xref="InterPro:IPR003697"
FT                   /db_xref="InterPro:IPR029001"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9JW50"
FT                   /protein_id="CAM07822.1"
FT                   /translation="MGLELPLILGTSSVFRREQMERLGIAFQAASPDFDETPMLGESAP
FT                   QTALRLAEGKARSLAGRFPEALIVGADQVAWCDGRQWGKPMNLANAQKMLMHLSGREIE
FT                   FYSAVVLLNTVTGRMQRHIDKTVVVMRKLDELHILRYLEREPDAVYCSCALKSEALGAL
FT                   LIERIESTDPNALIGLPVFRLVDFLKNEGVDVL"
FT   CDS_pept        523910..524635
FT                   /transl_table=11
FT                   /locus_tag="NMA0547"
FT                   /product="hypothetical protein NMA0547"
FT                   /note="NMA0547, len: 241 aa; unknown, similar to many
FT                   hypothetical proteins e.g. SW:YRAL_ECOLI
FT                   (EMBL:U18997),yraL, Escherichia coli hypothetical protein
FT                   (286 aa),fasta scores; E(): 5.6e-14, 31.1% identity in 235
FT                   aa overlap. Also similar to NMA0342, fasta scores; E():
FT                   1.6e-14, 30.4% identity in 217 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0547"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07823"
FT                   /db_xref="GOA:A0A0U1RHI4"
FT                   /db_xref="InterPro:IPR008189"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RHI4"
FT                   /protein_id="CAM07823.1"
FT                   /translation="MSEGMMSPVLYLIPTPLGTPDTPCLLPHEQQAIVGLTDFVVEAEK
FT                   TARAHLKHLGVTMPIRELNLQTLNEHTDLKTLLELLKPLQEGRSMGIVSEAGCPAVADP
FT                   GANLVALAHKHGFEVRPLVGPSSLLLALMASGANGQSFAFKGYLPSEKNERIQSLKALE
FT                   QRSRQQNETQLFIETPYRNDVLLADAVENLHSETRLCTATDLTLPTQEIISQTVVQWRK
FT                   RKEMPNLKKRPTIFVMYAG"
FT   CDS_pept        complement(524716..526353)
FT                   /transl_table=11
FT                   /locus_tag="NMA0548"
FT                   /product="putative integral membrane protein"
FT                   /note="NMA0548, probable integral membrane protein, len:
FT                   545 aa; similar to many e.g. SW:60IM_PSEPU (EMBL:X62540)
FT                   Pseudomonas putida 60 kD inner-membrane protein (560
FT                   aa),fasta scores; E(): 0, 42.1% identity in 573 aa overlap.
FT                   The C-terminal half is similar to SW:SP3J_BACSU
FT                   (EMBL:Z14225), spoIIIJ, Bacillus subtilis stage III
FT                   sporulation protein J precursor (259 aa), fasta scores;
FT                   E(): 4.8e-22, 37.3% identity in 217 aa overlap. Contains a
FT                   possible N-terminal signal sequence and
FT                   hydrophobic,probable membrane-spanning regions"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0548"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07824"
FT                   /db_xref="GOA:Q9JW48"
FT                   /db_xref="InterPro:IPR001708"
FT                   /db_xref="InterPro:IPR019998"
FT                   /db_xref="InterPro:IPR028053"
FT                   /db_xref="InterPro:IPR028055"
FT                   /db_xref="InterPro:IPR038210"
FT                   /db_xref="InterPro:IPR038221"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9JW48"
FT                   /protein_id="CAM07824.1"
FT                   /translation="MDFKRLTAFFAIALVIMIGWEKMFPTPKPVPAPQQTAQQQAVTAS
FT                   AEAALAPATPITVTTDTVQAVIDEKSGDLRRLTLLKYKATGDENKPFILFGDGKEYTYV
FT                   AQSELLDAQGNNILKGIGFSAPKKQYSLEGDKVEVRLSAPETRGLKIDKVYTFTKGSYL
FT                   VNVRFDIANGSGQTANLSADYRIVRDHSEPEGQGYFTHSYVGPVVYTPEGNFQKVSFSD
FT                   LDDDAKSGKSEAEYIRKTPTGWLGMIEHHFMSTWILQPKGGQSVCAAGDCRIDIKRRND
FT                   KLYSTSVSVPLAAIQNGAKSEASINLYAGPQTTSVIANIADNLQLAKDYGKVHWFASPL
FT                   FWLLNQLHNIIGNWGWAIIVLTIIVKAVLYPLTNASYRSMAKMRAAAPKLQAIKEKYGD
FT                   DRMAQQQAMMQLYTDEKINPLGGCLPMLLQIPVFIGLYWALFASVELRQAPWLGWITDL
FT                   SRADPYYILPIIMAATMFAQTYLNPPPTDPMQAKMMKIMPLVFSVMFFFFPAGLVLYWV
FT                   INNLLTIAQQWHINRSIEKQRAQGEVVS"
FT   CDS_pept        complement(526525..526815)
FT                   /transl_table=11
FT                   /locus_tag="NMA0549"
FT                   /product="hypothetical protein NMA0549"
FT                   /note="NMA0549, len: 96 aa; unknown, similar to
FT                   hypothetical proteins found downstream of rnpA and
FT                   elsewhere in many bacteria e.g. SW:YIDD_ECOLI
FT                   (EMBL:M11056), yidD, Escherichia coli hypothetical protein
FT                   (85 aa), fasta scores; E(): 3.1e-14, 52.9% identity in 68
FT                   aa overlap. Also similar to TR:Q44066 (EMBL:L36462),
FT                   hlyA,Aeromonas hydrophila putative haemolysin (85 aa),
FT                   fasta scores; E(): 3.1e-14, 52.9% identity in 68 aa
FT                   overlap. GC frameplot suggests a start codon overlapping
FT                   the stop codon of rnpA. However, similarity to other
FT                   sequences suggests a start codon at codon 24 or 28. The
FT                   true position is therefore uncertain"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0549"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07825"
FT                   /db_xref="GOA:P67302"
FT                   /db_xref="InterPro:IPR002696"
FT                   /db_xref="UniProtKB/Swiss-Prot:P67302"
FT                   /protein_id="CAM07825.1"
FT                   /translation="MIRTVLCRQGSDGNGFPILRNIPMNFLLSKLLLGLIRFYQYCISP
FT                   LIPPRCRYTPTCSQYAVEAVKKYGAFKGGRLAIKRIARCHPFGGHGHDPVP"
FT   CDS_pept        complement(526812..527177)
FT                   /transl_table=11
FT                   /locus_tag="NMA0550"
FT                   /product="putative ribonuclease P protein component"
FT                   /EC_number="3.1.26.5"
FT                   /note="NMA0550, rnpA, probable ribonuclease P protein
FT                   component, len: 121 aa; similar to many e.g. SW:RNPA_ECOLI
FT                   (EMBL:M11056), rnpA, Escherichia coli ibonuclease P protein
FT                   component (EC 3.1.26.5) (119 aa), fasta scores; E():
FT                   4.4e-09, 42.5% identity in 87 aa overlap. Contains Pfam
FT                   match to entry PF00825 Ribonuclease_P, Ribonuclease P"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0550"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07826"
FT                   /db_xref="GOA:Q9JW46"
FT                   /db_xref="InterPro:IPR000100"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020539"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9JW46"
FT                   /protein_id="CAM07826.1"
FT                   /translation="MDYRFGRQYRLLKTDDFSSVFAFRNRRSRDLLQVSRSNGNGLDHP
FT                   RIGLVVGKKTAKRANERNYMKRVIRDWFRLNKNRLPPQDFVVRVRRKFDRATAKQARAE
FT                   LAQLMFGNPATGCRKQA"
FT   CDS_pept        complement(527180..527314)
FT                   /transl_table=11
FT                   /locus_tag="NMA0551"
FT                   /product="50S ribosomal protein L34"
FT                   /note="NMA0551, rpmH, 50S ribosomal protein L34, len: 44
FT                   aa; highly similar to many e.g. SW:RL34_ECOLI
FT                   (EMBL:J01602), rpmH, Escherichia coli 50S ribosomal protein
FT                   L34 (46 aa), fasta scores; E(): 2.9e-11, 68.2% identity in
FT                   44 aa overlap. Contains Pfam match to entry PF00468
FT                   Ribosomal_L34, Ribosomal protein L34"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0551"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07827"
FT                   /db_xref="GOA:P66250"
FT                   /db_xref="InterPro:IPR000271"
FT                   /db_xref="InterPro:IPR020939"
FT                   /db_xref="UniProtKB/Swiss-Prot:P66250"
FT                   /protein_id="CAM07827.1"
FT                   /translation="MKRTYQPSVTKRKRTHGFLVRSKTRGGRAVLAARRAKGRKRLAV"
FT   CDS_pept        527602..529158
FT                   /transl_table=11
FT                   /locus_tag="NMA0552"
FT                   /product="putative chromosomal replication initiator
FT                   protein"
FT                   /note="NMA0552, dnaA, probable chromosomal replication
FT                   initiator protein, len: 518 aa; similar to many e.g.
FT                   SW:DNAA_VIBHA (EMBL:L47617), dnaA, Vibrio harveyi
FT                   chromosomal replication initiator protein (468 aa), fasta
FT                   scores; E(): 0, 42.5% identity in 510 aa overlap. Appears
FT                   to be longer than many others, having an additional amino
FT                   acids at aa 70-140. Contains Pfam match to entry PF00308
FT                   bac_dnaA, Bacterial dnaA protein and PS00017
FT                   ATP/GTP-binding site motif A (P-loop)"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0552"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07828"
FT                   /db_xref="GOA:Q9JW45"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9JW45"
FT                   /protein_id="CAM07828.1"
FT                   /translation="MTLAEFWPLCLRRLHDMLPHGQFAQWIAPLTVGEEGGVWVVYGKN
FT                   QFACNMLKSQFAGKIEAVREELAAGRSAFVFKPGEGVCYEMAAVEGAVEPAEPSLHAGS
FT                   EEMPVQEVLLDELPSEEPVKPAASKTAADILAERMRNLPHEPRQAAGSASRPESAAVAK
FT                   ARTDAQRDAEEARYEQTNLSPDYTFDTLVEGKGNRLAAAAAQAIAESPGQSYNPFFLYG
FT                   STGLGKTHLVQAVGNELLKNRPDAKVRYMHSDDYIRSFMKAVRNNTYDVFKQQYKQYDL
FT                   LIIDDIQFIKGKDRTMEEFFYLYNHFHNEKKQLILTCDVLPAKIEGMDDRLKSRFSWGL
FT                   TLELEPPELEMRIAILQKKAEAAGISIEDEAALFIANLIRSNVRELEGAFNRVGASSRF
FT                   MNRPVIDIDLARTALQDIIAEKHKVITADIIIDAVAKYYRIKISDVLGKKRTRNIARPR
FT                   QVAMSLTKELTTLSLPSIGDSFGGRDHTTVMHGIRAVAKLREEDPELAQDYEKLLILIQ
FT                   N"
FT   CDS_pept        529238..530341
FT                   /transl_table=11
FT                   /locus_tag="NMA0553"
FT                   /product="putative DNA polymerase III, beta subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="NMA0553, dnaN, probable DNA polymerase III, beta
FT                   subunit, len: 367 aa; similar to many e.g. SW:DP3B_PSEPU
FT                   (EMBL:X14791), dnaN, Pseudomonas putida DNA polymerase III,
FT                   beta subunit (EC 2.7.7.7) (367 aa), fasta scores; E(): 0,
FT                   45.2% identity in 365 aa overlap. Contains Pfam match to
FT                   entry PF00712 DNA_pol3_beta, DNA polymerase III beta
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0553"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07829"
FT                   /db_xref="GOA:A0A0U1RHI5"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RHI5"
FT                   /protein_id="CAM07829.1"
FT                   /translation="MLILQAERDSLLKPLQAVTGIVERRHTLPILSNVLIEGKGGQTKL
FT                   LATDLEIQIDTAGPEGGADDFRITTNAKKFQDILRALPAGALVSLDWDDSRLTLKAGKS
FT                   RFALQTLPAADFPMMNVGEDISATFSLEQERFKTMLSQVQYSMAVQDIRYYLNGLLMQV
FT                   EGSQLRLVATDGHRLAYAACAIDADLPRAEVILPRKTVLELFKLLNNPDDPIQIELLDK
FT                   QVRFQCNGTTIVSKVIDGKFPDFNRVIPLDNDKIFVLSRAELLGALERVSILANEKFRG
FT                   ARLFLQSGLLSVVCSNNEQEEAREEIEIAYQGGELEVGFNIGYLMDVLRNIHSDDMQLA
FT                   FGDANRSTLFTVPNNPNFKYIVMPMRI"
FT   CDS_pept        complement(530526..531119)
FT                   /transl_table=11
FT                   /locus_tag="NMA0554"
FT                   /product="putative transposase for IS1016"
FT                   /note="NMA0554, possible transposase for IS1016, len: 197
FT                   aa; similar to many e.g. TR:Q48234 (EMBL:X59756) ORF from
FT                   Haemophilus influenzae insertion sequence IS1016-V6 (191
FT                   aa), fasta scores; E(): 0, 69.7% identity in 175 aa
FT                   overlap"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0554"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07830"
FT                   /db_xref="InterPro:IPR024445"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RHI6"
FT                   /protein_id="CAM07830.1"
FT                   /translation="MKITHCKLKKKVQKELIRFFVLEVTARSAADILGIHPNSAVLFYR
FT                   KIRTVINHHLALAADEVFEGPVEPDESDFGGRRKGRRGRGAAGKVVVFGILKRNGRVYT
FT                   VVVNNAKSETLLPVIKKKIMPDSIVYTDSLSSGDKLDVSGFIHYRINHSKEFVDRQNHI
FT                   NGIENFWNQAKRVLRKYSGLTKIRTRRRSRRQYK"
FT   CDS_pept        complement(531352..533409)
FT                   /transl_table=11
FT                   /locus_tag="NMA0555"
FT                   /product="polyphosphate kinase"
FT                   /EC_number="2.7.4.1"
FT                   /note="NMA0555, ppk, polyphosphate kinase, len: 685 aa;
FT                   highly similar to many e.g. TR:Q59616 (EMBL:U16262),
FT                   ppk,Neisseria meningitidis BNCV polyphosphate kinase (EC
FT                   2.7.4.1) (685 aa), fasta scores; E(): 0, 99.6% identity in
FT                   685 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0555"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07831"
FT                   /db_xref="GOA:Q9JW42"
FT                   /db_xref="InterPro:IPR003414"
FT                   /db_xref="InterPro:IPR024953"
FT                   /db_xref="InterPro:IPR025198"
FT                   /db_xref="InterPro:IPR025200"
FT                   /db_xref="InterPro:IPR036830"
FT                   /db_xref="InterPro:IPR036832"
FT                   /db_xref="InterPro:IPR041108"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9JW42"
FT                   /protein_id="CAM07831.1"
FT                   /translation="MPEQNRILCRELSLLAFNRRVLAQAEDKNVPLLERLRFLCIVSSN
FT                   LDEFFEVRMAWLKRENKLHPRRRLDNGKMPSETIADVTEAARSLIRHQYDLFNNVLQPE
FT                   LARESIHFYRRRNWTGAQKKWIEDYFDRELLPILTPIGLDPSHPFPRPLNKSLNFAVEL
FT                   DGTDAFGRPSGMAIVQAPRILPRVVPLPSELCGGGHGFVFLSSILHAHVGKLFPGMNVK
FT                   GCHQFRLTRDSDLTVDEEDLQNLRAAIQNELHDREYGDGVRLEVADTCPAYIRDFLLAQ
FT                   FKLTAAELYQVKGPVNLVRLNAVPDLVNRPDLKFPTHTPGRLKALGKTASIFDLVRQSP
FT                   ILLHHPYQSFDPVVEMMREAAADPDVLAVKMTIYRTGTRSELVRALMKAALAGKQVTVV
FT                   VELMARFDEANNVNWAKQLEEAGAHVVYGVFGYKVHAKMALVIRREDGVLKRYAHLGTG
FT                   NYHQGTSRIYTDFGIITADEQITADVNTLFMEITGLGKPGRLNKLYQSPFTLHKMVIDR
FT                   IARETEHAKAGKPARITAKMNSLIEPTVIEALYRASAAGVQIDLIVRGMCTLRPGVKGL
FT                   SENIRVRSIIGRQLEHARVYCFHNNGADDTFISSADWMGRNFFRRIETAAPITAPELKK
FT                   RVIREGLEMALADNTHAWLMQPDGGYIRAAPAEGESEADLQNDLWTLLGG"
FT   CDS_pept        complement(533578..534021)
FT                   /transl_table=11
FT                   /locus_tag="NMA0556"
FT                   /product="putative periplasmic protein"
FT                   /note="NMA0556, possible periplasmic protein, len: 147 aa;
FT                   unknown, contains a probable N-terminal signal sequence"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0556"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07832"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RHI7"
FT                   /protein_id="CAM07832.1"
FT                   /translation="MPFRLFLGILCGLSMVAPVYAQGQPDAVNAYIQKKKVIVNTSKAE
FT                   LCFADDRQCHPVLIGVATPKGTFGLTLNSTDKPRYGGEVIGFKQEGDFLFALHRVWNQI
FT                   PSERRNERIASPSVSDRIMTNGCINVSDAVYEKLRHYFVLEVI"
FT   CDS_pept        complement(534028..534543)
FT                   /transl_table=11
FT                   /locus_tag="NMA0557"
FT                   /product="lipoprotein"
FT                   /note="NMA0557, mlp, lipoprotein, len: 171 aa; highly
FT                   similar to TR:Q51103 (EMBL:U16284), mlp, Neisseria
FT                   meningitidis BNCV lipoprotein not expressed by Neisseria
FT                   gonorrhoeae (171 aa), fasta scores; E(): 0, 97.1% identity
FT                   in 171 aa overlap. Contains a probable N-terminal signal
FT                   sequence and an appropriately positioned PS00013
FT                   Prokaryotic membrane lipoprotein lipid attachment site"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0557"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07833"
FT                   /db_xref="GOA:A0A0U1RHI8"
FT                   /db_xref="InterPro:IPR007450"
FT                   /db_xref="InterPro:IPR037873"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RHI8"
FT                   /protein_id="CAM07833.1"
FT                   /translation="MKIKQIVKPGLAVLAAGVLSACATKSNVKADGTTDNPVFPKPYSV
FT                   TLDNKRGTFPTYDELDQMRPGLTKDDIYKILGRPHYDEGMYGVREWDYLFHFHTPGVGI
FT                   DPENTSGVEDVTTCQYKVIFDKDKFARSFYWNPVFPKDAACPPPAPKAEPQVIIREIVP
FT                   AKPKRIRQ"
FT   CDS_pept        534813..537545
FT                   /transl_table=11
FT                   /locus_tag="NMA0559"
FT                   /product="putative leucyl-tRNA synthetase"
FT                   /EC_number="6.1.1.4"
FT                   /note="NMA0559, leuS, probable leucyl-tRNA synthetase,len:
FT                   910 aa; similar to many e.g. SW:SYL_ECOLI (EMBL:X06331),
FT                   leuS, Escherichia coli leucyl-tRNA synthetase (EC 6.1.1.4)
FT                   (860 aa), fasta scores; E(): 0,55.2% identity in 911 aa
FT                   overlap. Contains Pfam match to entry PF00133 tRNA-synt_1,
FT                   tRNA synthetases class I (I, L,M and V) and PS00178
FT                   Aminoacyl-transfer RNA synthetases class-I signature"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0559"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07834"
FT                   /db_xref="GOA:Q9JW39"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002302"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR015413"
FT                   /db_xref="InterPro:IPR025709"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9JW39"
FT                   /protein_id="CAM07834.1"
FT                   /translation="MQEQYQPAAIEPAAQKKWDDARIFNVSEDASKPKYYCLSMFPYPS
FT                   GKLHMGHVRNYTIGDVLSRFKLLNGFNVMQPMGWDAFGMPAENAAMKNNVAPAAWTYDN
FT                   IEYMKTQLKSLGFAIDWARETATCKPEYYRWEQWLFTKLFEKGIVYRKNGTVNWDPVDQ
FT                   TVLANEQVIDGRGWRSGALIEKREIPMYYFKITDYAEELLNDLDKLEHWPEQVKTMQRN
FT                   WIGKSRGMTVRFAVSDDSKQGLEGDYAKFLQVYTTRPDTLMGATYVAVAAEHPLATAAA
FT                   ADKPELQAFIAECKAGSVAEADMATMEKKGVPTGRYVVNPLNGDKLEVWIANYVLWGYG
FT                   DGAVMAVPAHDERDFEFAAKYSLPKKQVLQRVTIGLSPEQEEAMGFGGGSGCGAGYGDG
FT                   SGSDSRDLPFMPNKWQAWYGVKDDFMVLINSGELDGMNYQTAFDAVAAKLQAIGAGEPK
FT                   TQYRLRDWGISRQRYWGCPIPIVHCEQCGDVPVPADQLPVVLPENVVPDGMGSPLAKMP
FT                   EFYETTCPCCGGAAKRETDTMDTFMESSWYFFRYMSPKFSDGMVDPAAAKYWGAVDQYI
FT                   GGIEHAILHLLYARFFTKLMRDEGLVNVDEPFERLLTQGMVVCETYYRENDKGGKDWIN
FT                   PADVELTFDDKGRPVSAVLKVDGLPVVISGTEKMSKSKNNGVDPQELINAYGADTARLF
FT                   MMFAAPPEQSLEWSDSGVEGAHRFLRRLWRTVYEYLKQGEAVNAFAGSQDGLSKELKDL
FT                   RHKLHSTIAKVSDDYGRRQQFNTAIAAVMELLNQYDKTDTGSEQGRTVAQEVLEAAVRL
FT                   LWPIVPHICETLWSELNGAKLWEAGWPAVDEAALVKSEIEVMVQVNGKLRGKITVAADA
FT                   SKADLEAAALATEGAVKFMEGKPAKKIIVVPGRLVNIVV"
FT   CDS_pept        537775..538566
FT                   /transl_table=11
FT                   /locus_tag="NMA0560"
FT                   /product="putative type II restriction endonuclease"
FT                   /note="NMA0560, drg, probable type II restriction
FT                   endonuclease, len: 263 aa; similar to SW:T2D1_STRPN
FT                   (EMBL:M14340), dpnC, Streptococcus pneumoniae type II
FT                   restriction endonuclease (254 aa), fasta scores; E():
FT                   0,43.4% identity in 256 aa overlap. Highly similar to
FT                   TR:AAD34293 (EMBL:AF091143), drg, Neisseria meningitidis
FT                   BL2 putative endonuclease (254 aa), fasta scores; E():
FT                   0,100.0% identity in 252 aa overlap. Lies within a region
FT                   of unusually low GC content"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0560"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07835"
FT                   /db_xref="GOA:A0A0U1RHI9"
FT                   /db_xref="InterPro:IPR010324"
FT                   /db_xref="InterPro:IPR024064"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR041368"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RHI9"
FT                   /protein_id="CAM07835.1"
FT                   /translation="MNLFFDTKLGKQQNKATHKIRVMSEAWLEKNGYCPCCGSKPMQRF
FT                   ANNKPVADLFCPNCHEQYELKSKNQKTIGNSVPDGAYHTMLERIRSDTNPNFFFLAYKK
FT                   ADYSIRQLVLVPKHFITPDMIIPRNKGIKNRSHHIMCSINLAPLPESGKIFLIDDSRII
FT                   EPETVLKKWQSNLFLRNQNAERKGWLLAVMKCIDQLPEEFTLSQMYEFENKLSIQFPQN
FT                   NHIRDKIRQQLQILRDQNTIEFIGRGLYKKIDKLRPTLKAF"
FT   CDS_pept        538563..538700
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="NMA0561"
FT                   /product="putative DNA adenine methylase (pseudogene)"
FT                   /note="NMA0561, dam', pseudogene, probable DNA adenine
FT                   methylase, len: 138 bp; similar to the C-termini of e.g.
FT                   SW:DMA_ECOLI (EMBL:V00272), dam, Escherichia coli DNA
FT                   adenine methylase (278 aa), fasta scores; E():
FT                   1.4e-07,55.6% identity in 45 aa overlap. Highly similar to
FT                   the C-terminus of TR:AAD34292 (EMBL:AF091142), dam,
FT                   Neisseria meningitidis BF13 putative DNA adenine methylase
FT                   (271 aa),fasta scores; E(): 2.3e-17, 93.5% identity in 46
FT                   aa overlap. Lies within a region of unusually low GC
FT                   content"
FT   CDS_pept        538898..539779
FT                   /transl_table=11
FT                   /locus_tag="NMA0562"
FT                   /product="hypothetical protein NMA0562"
FT                   /note="NMA0562, len: 293 aa; unknown, shows weak
FT                   similarity, except at the N-terminus, to hypothetical
FT                   proteins from bacteria and yeast e.g. SW:YGGG_ECOLI
FT                   (EMBL:M32363), yggG, Escherichia coli hypothetical protein
FT                   (252 aa), fasta scores; E(): 1.3e-07 23.4% identity in 256
FT                   aa overlap. The predicted start codon is uncertain; fasta
FT                   similarities and GC frameplot suggest that the start codon
FT                   would be at approx. codon 17 where a potential signal
FT                   sequence and lipoprotein attachment site would then be
FT                   predicted. As no candidate sites are present, the nearest
FT                   upstream alternative has been used. Lies within a region of
FT                   unusually low GC content"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0562"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07837"
FT                   /db_xref="GOA:A0A0U1RHJ0"
FT                   /db_xref="InterPro:IPR001915"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RHJ0"
FT                   /protein_id="CAM07837.1"
FT                   /translation="MKFNFLRSKPKYEISFLPSFKRILCLSAVISVLGACTVVADVYGQ
FT                   DSATMNAAAAEDYMKTVELNKSAGNVDTTSKTARRVQAVFRRMLPYADAANNTGHKFDW
FT                   KMTVFKNDELNAWAMPGGKMAFYTGIVDKLKLTDGEIAAIMGHEMTHALHEHGKNKVGQ
FT                   KILTNMAAQIGTQIILDKKPDTNPELVGLGMDILGMYGITLPYSRSLEEEADEGGMMLM
FT                   AQAGYHPAAAVRVWEKMNQENDQNGFIYAITSTHPTNNARIENLKRLLPTVMPVYEHSV
FT                   RNKGRVNKNRRR"
FT   CDS_pept        complement(540161..540472)
FT                   /transl_table=11
FT                   /locus_tag="NMA0564"
FT                   /product="putative DNA-binding protein"
FT                   /note="NMA0564, possible DNA-binding protein, len: 103 aa;
FT                   unknown, similar to TR:Q57459 (EMBL:X75356) Coxiella
FT                   burnetii plasmid QpH1 hypothetical protein (114 aa), fasta
FT                   scores; E(): 3.5e-15, 49.0% identity in 96 aa overlap.
FT                   Contains Pfam match to entry PF01381
FT                   HTH_3,Helix-turn-helix. Contains probable helix-turn-helix
FT                   motif at aa 58-79 (Score 1781, +5.25 SD)"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0564"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07838"
FT                   /db_xref="GOA:A0A0U1RHJ1"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RHJ1"
FT                   /protein_id="CAM07838.1"
FT                   /translation="MKYKSEALAAIHEMMEGAYNIGAIDKKTMRGFDKSCLTEIKPLSG
FT                   GDIKAIREKEALSQAAFAIYLNVGKNHVSAWERGVKKPSGAALKLLTIVKNKGIEAIA"
FT   CDS_pept        complement(540469..540837)
FT                   /transl_table=11
FT                   /locus_tag="NMA0565"
FT                   /product="hypothetical protein NMA0565"
FT                   /note="NMA0565, len: 122 aa; unknown, similar to TR:Q45933
FT                   (EMBL:X85964) Coxiella burnetii plasmid QpDV hypothetical
FT                   protein (121 aa), fasta scores; E(): 3.5e-14, 39.2%
FT                   identity in 120 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0565"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07839"
FT                   /db_xref="InterPro:IPR009387"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RHJ2"
FT                   /protein_id="CAM07839.1"
FT                   /translation="MRIFKNQWIVKFAKKHKINDSELLEAVERADNGLIDADLGGGVIK
FT                   QRIARQGQGRSGGYRSLILFKQADRAFFVYAFAKNDRENISDKELDVYRKAAAYYLKYT
FT                   RAELAALKEDGIITEIES"
FT   CDS_pept        complement(541736..542086)
FT                   /transl_table=11
FT                   /locus_tag="NMA0569"
FT                   /product="putative protein-export integral membrane
FT                   protein"
FT                   /note="NMA0569, secG, probable protein-export integral
FT                   membrane protein, len: 116 aa; similar to SW:SECG_ECOLI
FT                   (EMBL:D16463), secG, Escherichia coli protein-export
FT                   membrane protein (110 aa), fasta scores; E(): 2.9e-09,38.6%
FT                   identity in 101 aa overlap. Contains a probable N-terminal
FT                   signal sequence and a hydrophobic, probable
FT                   membrane-spanning region"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0569"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07840"
FT                   /db_xref="GOA:A0A0U1RHJ3"
FT                   /db_xref="InterPro:IPR004692"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RHJ3"
FT                   /protein_id="CAM07840.1"
FT                   /translation="MEAFKTLIWIVNIISALAVIVLVLLQHGKGADAGATFGSGSGSAQ
FT                   GVFGSAGNANFLSRSTAVAATFFFATCMAMVYIHTHTTKHGLDFSNVQQTQQAPKPVSN
FT                   TEPSAPVPQQQK"
FT   CDS_pept        complement(542093..542848)
FT                   /transl_table=11
FT                   /locus_tag="NMA0570"
FT                   /product="putative triosephosphate isomerase"
FT                   /EC_number="5.3.1.1"
FT                   /note="NMA0570, tpi, probable triosephosphate
FT                   isomerase,len: 251 aa; similar to many e.g. SW:TPIS_ECOLI
FT                   (EMBL:X00617), tpi, Escherichia coli triosephosphate
FT                   isomerase (EC 5.3.1.1) (255 aa), fasta scores; E():
FT                   2e-32,41.4% identity in 251 aa overlap. Contains Pfam match
FT                   to entry PF00121 TIM, Triosephosphate isomerase and PS00171
FT                   Triosephosphate isomerase active site"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0570"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07841"
FT                   /db_xref="GOA:Q9JW31"
FT                   /db_xref="InterPro:IPR000652"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR020861"
FT                   /db_xref="InterPro:IPR022896"
FT                   /db_xref="InterPro:IPR035990"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9JW31"
FT                   /protein_id="CAM07841.1"
FT                   /translation="MWDQKWVIGNWKMNGRLQNNNSLMHRFRILPTAERVLIGLAAPTV
FT                   YLLQLHNAMQIVLNNRILTCAQDVSRFPDNGAYTGEVSAEMLADTGTDIVLIGHSERSL
FT                   YFGEKNEIQRRKMENVLNVGLIPLLCVGESLEEREAGKEHEVIAHQLSILQGLDTKNIA
FT                   VAYEPVWAIGTGKVATVEQIADMHAFIYKEILSLCGSDVKIRVLYGGSVKADNAADIFA
FT                   VPYVDGALVGGASLSYDSFTAIISAAQNA"
FT   CDS_pept        543026..543553
FT                   /transl_table=11
FT                   /locus_tag="NMA0571"
FT                   /product="hypothetical protein NMA0571"
FT                   /note="NMA0571, len: 175 aa; unknown, similar to
FT                   hypothetical proteins from bacteria and eukaryotes e.g.
FT                   SW:YKG9_YEAST (EMBL:X75780), YKL069W, Saccharomyces
FT                   cerevisiae hypothetical protein (180 aa), fasta scores;
FT                   E(): 1.3e-20, 37.7% identity in 167 aa overlap and
FT                   SW:YEBR_ECOLI (EMBL:AE000277), yebR, Escherichia coli
FT                   hypothetical protein (183 aa), fasta scores; E():
FT                   1.4e-20,44.0% identity in 150 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0571"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07842"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RHJ4"
FT                   /protein_id="CAM07842.1"
FT                   /translation="MYATIGDVMHALHFSASDKAALYREVLPQIESVVADETDWVANLA
FT                   NTAAVLKEAFGWFWVGFYLVDTRSDELVLAPFQGPLACTRIPFGRGVCGQAWAKGGTVV
FT                   VGDVDAHPDHIACSSLSRSEIVVPLFSDGRCIGVLDADSEYLAQFDETDALYLGELAKI
FT                   LEKRFEASRQAA"
FT   CDS_pept        543655..544311
FT                   /transl_table=11
FT                   /locus_tag="NMA0572"
FT                   /product="putative protein-L-isoaspartate
FT                   O-methyltransferase"
FT                   /EC_number="2.1.1.77"
FT                   /note="NMA0572, probable protein-L-isoaspartate
FT                   O-methyltransferase, len: 218 aa; similar to many e.g.
FT                   SW:PIMT_ECOLI (EMBL:M63493), pcm, Escherichia coli
FT                   protein-L-isoaspartate O-methyltransferase (EC 2.1.1.77)
FT                   (207 aa), fasta scores; E(): 1.5e-17, 38.7% identity in 186
FT                   aa overlap. Contains Pfam match to entry PF01135
FT                   PCMT,Protein-L-isoaspartate(D-aspartate)
FT                   O-methyltransferase (PCMT)"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0572"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07843"
FT                   /db_xref="GOA:A0A0U1RHJ5"
FT                   /db_xref="InterPro:IPR000682"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RHJ5"
FT                   /protein_id="CAM07843.1"
FT                   /translation="MDFEKARFNMVEQQIRPWDVLDFDVLDALAEIPRELFVDEDLQGL
FT                   AYADMALPLANGHKMLEPKVVARLAQGLKLTKNDTVLEIGTGSGYATALLAKLAGKVVS
FT                   DDLDAEQQNRAKAVLDGLGLDNIDYVQNNGLTELSAGAPFDAVYVGGAVNLVPEVLKEQ
FT                   LKDGGRMAVIVGRKPVQRALLITRKGDVFEEKVLFDTLVAHLDDKDTDPFGGFDF"
FT   CDS_pept        544391..544714
FT                   /transl_table=11
FT                   /locus_tag="NMA0573"
FT                   /product="hypothetical protein NMA0573"
FT                   /note="NMA0573, len: 107 aa; unknown, shows weak similarity
FT                   SW:GLPE_ECOLI (EMBL:M96795), glpE, Escherichia coli protein
FT                   of unknown function (108 aa), fasta scores; E(): 4.6e-06,
FT                   31.8% identity in 85 aa overlap and to other hypothetical
FT                   protein of similar length. Also shows weak similarity to
FT                   the C-termini of longer hypothetical proteins e.g.
FT                   TR:O05860 (EMBL:Z95120) Mycobacterium tuberculosis
FT                   hypothetical protein (392 aa), fasta scores; E(): 8.9e-10,
FT                   39.0% identity in 100 aa overlap. Contains Pfam match to
FT                   entry PF00581 Rhodanese, Rhodanese-like domain"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0573"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07844"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RHJ6"
FT                   /protein_id="CAM07844.1"
FT                   /translation="MDIVQLGSAELKAWMDEGRMFCLLDVRTDEEAAICSLPDALHIPM
FT                   NLIPLRQNELPDDVPLVVYCHHGIRSLHTAMYLADAGFENLYNLQGGIDAWAVEVDAEM
FT                   ARY"
FT   CDS_pept        complement(545129..547306)
FT                   /transl_table=11
FT                   /locus_tag="NMA0575"
FT                   /product="putative ferric siderophore receptor protein"
FT                   /note="NMA0575, probable ferric siderophore receptor
FT                   protein, len: 725 aa; similar to many ferric siderophore
FT                   receptors e.g. TR:AAD26430 (EMBL:AF135154), fauA,Bordetella
FT                   pertussis FERRIC alcaligin siderophore receptor (734 aa),
FT                   fasta scores; E(): 0, 33.1% identity in 721 aa overlap.
FT                   Contains Pfam match to entry PF00593 TonB_boxC,TonB
FT                   dependent receptor C-terminal region. Contains a probable
FT                   N-terminal signal sequence"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0575"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07845"
FT                   /db_xref="GOA:A0A0U1RHJ7"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR010105"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039423"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RHJ7"
FT                   /protein_id="CAM07845.1"
FT                   /translation="MTRFKYSLLFAALLPVYAQADVSVSDDPKPQESTELPTITVTADR
FT                   TASSNDGYTVSGTHTPLGLPMTLREIPQSVSVITSQQMRDQNIKALDRALLQATGTSRQ
FT                   IYGSDRAGYNYLFARGSRIANYQINGIPVADALADTGNANTAAYERVEVVRGVAGLLDG
FT                   TGEPSATVNLVRKRPTRKPLFEVRAEAGNRKHFGLGADVSGSLNAEGTLRGRLVSTFGR
FT                   GDSWRQRERSRDAELYGILEYDIAPQTRVHAGMDYQQAKETADAPLSYAVYDSQGYATA
FT                   FGPKDNPATNWANSRHRALNLFAGIEHRFNQDWKLKAEYDYTRSRFRQPYGVAGVLSID
FT                   HNTAATDLIPGYWHADPRTHSASVSLIGKYRLFGREHDLIAGINGYKYASNKYGERSII
FT                   PNAIPNAYEFSRTGAYPQPASFAQTIPQYGTRRQIGGYLATRFRAADNLSLILGGRYSR
FT                   YRTGSYDSRTQGMTYVSANRFTPYTGIVFDLTGNLSLYGSYSSLFVPQSQKDEHGSYLK
FT                   PVTGNNLEAGIKGEWLEGRLNASAAVYRARKNNLATAAGRDPSGNTYYRAANQAKTHGW
FT                   EIEVGGRITPEWQIQAGYSQSKTRDQDGSRLNPDSVPERSFKLFTAYHFAPEAPSGWTI
FT                   GAGVRWQSETHTDPATLRIPNPAAKARAADNSRQKAYAVADIMARYRFNPRAELSLNVD
FT                   NLFNKHYRTQPDRHSYGALRTVNAAFTYRFK"
FT   CDS_pept        complement(547420..547743)
FT                   /transl_table=11
FT                   /locus_tag="NMA0576"
FT                   /product="hypothetical protein NMA0576"
FT                   /note="NMA0576, len: 107 aa; unknown, shows weak similarity
FT                   to TR:P96597 (EMBL:AB001488), ydbB, Bacillus subtilis
FT                   hypothetical protein (113 aa), fasta scores; E(): 2.7e-05,
FT                   33.3% identity in 66 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0576"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07846"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RHJ8"
FT                   /protein_id="CAM07846.1"
FT                   /translation="MQNETINLKQHLAAIKEYWQPEIINRHGFQFRLVKLLGDYGWHTH
FT                   GYSDKVLFAVEGDMAVDFADGGSMTIREGEMAVVPKSVSHRPRSENGCSLVLIELSDPS
FT                   EAV"
FT   CDS_pept        complement(548781..549746)
FT                   /transl_table=11
FT                   /locus_tag="NMA0577"
FT                   /product="putative ferric enterobactin transporter binding
FT                   protein"
FT                   /note="NMA0577, fetB2, probable ferric enterobactin
FT                   transporter binding protein, len: 321 aa; similar to
FT                   TR:AAD29611 (EMBL:AF115385), fetB, Neisseria gonorrhoeae
FT                   putative ferric enterobactin transporter periplasmic
FT                   binding protein (323 aa), fasta scores; E(): 0, 50.6%
FT                   identity in 314 aa overlap. Contains a probable N-terminal
FT                   signal sequence and an appropriately positioned PS00013
FT                   Prokaryotic membrane lipoprotein lipid attachment site.
FT                   Similar to NMA0452, fasta scores; E(): 0, 50.0% identity in
FT                   314 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0577"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07847"
FT                   /db_xref="GOA:A0A0U1RHJ9"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="InterPro:IPR033870"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RHJ9"
FT                   /protein_id="CAM07847.1"
FT                   /translation="MKPRFYWAACAVLLTACSPEPAAEKTVSAASASAATLTVPTARGD
FT                   AVVPKNPERVAVYDWAALDTLTELGVNVGATTAPVRVDYLQPAFDKAATVGTLFEPDYE
FT                   ALHRYNPQLVITGGPGAEAYEQLAKNATTIDLTVDNGNIRTSGEKQMETLARIFGKEAR
FT                   AAELKAQIDALFAQTREAAKGKGRGLVLSVTGNKVSAFGTQSRLASWIHGDIGLPPVDE
FT                   SLRNEGHGQPVSFEYIKEKNPDWIFIIDRTAAIGQEGPAAVEVLDNALVRGTNAWKRKQ
FT                   IIVMPAANYIVAGGSRQLIQAAEQLKEAFEKAEPVAAGKE"
FT   CDS_pept        549982..550938
FT                   /transl_table=11
FT                   /locus_tag="NMA0578"
FT                   /product="putative araC-family transcriptional regulator"
FT                   /note="NMA0578, possible araC-family transcriptional
FT                   regulator, len: 318 aa; shows similarity to known
FT                   transcriptional regulators only at the C-terminus, in the
FT                   putative helix-turn-helix region e.g. TR:O52834
FT                   (EMBL:AJ000061), alcR, Bordetella bronchiseptica regulator
FT                   of alcaligin siderophore synthesis (303 aa), fasta scores;
FT                   E(): 5.2e-06, 32.9% identity in 140 aa overlap. Contains a
FT                   probable helix-turn-helix motif at aa 236-257 (Score
FT                   2068,+6.23 SD). Contains Pfam match to entry PF00165
FT                   HTH_2,Bacterial regulatory helix-turn-helix proteins, araC
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0578"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07848"
FT                   /db_xref="GOA:A0A0U1RHK0"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RHK0"
FT                   /protein_id="CAM07848.1"
FT                   /translation="MNTAAIYRQYQTYVRSDKSGWALDGCSDSALIAQAKQPGLHLEMC
FT                   INRFDSGITLSRMRGGGTGAFPTEIHNFSHNCALFVMVSGQNRLQMGGREYRPSAGEIW
FT                   LVRGELADVSETLLPDNSGMCALHLDFSLEKLRRWHDEGLLDERLFSPQTIGRFALQRL
FT                   AQNAAALTAAACPLLQRSFESDGFGLLADEAAALELSARLLRFTFRRHDNGYRRRRIDE
FT                   AADILQHEFARPLTIAEIARRVGLNECYLKRYFKAQTGETVAGCLRRLRLEHALALIES
FT                   GSTVQAAMHFCGYRHAGRFNEAFRRHYGFLPSDVKKC"
FT   CDS_pept        complement(551052..553067)
FT                   /transl_table=11
FT                   /locus_tag="NMA0579"
FT                   /product="putative prolyl endopeptidase"
FT                   /EC_number="3.4.21.26"
FT                   /note="NMA0579, possible prolyl endopeptidase, len: 671 aa;
FT                   shows weak similarity to known prolyl endopeptidases e.g.
FT                   SW:PPCE_AERHY (EMBL:D14005) Aeromonas hydrophila prolyl
FT                   endopeptidase (EC 3.4.21.26) (689 aa), fasta scores; E():
FT                   3.5e-31, 25.5% identity in 666 aa overlap and SW:PPCF_FLAME
FT                   (EMBL:M81461) Flavobacterium meningosepticum prolyl
FT                   endopeptidase precursor (EC 3.4.21.26) (705 aa),fasta
FT                   scores; E(): 1.8e-28, 24.7% identity in 684 aa overlap.
FT                   Contains Pfam match to entry PF00326 Peptidase_S9, Prolyl
FT                   oligopeptidase family"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0579"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07849"
FT                   /db_xref="GOA:A0A0U1RHK1"
FT                   /db_xref="InterPro:IPR001375"
FT                   /db_xref="InterPro:IPR002470"
FT                   /db_xref="InterPro:IPR023302"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RHK1"
FT                   /protein_id="CAM07849.1"
FT                   /translation="MKSYPDPYRHFENLDSAETQNFAAEANAETRARFLNNDKARALSD
FT                   GILAQLQDTRQIPFCQEHRARMYHFHQDAEYPKGVYRVCTAATYRSGYPEWKILFSVAD
FT                   FDELLGDDVYLGGVSHLVEQPNRALLTLSKSGGDTAYTLEVDLEAGELVEGGFHFPAGK
FT                   NHVSWRDENSVWVCPAWDERQLTESGYPREVWLVERGKSFEESLPVYQIAEDGMMVNAW
FT                   RYLDPQGSPIDLIEASDGFYTKTYLQVSAEGEAKPLNLPNDCDVVGYLAGHLLLTLRKD
FT                   WHRANQSYPSGALVAVKLNRGELGAAQLLFAPNETQALESVETTKRFVVASLLENVQGR
FT                   LKAWRFTDGKWQETELPRLPSGALEMTDQPWGGDVVYLAASDFTTPLTLFALDLNVMEL
FT                   TVMRRQPQQFDSDGINVQQFWTTSADGERIPYFHVGKNAAPDMPTLVYAYGGFGIPELP
FT                   HYLGSIGKYWLEEGNAFVLANIRGGGEFGPRWHQAAQGISKHKSVDDLLAVVSDLSERG
FT                   ISSPEHIGLQGGSNGGLITAAAFVREPQSIGALVCEVPLTDMIRYPLLSAGSSWTDEYG
FT                   NPQKYEVCKRRLGELSPYHNLSDGIDYPPALITTSLSDDRVHPAHALKFYAKLRETSPQ
FT                   SWLYSPDGGGHTGNGTQREAADELACVLLFLKEFLG"
FT   CDS_pept        complement(553268..554578)
FT                   /transl_table=11
FT                   /locus_tag="NMA0580"
FT                   /product="putative acetylglutamate synthase"
FT                   /EC_number="2.3.1.1"
FT                   /note="NMA0580, argA, probable acetylglutamate
FT                   synthase,len: 436 aa; similar to many e.g. SW:ARGA_ECOLI
FT                   (EMBL:Y00492), argA, Escherichia coli acetylglutamate
FT                   synthase (EC 2.3.1.1) (443 aa), fasta scores; E(): 0,40.7%
FT                   identity in 435 aa overlap. Contains Pfam match to entry
FT                   PF00583 Acetyltransf, Acetyltransferase (GNAT) family"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0580"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07850"
FT                   /db_xref="GOA:Q9JW21"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR010167"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR033719"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9JW21"
FT                   /protein_id="CAM07850.1"
FT                   /translation="MIVPDLFVAHFREAAPYIRQMRGKTLVAGIDDRLLEGDTLNKFAA
FT                   DIGLLSQLGIRLVLIHGARHFLDRHAAAQGRTPHYCRGLRVTDETSLEQAQQFAGTVRS
FT                   RFEAALCGSVSGFARAPSVPLVSGNFLTARPIGVIDGTDMEYAGVIRKTDTAALRFQLD
FT                   AGNIVWLPPLGHSYSGKTFHLDMLQTAASVAVSLQAEKLVYLTLSDGISRPDGTLAVTL
FT                   SAQEAQSLAEHAGGETRRLISSAVAALEGGVHRVQILNGAADGSLLQELFTRNGIGTSI
FT                   AKEAFVSIRQAHSGDIPHIAALIRPLEEQGILLHRSREYLENHISEFSILEHDGNLYGC
FT                   AALKTFAEADCGEIACLAVSPQAQDGGYGERLLAHIIDKARGIGISRLFALSTNTGEWF
FT                   AERGFQTASEDELPETRRKDYRSNGRNSHILVRRLHR"
FT   CDS_pept        complement(554575..555009)
FT                   /transl_table=11
FT                   /locus_tag="NMA0581"
FT                   /product="hypothetical protein NMA0581"
FT                   /note="NMA0581, len: 144 aa; unknown"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0581"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07851"
FT                   /db_xref="GOA:A0A0U1RHK2"
FT                   /db_xref="InterPro:IPR011723"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RHK2"
FT                   /protein_id="CAM07851.1"
FT                   /translation="MPACFCPHCKTRLWVKETQLNVAQGFVVCQKCEGMFKAKDHLAST
FT                   KEPIFNDLPEAVSDVKLVHRIGTSAIGKKQISRDEIAGILNGGTTQPDIPPATAATPAA
FT                   APQVTVPPAAPARQDGFNWTIATLFALIVLIMQLSYLVIL"
FT   CDS_pept        complement(555083..555724)
FT                   /transl_table=11
FT                   /locus_tag="NMA0582"
FT                   /product="putative orotate phosphoribosyltransferase"
FT                   /EC_number="2.4.2.10"
FT                   /note="NMA0582, pyrE, probable orotate
FT                   phosphoribosyltransferase, len: 213 aa; similar to many
FT                   e.g. SW:PYRE_ECOLI (EMBL:X00781), pyrE, Escherichia coli
FT                   orotate phosphoribosyltransferase (EC 2.4.2.10) (212
FT                   aa),fasta scores; E(): 0, 56.2% identity in 210 aa overlap.
FT                   Contains Pfam match to entry PF00156
FT                   Pribosyltran,Purine/pyrimidine phosphoribosyl transferases
FT                   and PS00103 Purine/pyrimidine phosphoribosyl transferases
FT                   signature"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0582"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07852"
FT                   /db_xref="GOA:P65914"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR004467"
FT                   /db_xref="InterPro:IPR023031"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/Swiss-Prot:P65914"
FT                   /protein_id="CAM07852.1"
FT                   /translation="MTDFRQDFLKFSLAQNVLKFGEFTTKAGRRSPYFFNAGLFNDGLS
FT                   TLQLAKFYAQSIIESGIRFDMLFGPAYKGIILAAATAMMLAEKGVNVPFAYNRKEAKDH
FT                   GEGGVLVGAPLKGRVLIIDDVISAGTSVRESIKLIEAEGATPAGVAIALDRMEKGTGEL
FT                   SAVQEVEKQYGLPVAPIASLNDLFILLQNNPEFGQFLEPVRAYRRQYGVE"
FT   CDS_pept        complement(555786..556523)
FT                   /transl_table=11
FT                   /locus_tag="NMA0583"
FT                   /product="hypothetical protein NMA0583"
FT                   /note="NMA0583, len: 245 aa; unknown"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0583"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07853"
FT                   /db_xref="InterPro:IPR036895"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RHK3"
FT                   /protein_id="CAM07853.1"
FT                   /translation="MLSARYLHLHEALGLGPMWLKQAAAVLPPKNTPAPSAQARPQTVR
FT                   AAPIRPSQPHNGQARLETMKALETAAVHTRKPAPETETPPPGLSDGIAPVPAASGITKL
FT                   AVVSLCPPIEDAVYGQLFYGKAGVLLDNILKAVGLDAAYVHKTCWVKTAAVGNPMPSEA
FT                   AIETATVSVMQELDGCRAPAVLFLGQAFVNPERQAMIETLCGSRPFFIIDHPARLLRQP
FT                   ELKARAWQVLKQLKRALRQGGGS"
FT   CDS_pept        complement(556517..556957)
FT                   /transl_table=11
FT                   /locus_tag="NMA0584"
FT                   /product="putative acetyltransferase"
FT                   /note="NMA0584, possible acetyltransferase, len: 146 aa;
FT                   shows weak similarity to SW:RIMI_ECOLI (EMBL:X06117),rimI,
FT                   Escherichia coli ribosomal-protein-alanine
FT                   acetyltransferase (148 aa), fasta scores; E():
FT                   1.4e-11,40.8% identity in 120 aa overlap. Also similar to
FT                   hypothetical acetyltransferases. Contains Pfam match to
FT                   entry PF00583 Acetyltransf, Acetyltransferase (GNAT)
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0584"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07854"
FT                   /db_xref="GOA:A0A0U1RHK4"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR006464"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RHK4"
FT                   /protein_id="CAM07854.1"
FT                   /translation="MNIRRAVYADCAALAALDAVCNPSAWTQRQFESALVSPSEQVFLA
FT                   EKDGGIAAFIVWQNLPDESELHLIATAPECRRQGIASALLEYWFTHLPEDTQRLLLEVR
FT                   AGNTAAQALYTAHGFSITGRRKNYYRTADGKTEDAVLMEKIC"
FT   CDS_pept        complement(556954..557631)
FT                   /transl_table=11
FT                   /locus_tag="NMA0585"
FT                   /product="hypothetical protein NMA0585"
FT                   /note="NMA0585, len: 225 aa; unknown, similar to bacterial
FT                   hypothetical proteins e.g. SW:YEAZ_ECOLI
FT                   (EMBL:AE000275),yeaZ, Escherichia coli hypothetical protein
FT                   (231 aa),fasta scores; E(): 6.7e-13, 35.2% identity in 227
FT                   aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0585"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07855"
FT                   /db_xref="GOA:A0A0U1RHK5"
FT                   /db_xref="InterPro:IPR000905"
FT                   /db_xref="InterPro:IPR022496"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RHK5"
FT                   /protein_id="CAM07855.1"
FT                   /translation="MQADFNRPVLAVDTGTSYLSLALRADGETCLFHQEVGSRQSALIL
FT                   PEIRTLFHDAGITAADLGAIVYAKGPGAFTGLRIGIGVAQGLATPFDTPLIGVPSLDAA
FT                   ASLPPPQSCILAAADARMGEVFYAWFDTLNRRRLSDYQVGRAADIRLPEGCAFSDGIGN
FT                   AFALENRPPFSGKPDMPTAADFLNLAAEGGFPAVAAAHAELLYVRNKIALTAKEQAERR
FT                   ARL"
FT   CDS_pept        complement(557771..558613)
FT                   /transl_table=11
FT                   /locus_tag="NMA0586"
FT                   /product="putative lipoprotein"
FT                   /note="NMA0586, possible lipoprotein, len: 280 aa; unknown,
FT                   contains a possible N-terminal signal sequence and an
FT                   appropriately positioned PS00013 Prokaryotic membrane
FT                   lipoprotein lipid attachment site"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0586"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07856"
FT                   /db_xref="InterPro:IPR011250"
FT                   /db_xref="InterPro:IPR014902"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RHK6"
FT                   /protein_id="CAM07856.1"
FT                   /translation="MTRSKPVNRTAFCCLSLTAALILTACSSGGGGVAADIGAVLADAL
FT                   TAPLDHKDKSLQSLTLDQSVRKNEKLKLAAQGAEKTYGNGDSLNTGKLKNDKVSRFDFI
FT                   RQIEVDGQLITLESGEFQVYKQSHSALTALQTEQVQDSEHSGKMVAKRQFRIGDIAGEH
FT                   TSFDKLPEGGRATYRGTAFGSDDASGKLTYTIDFAAKQGHGKIEHLKSPELNVDLAASD
FT                   IKPDKKRHAVISGSVLYNQAEKGSYSLGIFGGQAQEVAGSAEVETANGIRHIGLAAKQ"
FT   CDS_pept        complement(558939..560003)
FT                   /transl_table=11
FT                   /locus_tag="NMA0587"
FT                   /product="putative fructose-1,6-bisphosphate aldolase"
FT                   /EC_number="4.1.2.13"
FT                   /note="NMA0587, fba, probable fructose-1,6-bisphosphate
FT                   aldolase, len: 354 aa; similar to many e.g. TR:O87796
FT                   (EMBL:AJ011927), fda, Pseudomonas stutzeri
FT                   fructose-1,6-bisphosphate aldolase (354 aa), fasta scores;
FT                   E(): 0, 78.0% identity in 350 aa overlap. Contains Pfam
FT                   match to entry PF01116 F_bP_aldolase,Fructose-bisphosphate
FT                   aldolase class-II and PS00602 Fructose-bisphosphate
FT                   aldolase class-II signature 1"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0587"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07857"
FT                   /db_xref="GOA:A0A0U1RHK7"
FT                   /db_xref="InterPro:IPR000771"
FT                   /db_xref="InterPro:IPR006412"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RHK7"
FT                   /protein_id="CAM07857.1"
FT                   /translation="MALVSMRQLLDHAAENSYGLPAFNVNNLEQMRAIMEAADQVNAPV
FT                   IVQASAGARKYAGAPFLRHLILAAVEEFPHIPVVMHQDHGASPDVCQRSIQLGFSSVMM
FT                   DGSLMEDGKTPSSYEYNVNATRTVVNFSHACGVSVEGEIGVLGNLETGEAGEEDGVGAV
FT                   GKLSHDQMLTSVEDAVRFVKDTGVDALAIAVGTSHGAYKFTRPPTGDVLRIDRIKEIHQ
FT                   ALPNTHIVMHGSSSVPQEWLKVINEYGGNIGETYGVPVEEIVEGIKHGVRKVNIDTDLR
FT                   LASTGAVRRYLAENPSDFDPRKYLSKTIEAMKQICLDRYLAFGCEGQAGKIKPVSLEKM
FT                   ANRYAKGELNQIVK"
FT   CDS_pept        560197..561114
FT                   /transl_table=11
FT                   /locus_tag="NMA0588"
FT                   /product="putative integrase/recombinase"
FT                   /note="NMA0588, xerC, probable integrase/recombinase, len:
FT                   305 aa; similar to many e.g. SW:XERC_ECOLI
FT                   (EMBL:M87049),xerC, Escherichia coli integrase/recombinase
FT                   (298 aa),fasta scores; E(): 0, 43.7% identity in 300 aa
FT                   overlap. Similar to NMA0964, fasta scores; E(): 4.4e-28,
FT                   35.0% identity in 294 aa overlap. Contains Pfam match to
FT                   entry PF00589 Phage_integrase, 'Phage' integrase family"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0588"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07858"
FT                   /db_xref="GOA:Q9JW14"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR011931"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR023009"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9JW14"
FT                   /protein_id="CAM07858.1"
FT                   /translation="MVLDGFAAHFDAYLENIVREGKSEHTVAAYRRDLEELFALLAQMP
FT                   SEDAGGVPQGLSQRDFTAALRRLSQRGLNARTLARKLSSWRQYCAWLVKRGLLHTDPTA
FT                   DIKPPKQPERVPKALPQEWLNRMLDLPVDGGDPLAVRDHALFELMYGSGLRVSEIHGLN
FT                   ADDVYLDEAWVHVTGKGRKQRQVPLTGKSVEALKNYLPLRQTASDGKALFTGRNGTRLS
FT                   QRQIQKRLAQWAAQNGDGRHVSPHMMRHSYAGHLLQASRDIRAVQELLGHSSLSTTQIY
FT                   TKLDFDHIARLYDEAHPRAKRQDE"
FT   CDS_pept        561199..563112
FT                   /transl_table=11
FT                   /locus_tag="NMA0589"
FT                   /product="putative 1-deoxyxylulose-5-phosphate synthase"
FT                   /note="NMA0589, dxs, probable 1-deoxyxylulose-5-phosphate
FT                   synthase, len: 637 aa; similar to many e.g. SW:DXS_ECOLI
FT                   (EMBL:AE000148), dxp, Escherichia coli
FT                   1-deoxyxylulose-5-phosphate synthase (619 aa), fasta
FT                   scores; E(): 0, 55.8% identity in 629 aa overlap. Contains
FT                   PS00801 Transketolase signature 1 and PS00802 Transketolase
FT                   signature 2"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0589"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07859"
FT                   /db_xref="GOA:Q9JW13"
FT                   /db_xref="InterPro:IPR005474"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR005477"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR020826"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9JW13"
FT                   /protein_id="CAM07859.1"
FT                   /translation="MNPSPLLDLIDSPQDLRRLDKKQLPRLAGELRTFLLESVGQTGGH
FT                   FASNLGAVELTVALHYVYNTPEDKLVWDVGHQSYPHKILTGRKNQMHTMRQYGGLAGFP
FT                   KRCESEYDAFGVGHSSTSIGAALGMAAADKQLGSDRRSVAIIGDGAMTAGQAFEALNCA
FT                   GDMDVDLLVVLNDNEMSISPNVGALPKYLASNVVRDMHGLLSTVKAQTGKVLDKIPGAM
FT                   EFAQKVEHKIKTLAEEAEHAKQSLSLFENFGFRYTGPVDGHNVENLVDVLEDLRGRKGP
FT                   QLLHVITKKGNGYKLAENDPVKYHAVANLPKESAAQMPSEKEPKPAAKPTYTQVFGKWL
FT                   CDRAAADSRLVAITPAMREGSGLVEFEQRFPDRYFDVGIAEQHAVTFAGGLACEGMKPV
FT                   VAIYSTFLQRAYDQLVHDIALQNLPVLFAVDRAGIVGADGPTHAGLYDLSFLRCIPNMI
FT                   VAAPSDENECRLLLSTCYQADAPAAVRYPRGTGTGVPVSDGMETVEIGKGIIRREGEKT
FT                   AFIAFGSMVAPALAVAGKLNATVADMRFVKPIDEELIVRLARSHDRIVTLEENAEQGGA
FT                   GSAVLEVLAKHGICKPVLLLGVADTVTGHGDPKKLLDDLGLSAEAVERRVRAWLSDRDA
FT                   AN"
FT   CDS_pept        complement(563197..564525)
FT                   /transl_table=11
FT                   /locus_tag="NMA0590"
FT                   /product="hypothetical protein NMA0590"
FT                   /note="NMA0590, len: 442 aa; unknown, similar to many
FT                   bacterial hypothetical proteins e.g. SW:YLEA_ECOLI
FT                   (EMBL:AE000170), yleA, Escherichia coli hypothetical
FT                   protein (474 aa), fasta scores; E(): 0, 64.8% identity in
FT                   440 aa overlap. Contains Pfam match to entry PF00919
FT                   UPF0004, Uncharacterized protein family UPF0004 and PS01278
FT                   Uncharacterized protein family UPF0004 signature"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0590"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07860"
FT                   /db_xref="GOA:A1IQ34"
FT                   /db_xref="InterPro:IPR002792"
FT                   /db_xref="InterPro:IPR005839"
FT                   /db_xref="InterPro:IPR006463"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013848"
FT                   /db_xref="InterPro:IPR020612"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR038135"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1IQ34"
FT                   /protein_id="CAM07860.1"
FT                   /translation="MKKVFIRTFGCQMNEYDSDKMLAVLAEEHGGIEQVTQADEADIIL
FT                   FNTCSVREKAQEKVFSDLGRVRPLKEKKPGLIIGVAGCVASQEGENIIKRAPYVDVVFG
FT                   PQTLHRLPKMIVDKETSGLSQVDISFPEIEKFDHLPPARVEGGAAFVSIMEGCSKYCSF
FT                   CVVPYTRGEEFSRPLNDVLTEIANLAQQGVKEINLLGQNVNAYRGEMDDGEICDFATLL
FT                   RIVHEIPGIERMRFTTSHPREFTDSIIECYRDLPKLVSHLHLPIQSGSDRVLSAMKRGY
FT                   TALEYKSIIRKLRAIRPDLCLSSDFIVGFPGETEREFEQTLKLVKDIAFDLSFVFIYSP
FT                   RPGTPAANLHDDTPHEEKVRRLEALNEVIEAETARINQTMIGTVQRCLVEGISKKDPDQ
FT                   LQARTANNRVVNFTGTPDMINQMIDLEITEAYTFSLRGKIVEA"
FT   CDS_pept        565358..566641
FT                   /transl_table=11
FT                   /locus_tag="NMA0592"
FT                   /product="putative glutamate-1-semialdehyde
FT                   2,1-aminomutase"
FT                   /EC_number="5.4.3.8"
FT                   /note="NMA0592, hemL, probable glutamate-1-semialdehyde
FT                   2,1-aminomutase, len: 427 aa; similar to many e.g.
FT                   SW:GSA_PSEAE (EMBL:X82072), hemL, Pseudomonas aeruginosa
FT                   glutamate-1-semialdehyde 2,1-aminomutase (EC 5.4.3.8) (427
FT                   aa), fasta scores; E(): 0, 60.1% identity in 426 aa
FT                   overlap. Contains Pfam match to entry PF00202
FT                   aminotran_3,Aminotransferases class-III pyridoxal-phosphate
FT                   and PS00600 Aminotransferases class-III pyridoxal-phosphate
FT                   attachment site"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0592"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07861"
FT                   /db_xref="GOA:Q9JW10"
FT                   /db_xref="InterPro:IPR004639"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9JW10"
FT                   /protein_id="CAM07861.1"
FT                   /translation="MNRNEILFDRAKAVIPGGVNSPVRAFGSVGGVPRFIKKAEGAYVW
FT                   DENGTRYTDYVGSWGPAIVGHAHPEVIEAVREAALGGLSFGAPTEGEIAIAEEIAKIMP
FT                   SVERLRLVSSGTEATMTAIRLARGFTGRDKIIKFEGCYHGHSDSLLVKAGSGLLTFGNP
FT                   SSAGVPADFTKHTLVLEYNNIAQLEEAFAQSGNDIACVILEPFVGNMNLVRPSEAFVKA
FT                   LRELTEKHGAVLIYDEVMTGFRVALGGAQSLHGITPDLTTMGKVIGGGMPLAAFGGRKD
FT                   IMECISPLGGVYQAGTLSGNPIAVAAGLKTLEIIRREGFYENLTARTEQLVQGFRTAAD
FT                   AAGIEFTADSVGGMFGLYFAAHAPRNYADMARSNIEGFKQFFHGMLDRGIAFGPSAYEA
FT                   GFVSAAHTPELIDETVAVAVEVFKAMAA"
FT   CDS_pept        complement(567140..567703)
FT                   /transl_table=11
FT                   /locus_tag="NMA0594"
FT                   /product="putative oligoribonuclease"
FT                   /EC_number="3.1.-.-"
FT                   /note="NMA0594, orn, probable oligoribonuclease, len: 187
FT                   aa; similar to many e.g. SW:ORN_ECOLI (EMBL:U14003),
FT                   orn,Escherichia coli oligoribonuclease (EC 3.1.-.-) (180
FT                   aa),fasta scores; E(): 0, 56.3% identity in 176 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0594"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07862"
FT                   /db_xref="GOA:Q9JW09"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR013520"
FT                   /db_xref="InterPro:IPR022894"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9JW09"
FT                   /protein_id="CAM07862.1"
FT                   /translation="MQDKNNLCWLDMEMTGLNPETDRIIEVAMIITDSDLNVLAQSEVY
FT                   AIHQSDELLDNMDEWNTATHGRTGLTQRVRESSHTEAEVEQKLLDFMSEWVPRRATPMC
FT                   GNSIHQDRRFMVKYMPKLENYFHYRNLDVSTLKELAKRWNPPVAKSVVKRGSHKALDDI
FT                   LESIEEMRHYREHFLISAPRAEAQ"
FT   CDS_pept        complement(567721..568608)
FT                   /transl_table=11
FT                   /locus_tag="NMA0595"
FT                   /product="putative ribosomal protein L11 methyltransferase"
FT                   /EC_number="2.1.1.-"
FT                   /note="NMA0595, prmA, probable ribosomal protein L11
FT                   methyltransferase, len: 295 aa; similar to SW:PRMA_ECOLI
FT                   (EMBL:S67010), prmA, Escherichia coli ribosomal protein L11
FT                   methyltransferase (EC 2.1.1.-) (293 aa), fasta scores; E():
FT                   0, 46.2% identity in 299 aa overlap. Similar to many
FT                   hypothetical ribosomal protein L11 methyltransferases"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0595"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07863"
FT                   /db_xref="GOA:Q9JW08"
FT                   /db_xref="InterPro:IPR004498"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9JW08"
FT                   /protein_id="CAM07863.1"
FT                   /translation="MPYQQITVNVNDAVAERLADALMEHGALSAAIEDAYAGTQNEQAI
FT                   FGEPGMPAEQIWQQSKVIALFGEHDEAAAIIQTAAQECGLKDLAYTGEILEDQDWVRLT
FT                   QAQFDPIRISERLWITPSWHEAPEDTAVNLRLDPGLAFGTGSHPTTRLCLKWLDTQLKN
FT                   GESVLDYGCGSGILTIAALKLGAGFAVGVDIDEQAVRAGKDNAEQNNVDAQFFLPDGLP
FT                   QGQFDVVVANILANPLRMLGEMLAARTKQGGRIVLSGLLDEQAEELGGIYSQWFDLDPA
FT                   ETEEGWARLSGTKR"
FT   CDS_pept        complement(568869..570230)
FT                   /transl_table=11
FT                   /locus_tag="NMA0596"
FT                   /product="putative acetyl-CoA carboxylase biotin
FT                   carboxylase component"
FT                   /EC_number="6.3.4.14"
FT                   /note="NMA0596, accC, probable acetyl-CoA carboxylase
FT                   biotin carboxylase component, len: 453 aa; similar to many
FT                   e.g. SW:ACCC_PSEAE (EMBL:L14612), accC, Pseudomonas
FT                   aeruginosa biotin carboxylase (EC 6.3.4.14) (449 aa),fasta
FT                   scores; E(): 0, 68.2% identity in 444 aa overlap. Contains
FT                   Pfam match to entry PF00289
FT                   CPSase_L_chain,Carbamoyl-phosphate synthase (CPSase),
FT                   PS00866 Carbamoyl-phosphate synthase subdomain signature 1
FT                   and PS00867 Carbamoyl-phosphate synthase subdomain
FT                   signature 2"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0596"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07864"
FT                   /db_xref="GOA:A0A0U1RHK8"
FT                   /db_xref="InterPro:IPR004549"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005481"
FT                   /db_xref="InterPro:IPR005482"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR011764"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RHK8"
FT                   /protein_id="CAM07864.1"
FT                   /translation="MLKKVLIANRGEIALRVLRACREMGIATVAVHSEADKDSLHVKLA
FT                   DESVCIGPAASAQSYLNVPAIIAAAEVSCADAVHPGYGFLAENADFAEQVEQSGFTFIG
FT                   PKPDTIRLMGDKVSAKHAMIAAGVPCVPGSDGALPDDGEEILKIADKIGYPVIIKASGG
FT                   GGGRGMRVVEKKEDLLQSVEMTKAEAGAAFGNPMVYMERYLQRPRHVEIQVIADEHGNA
FT                   VYLAERDCSLQRRHQKVIEEAPAPFITEKERAKIGKACADACKRIGYRGAGTFEFLYED
FT                   GEFFFIEMNTRVQVEHPVTELITGVDIVQEQLRIAAGLPLQYKQKDIQVEGHAFECRIN
FT                   AEDPYNFIPSPGPIESCHLPSGFGIRVDSHIYQGYRIPPYYDSLIGKVCVVGKDRDQAM
FT                   AKMRVALAELAITGIKTNTPLHRDLFNDPGFQKGGVSIHYLEHWLEDRKAKQDK"
FT   CDS_pept        complement(570343..570798)
FT                   /transl_table=11
FT                   /locus_tag="NMA0597"
FT                   /product="putative acetyl-CoA carboxylase biotin carboxyl
FT                   carrier protein"
FT                   /note="NMA0597, accB, probable acetyl-CoA carboxylase
FT                   biotin carboxyl carrier protein, len: 151 aa; similar to
FT                   many e.g. SW:BCCP_PSEAE (EMBL:L14612), accB, Pseudomonas
FT                   aeruginosa biotin carboxyl carrier protein of acetyl-CoA
FT                   carboxylase (156 aa), fasta scores; E(): 4.3e-23,64.3%
FT                   identity in 157 aa overlap. Contains Pfam match to entry
FT                   PF00364 biotin_lipoyl, Biotin-requiring enzymes and PS00188
FT                   Biotin-requiring enzymes attachment site"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0597"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07865"
FT                   /db_xref="GOA:A0A0U1RHK9"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001249"
FT                   /db_xref="InterPro:IPR001882"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RHK9"
FT                   /protein_id="CAM07865.1"
FT                   /translation="MDLRKLKKLIDLVEESGIAEIEVTEGEEKVRITRTIAAAPVYAAP
FT                   VPAAAPAVTPAAAPVAASAPAAAPAARDLSDAQKSPMVGTFYRAPGPNAAPFVEVGQQV
FT                   KAGDTLCIIEAMKLMNEIEAEKSGTVKEILVENGTPVEFGEPLFIIG"
FT   CDS_pept        571154..572194
FT                   /transl_table=11
FT                   /locus_tag="NMA0599"
FT                   /product="putative S-adenosylmethionine:tRNA
FT                   ribosyltransferase-isomerase"
FT                   /EC_number="5.-.-.-"
FT                   /note="NMA0599, queA, probable S-adenosylmethionine:tRNA
FT                   ribosyltransferase-isomerase, len: 346 aa; similar to many
FT                   e.g. SW:QUEA_ECOLI (EMBL:M37702), queA, Escherichia coli
FT                   S-adenosylmethionine:tRNA ribosyltransferase-isomerase (EC
FT                   5.-.-.-) (356 aa), fasta scores; E(): 0, 55.7% identity in
FT                   350 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0599"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07866"
FT                   /db_xref="GOA:Q9JW05"
FT                   /db_xref="InterPro:IPR003699"
FT                   /db_xref="InterPro:IPR036100"
FT                   /db_xref="InterPro:IPR042118"
FT                   /db_xref="InterPro:IPR042119"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9JW05"
FT                   /protein_id="CAM07866.1"
FT                   /translation="MDISDFDFTLPEHLIAQHPPEVRGSSHLLVALPDMPLQDRVFGDL
FT                   PDYVEAGDVLVFNNTKVMKARLFGQKDSGGRIEALIERVLDSHTALAHIRSSKSPKPGM
FT                   GLVFEGGIRAVMVGREGELFCLRFEGGETVYELLEQNGHLPLPPYIERAADADDDSRYQ
FT                   TVYAKYQGAVAAPTAGLHFTEELLRRLKDKGAVTAEVTLHVGAGTFQPVRVDKIEEHKM
FT                   HSEWFEVPSETAAAVEAAKARGNKVWAVGTTSMRALESAARATGRLKAGQGDTDIFITP
FT                   GYRFNVADRLVTNFHLPKSTLLMLVSAFSGMGHIRAAYRYAVEREYRFFSYGDAMVLGR
FT                   NEGVVR"
FT   CDS_pept        complement(572565..573143)
FT                   /transl_table=11
FT                   /locus_tag="NMA0600"
FT                   /product="hypothetical protein NMA0600"
FT                   /note="NMA0600, len: 192 aa; unknown, similar to
FT                   SW:MDAB_ECOLI (EMBL:U18656), mdaB, Escherichia coli
FT                   modulator of drug activity B (putative modulator of
FT                   topoisomerase IV activity imparting DMP 840, adriamycin and
FT                   etoposide resistance on overexpression) (193 aa),fasta
FT                   scores; E(): 0, 59.2% identity in 191 aa overlap. Also
FT                   similar to hypothetical proteins from bacteria and
FT                   Schizosaccharomyces pombe e.g. SW:YA05_SCHPO (EMBL:Z49811),
FT                   SPAC5H10.05C, Schizosaccharomyces pombe hypothetical
FT                   protein (196 aa), E(): 0, 55.7% identity in 192 aa overlap.
FT                   Identical, except at the N-terminus, to NMA1174, fasta
FT                   scores; E(): 0, 99.3% identity in 147 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0600"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07867"
FT                   /db_xref="InterPro:IPR003680"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RHL0"
FT                   /protein_id="CAM07867.1"
FT                   /translation="MNILLLDGGKAFGHSHGGLNRTLHKKAKEVLTALGHNVQETVIDA
FT                   GYDVEAEIEKFVWMDAVIWQMPGWWMHEPWTVKKYIDEVLTAGHGKLYQSDGRHSVNPT
FT                   EGYGTGGLLQGKKHMLSLTWNAPIEAFTREGDFFEGKGVDVLYMHFHKANEFLGMTRLP
FT                   TFLCNDVVKNPQVEKYLADYQAHLEKVFG"
FT   CDS_pept        573382..574281
FT                   /transl_table=11
FT                   /locus_tag="NMA0601"
FT                   /product="putative lysR-family transcriptional regulator"
FT                   /note="NMA0601, probable lysR-family transcriptional
FT                   regulator, len: 299 aa; similar to many e.g. TR:P72131
FT                   (EMBL:U35068), ptxR, Pseudomonas aeruginosa positive
FT                   regulator of exotoxin A production (312 aa), fasta scores;
FT                   E(): 7.4e-24, 31.9% identity in 295 aa overlap. Contains
FT                   Pfam match to entry PF00126 HTH_1, Bacterial regulatory
FT                   helix-turn-helix protein, lysR family and PS00044 Bacterial
FT                   regulatory proteins, lysR family signature. Contains
FT                   probable helix-turn-helix motif at aa 19-40 (Score 1196,
FT                   +3.26 SD)"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0601"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07868"
FT                   /db_xref="GOA:A0A0U1RHL1"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RHL1"
FT                   /protein_id="CAM07868.1"
FT                   /translation="MKTNSEELTVFVQVVESGSFSRAAEQLAMANSAVSRIVKRLEEKL
FT                   GVNLLNRTTRQLSLTEEGAQYFRRAQRILQEMAAAETEMLAVHEIPQGVLRVDSAMPMV
FT                   LHLLAPLAAKFNERYPHIRLSLVSSEGYINLIERKVDIALRAGELDDSGLRARHLFDSR
FT                   FRVIASPEYLAKHGTPQSTEELAGHQCLGFTEPGSLNTWAVLDAQGNPYKISPHFTASS
FT                   GEILRSLCLSGCGIACLSDFLVDNDIAEGKLIPLLAEQTSNKTHPFNAVYYSDKAVNLR
FT                   LRVFLDFLVEELGNNLCG"
FT   CDS_pept        complement(574508..577723)
FT                   /transl_table=11
FT                   /locus_tag="NMA0602"
FT                   /product="carbamoyl phosphate synthase large subunit"
FT                   /EC_number="6.3.5.5"
FT                   /note="NMA0602, carB, carbamoyl phosphate synthase large
FT                   subunit, len: 1071 aa; highly similar to many e.g.
FT                   SW:CARB_ECOLI (EMBL:V01500), carB, Escherichia coli
FT                   carbamoyl phosphate synthase large subunit (EC 6.3.5.5)
FT                   (1072 aa), fasta scores; E(): 0, 69.4% identity in 1073 aa
FT                   overlap. Note that the similarity between this sequence and
FT                   that from Neisseria gonorrhoeae differ beyond aa 969 (in
FT                   this sequence) where the similarity shifts frame in the
FT                   Neisseria gonorrhoeae sequence. Contains 3 Pfam matches to
FT                   entry PF00289 CPSase_L_chain,Carbamoyl-phosphate synthase
FT                   (CPSase), PS00866 Carbamoyl-phosphate synthase subdomain
FT                   signature 1, 2 PS00867 Carbamoyl-phosphate synthase
FT                   subdomain signature 2, and an appropriately positioned
FT                   PS00013 Prokaryotic membrane lipoprotein lipid attachment
FT                   site. Contains a probable N-terminal signal sequence"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0602"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07869"
FT                   /db_xref="GOA:Q9JW02"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005480"
FT                   /db_xref="InterPro:IPR005483"
FT                   /db_xref="InterPro:IPR006275"
FT                   /db_xref="InterPro:IPR011607"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR033937"
FT                   /db_xref="InterPro:IPR036897"
FT                   /db_xref="InterPro:IPR036914"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9JW02"
FT                   /protein_id="CAM07869.1"
FT                   /translation="MPKRTDLKSILIIGAGPIVIGQACEFDYSGAQACKALREEGYKVI
FT                   LVNSNPATIMTDPEMADVTYIEPIMWQTVEKIIAKERPDAILPTMGGQTALNCALDLAR
FT                   NGVLAKYNVELIGATEDAIDKAEDRGRFKEAMEKIGLSCPKSFVCHTMNEALAAQEQVG
FT                   FPTLIRPSFTMGGSGGGIAYNKDEFLAICERGFDASPTHELLIEQSVLGWKEYEMEVVR
FT                   DKNDNCIIICSIENFDPMGVHTGDSITVAPAQTLTDKEYQIMRNASLAVLREIGVDTGG
FT                   SNVQFAVNPENGEMIVIEMNPRVSRSSALASKATGFPIAKVAAKLAVGFTLDELRNDIT
FT                   GGRTPASFEPSIDYVVTKIPRFAFEKFPAADDRLTTQMKSVGEVMAMGRTIQESFQKAL
FT                   RGLETGLCGFNPRSSDKAEIRRELANPGPERMLFVADAFRAGFTLEEIHEICAIDPWFL
FT                   AQIEDLMKEEKAVSDGVLSDLDYAALRRLKRKGFSDKRIAQLLDVKEKEVREHRYVLNL
FT                   HPVYKRVDTCAAEFATETAYLYSTYEEECEARPSDRKKVMILGGGPNRIGQGIEFDYCC
FT                   VHAALALRESGFETIMVNCNPETVSTDFDTSDRLYFEPLTLEDVLEIVRTENPWGVIVH
FT                   YGGQTPLKLANALVENGVNIIGTSADSIDAAEDRERFQKVLNDLGLRQPPNRIAHNEEE
FT                   ALVKAEEIGYPLVVRPSYVLGGRAMQIVHSAEQLQKYMREAVQVSEDSPVLLDFFLNNA
FT                   IEVDVDCVSDGKDVVIGGIMQHVEQAGIHSGDSGCSLPPYSLSEEIQDEIRRQTKAMAY
FT                   ALGVVGLMNVQFAVQDGVVFVLEVNPRASRTVPFVSKATGVPLAKVGARCMAGISLKEQ
FT                   GVEKEVVPDFYAVKEAVFPFIKFPGVDTILGPEMRSTGEVMGVGASFGEAYYKAQLGAG
FT                   ERLNPTGKIFLSVREEDKERVIKTAKNFQALGYGICATRGTAQYLTEHGLIVQTINKVP
FT                   EGRPHIGDALKNGEIALVVNTVSSDPQSVSDSHIIRQSALQQRVPQYTTTAGGEAMSEG
FT                   AKSRDHLGVYSVQELHGRLKNRS"
FT   CDS_pept        complement(577730..578278)
FT                   /transl_table=11
FT                   /locus_tag="NMA0603"
FT                   /product="hypothetical protein NMA0603"
FT                   /note="NMA0603, len: 182 aa; unknown, lies within a region
FT                   of unusually low GC content. Shows weak similarity to
FT                   NMA2217, fasta scores; E(): 4.4e-05, 23.8% identity in 185
FT                   aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0603"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07870"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RHL2"
FT                   /protein_id="CAM07870.1"
FT                   /translation="MRTIFFSGSRSISRLNPQIRERINNILSNNFDIVIGDANGADKAI
FT                   QKFLQEQDYANVHIYFSGKIYRNNVGNWQFVQVDSKGTGRVFYTAKDKKMAEIADYGFI
FT                   LWDGKSIGSLNNIAELLQLNKPSLVYHSQTKEFFKIKSSADLENILSNIEDDVLASILE
FT                   KGNTFLKSYVTKQPSLIQE"
FT   CDS_pept        complement(578281..578844)
FT                   /transl_table=11
FT                   /locus_tag="NMA0604"
FT                   /product="hypothetical protein NMA0604"
FT                   /note="NMA0604, len: 187 aa; unknown, shows very weak
FT                   similarity to the C-termini of SW:CMF3_BACSU (EMBL:Z18629),
FT                   comFC, Bacillus subtilis competence protein (229 aa), fasta
FT                   scores; E(): 0.077, 25.3% identity in 150 aa overlap and
FT                   TR:AAD36651 (EMBL:AE001803), TM1584,Thermotoga maritima
FT                   putative competence protein (202 aa),fasta scores; E():
FT                   0.003, 26.1% identity in 142 aa overlap. Lies within a
FT                   region of unusually low GC content"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0604"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07871"
FT                   /db_xref="GOA:A0A0U1RHL3"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RHL3"
FT                   /protein_id="CAM07871.1"
FT                   /translation="MAIELNGNWTKGFALDHHMQKSILLGYDELGHPHFDSKRSVIGEW
FT                   VYQLKYRNQTQNVSLLVDYILQKFSGLESINLIVPAPFTTERINQPVQLIAKELSDRLN
FT                   IPYSPILRKSSSHTPLKNIEEKSEKLEILNNSITIDNIDLSNKNILVIDDLFDSGATLE
FT                   ISTEKLFSKNARSVIVLAMTKTRG"
FT   CDS_pept        complement(579695..580084)
FT                   /transl_table=11
FT                   /locus_tag="NMA0605"
FT                   /product="hypothetical protein NMA0605"
FT                   /note="NMA0605, len: 129 aa; unknown, similar to ORFs
FT                   present between the carA and carB genes of other Neisseria
FT                   spp. e.g. TR:Q9ZIE8 (EMBL:AF029362) Neisseria gonorrhoeae
FT                   ORF (129 aa), fasta scores; E(): 0, 91.5% identity in 129
FT                   aa overlap and to putative CDS from other bacteria e.g.
FT                   SW:YCJD_ECOLI (EMBL:AE000227), ycjD, Escherichia coli hop
FT                   (117 aa), fasta scores; E(): 1.7e-20, 46.0% identity in 113
FT                   aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0605"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07872"
FT                   /db_xref="InterPro:IPR007569"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RHL4"
FT                   /protein_id="CAM07872.1"
FT                   /translation="MNPHEKLLTTDNPILRQRAKAMRQEMSGAEAKLWQHLRAGRLNGY
FT                   KFRRQQPMGNYIVDFMCVTPKLIVEADGGQHTEQAAYDHARTAYLNSLGFTVLRFWNHE
FT                   ILQQTNDVLTEILLVLQELEKQAAR"
FT   CDS_pept        complement(580081..580260)
FT                   /transl_table=11
FT                   /locus_tag="NMA0606"
FT                   /product="hypothetical protein NMA0606"
FT                   /note="NMA0606, len: 59 aa; unknown"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0606"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07873"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RHL5"
FT                   /protein_id="CAM07873.1"
FT                   /translation="MKSDLDLQALISGRLKNKKQPVQLVFLVFLAKPLITTAAPSSLPW
FT                   ERVRERAANSTTTK"
FT   CDS_pept        complement(580363..580500)
FT                   /transl_table=11
FT                   /locus_tag="NMA0607"
FT                   /product="hypothetical protein NMA0607"
FT                   /note="NMA0607, len: 45 aa; unknown, highly similar to part
FT                   of TR:Q50992 (EMBL:L36381), sucA, Neisseria gonorrhoeae
FT                   putative 2-oxoglutarate dehydrogenase E1 component (partial
FT                   CDS) (582 aa), fasta scores; E(): 8.4e-17, 93.0% identity
FT                   in 43 aa overlap. Up to codon 87 in TR:Q50992 the sequence
FT                   is markedly different from other sucA homologues, including
FT                   sucA from this strain"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0607"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07874"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RHL6"
FT                   /protein_id="CAM07874.1"
FT                   /translation="MKISALDHLVLTVADIDRTIAFYTQVLGMEEVSFGNNRKACILED
FT                   "
FT   CDS_pept        complement(580546..581679)
FT                   /transl_table=11
FT                   /locus_tag="NMA0608"
FT                   /product="carbamoyl phosphate synthase small subunit"
FT                   /EC_number="6.3.5.5"
FT                   /note="NMA0608, carA, carbamoyl phosphate synthase small
FT                   subunit, len: 377 aa; highly similar to many e.g. TR:Q50983
FT                   (EMBL:Z54242), carA, Neisseria gonorrhoeae
FT                   carbamoyl-phosphate synthase small subunit (377 aa), fasta
FT                   scores; E(): 0, 96.8% identity in 377 aa overlap. Contains
FT                   Pfam matches to entry PF00988
FT                   CPSase_sm_chain,Carbamoyl-phosphate synthase small chain,
FT                   CPSase domain and to entry PF00117 GATase, Glutamine
FT                   amidotransferase class-I. Contains PS00442 Glutamine
FT                   amidotransferases class-I active site"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0608"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07875"
FT                   /db_xref="GOA:Q9JVZ6"
FT                   /db_xref="InterPro:IPR002474"
FT                   /db_xref="InterPro:IPR006274"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR035686"
FT                   /db_xref="InterPro:IPR036480"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9JVZ6"
FT                   /protein_id="CAM07875.1"
FT                   /translation="MSTPALLVLADGSVFHGTSIGYEGSTSGEVVFNTSMTGYQEILTD
FT                   PSYCKQIVTLTYPHIGNTGTNAEDEESRSVYAAGLIIRDLPLLHSNFRASESLHDYLVR
FT                   NKTVAIADIDTRRLTTLLREKGAQGGAILTGADATIEKAQELIAAFGSMVGKDLAKEVS
FT                   CTETYEWTEGEWALGKGFVTPDEQPYHVVAYDFGVKTNILRMLASRGCRLTVVPAQTSA
FT                   QDVLALNPDGVFLSNGPGDPEPCTYAIEAVQKLMESGKPIFGICLGHQLISLAIGAKTL
FT                   KMRFSHHGANHPVQDLDSGKVVITSQNHGFAVDADTLPANARITHKSLFDNTLQGIELT
FT                   DKPVFCFQGHPEASPGPQDVGYLFDKFIGNMKAAKRA"
FT   CDS_pept        complement(583916..587029)
FT                   /transl_table=11
FT                   /locus_tag="NMA0609"
FT                   /product="pilus-associated protein"
FT                   /note="NMA0609, pilC1, pilus-associated protein, len: 1037;
FT                   highly similar to many other pilus-associated proteins from
FT                   Neisseris spp. e.g. TR:O05924 (EMBL:Y13020),pilC1 from
FT                   Neisseria meningitidis FAM20 (1038 aa), fasta scores; E():
FT                   0, 78.0% identity in 1043 aa overlap. Contains 2 PS00017
FT                   ATP/GTP-binding site motif A (P-loop)"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0609"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07876"
FT                   /db_xref="InterPro:IPR008707"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RHL7"
FT                   /protein_id="CAM07876.1"
FT                   /translation="MNKTLKRRVFRHTALYAAILMFSHTGGGGGAMAQTRQYAIIMNER
FT                   NQPEVQWNGSYSIKDKDRKREYTHHNHQQGGSSVSFNNSDELVSRQSGTAVFGTATYLP
FT                   PYGKVSGFDAAALKERNNAVDWIHTTHPGLIGYSYDGVVCRSATDCPKLVYKTRFSFDN
FT                   PDLAKTGGGLDKHTEPSRDNSPIYKLKDHPWLGVSFNLGAEGIAKNGKTINKLVSSFNE
FT                   KNSNNNLVYTTEGRDISLGNWQRETTAMAYYLNAKLHLLDKKQIQNITDKTVQLGVLKP
FT                   SIDVRTRNTGTAGILSYWAKWDIKDTGQIPVKLSLTQVKAGRCVNKDNPNKNTKTSSPA
FT                   LTAPALWFGAGQDGKAEMYSASVSTYPDSSSSRIFLQNLKRKTDTSRPGRYSLATLNKS
FT                   DIESREPSFTSRQTVIRLDGGVQQIKLDRNNTEVTGFNGNDGKNDTFGIVSEGSFMPDA
FT                   SEWKKVLLPWTVRAFNYDGRFNTVNKEENNGKPKYSQKYRSRNNGKHERNLGDIVNSPI
FT                   VAVGEYLATSANDGMVHIFKQSGGDKRSYNLKLSYIPGTMPRKDIESKDSTLAKELRAF
FT                   AEKGYVGDRYGVDGGFVLRRITDDQDKQKHFFMFGAMGLGGRGAYALDLTKADDNDPTK
FT                   ASLFDVKDNGNNGNNGNNRVELGYTVGTPQIGKTHNGKYAAFLASGYATKQIDSGENKT
FT                   ALYVYDLESNNGTLIRKIEVTDGKGGLSSPTLVDKDLDGTVDIAYAGDRGGKMYRFDLS
FT                   GNNPNSWTVRTIFQGTKPITSAPAISQLKDKRVVIFGTGSDLSEDDVLSTDEQHIYGIF
FT                   DNDTNTGTAQEGLGKGLLEQKLSEENKTLFLTDYKRSDGSGDKGWVVKLKDGQRVTVKP
FT                   TVVLRTAFVTIHKYTGNDKCGAETAILGINTADGGKLTKKSARPIVPAANSKVAQYSGD
FT                   KKTSSGKSIPIGCMEKDGGTVCPNGYVYDKPVNVRYLDEKKTDGFSTTADGDAGGSGTF
FT                   KEGKKPARNNRCFSGKGVRTLLMNDLDSLDITGPMCGMKRISWREVFY"
FT   CDS_pept        complement(587959..589038)
FT                   /transl_table=11
FT                   /locus_tag="NMA0611"
FT                   /product="hypothetical protein NMA0611"
FT                   /note="NMA0611, len: 375 aa; unknown, similar to many
FT                   hypothetical proteins from both bacteria and eukaryotes
FT                   e.g. SW:MRP_ECOLI (EMBL:U00007), mrp, Escherichia coli
FT                   hypothetical protein (379 aa), fasta scores; E(): 0, 45.2%
FT                   identity in 372 aa overlap. Contains a region similar to
FT                   NMA0076, fasta scores; E(): 1.2e-06, 24.1% identity in 266
FT                   aa overlap and NMA0100, fasta scores; E(): 2.4e-05, 26.3%
FT                   identity in 262 aa overlap. Contains PS00017
FT                   ATP/GTP-binding site motif A (P-loop)"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0611"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07877"
FT                   /db_xref="GOA:A0A0U1RHL8"
FT                   /db_xref="InterPro:IPR019591"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033756"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RHL8"
FT                   /protein_id="CAM07877.1"
FT                   /translation="MNIQNIRTLLDTVAVPNTARTLGGEKAVRSVEQRSDGIHIALHFG
FT                   FPVAHIASETADRIQEILMPLTGDTHIHLSMDTEIGTHKVQPGVTTIKGVKNIIAVASG
FT                   KGGVGKSTTTANLAAAMARMGARVGVLDADLYGPSQPTMLGVDDRKPDQKNQKLIPVES
FT                   SDGIQVMSIGFLVDTDQAVVWRGPMVSQALQQLMFQSEWDEVDYLFIDLPPGTGDIQLT
FT                   LSQRIPVTGSVIVTTPQDIALIDARKAVDMFRKVNIPILGVLENMSVHICTNCGHSEAL
FT                   FGTDGGKDLAARLNVPLLGQLPLSLPVREAMDGGTPAQLFDEHPAIARIYTDAAFQIAL
FT                   GVADKGKDFSSRFPKIVIE"
FT   CDS_pept        589403..589912
FT                   /transl_table=11
FT                   /locus_tag="NMA0612"
FT                   /product="putative periplasmic thioredoxin"
FT                   /note="NMA0612, possible periplasmic thioredoxin, len: 169
FT                   aa; similar to many e.g. shows weak similarity to
FT                   SW:CCMG_PARDE (EMBL:Z71971), ccmG, Paracoccus denitrificans
FT                   periplasmic protein-disulfide oxidoreductase (179 aa),
FT                   fasta scores; E(): 7e-05, 26.5% identity in 136 aa overlap
FT                   and similar to SW:THIX_HAEIN (EMBL:U32791),HI1115,
FT                   Haemophilus influenzae thioredoxin-like protein (167 aa),
FT                   fasta scores; E(): 7.6e-26, 42.4% identity in 170 aa
FT                   overlap. Contains a probable N-terminal signal sequence"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0612"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07878"
FT                   /db_xref="GOA:A0A0U1RHL9"
FT                   /db_xref="InterPro:IPR013740"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RHL9"
FT                   /protein_id="CAM07878.1"
FT                   /translation="MKKKLLSGIKFAVQTALVFLLVSLFLDWIRKPEEPAGAAGRPLTL
FT                   LSGQRLTLGQFSRDKAVLVYFWGSWCGVCRYQSPIIDDLAADGVPVVGVAVRSGSASEV
FT                   AAYMAKRGLGFPTVNDEDGGLARSWRIVATPAVVLVKNGKMVHYTTGISSYWGLRARIF
FT                   QADVFG"
FT   CDS_pept        590256..590696
FT                   /transl_table=11
FT                   /locus_tag="NMA0613"
FT                   /product="putative marR-family transcriptional regulator"
FT                   /note="NMA0613, probable marR-family transcriptional
FT                   regulator, len: 146 aa; shows weak similarity to TR:P94314
FT                   (EMBL:U64802), cinR, Butyrivibrio fibrisolvens
FT                   transcriptional repressor of cinnamoyl ester hydrolase (142
FT                   aa), fasta scores; E(): 0.0013, 30.3% identity in 145 aa
FT                   overlap and SW:HPCR_ECOLI (EMBL:S56952), hpaR,Escherichia
FT                   coli homoprotocatechuate degradative operon repressor (148
FT                   aa), fasta scores; E(): 8.3e-26, 55.7% identity in 131 aa
FT                   overlap. Contains Pfam match to entry PF01047 MarR, MarR
FT                   family and PS01117 Bacterial regulatory proteins, marR
FT                   family signature"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0613"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07879"
FT                   /db_xref="GOA:A0A0U1RHM0"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR012712"
FT                   /db_xref="InterPro:IPR023187"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RHM0"
FT                   /protein_id="CAM07879.1"
FT                   /translation="MPTQSKHASINIGLIQAREALMTQFRPILNQANITDQQWRIIRLL
FT                   AENGTLDFQDLANQACILRPSLTGILTRLEKAGLVVRLKPSNDQRRVFLKLTAEGEKLY
FT                   EEIGEEVDERYDAIEEVLGREKMLLLKDLLAELAKIEDALNS"
FT   CDS_pept        590811..591311
FT                   /transl_table=11
FT                   /locus_tag="NMA0614"
FT                   /product="putative NADH:FMN oxidoreductase"
FT                   /note="NMA0614, probable NADH:FMN oxidoreductase, len: 166
FT                   aa; similar to many NADH:FMN redox coupling protein
FT                   components from multi-component monooxygenases e.g.
FT                   TR:Q57501 (EMBL:Z37980), hpaC, Escherichia coli
FT                   4-hydroxyphenylacetate 3-monooxygenase coupling protein
FT                   (170 aa), fasta scores; E(): 5.7e-24, 43.8% identity in 153
FT                   aa overlap and TR:O87008 (EMBL:U83405), tftC,Burkholderia
FT                   cepacia chlorophenol-4-monooxygenase component 1 (179 aa),
FT                   fasta scores; E(): 3.1e-15, 35.0% identity in 163 aa
FT                   overlap"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0614"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07880"
FT                   /db_xref="GOA:A0A0U1RHM1"
FT                   /db_xref="InterPro:IPR002563"
FT                   /db_xref="InterPro:IPR011982"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RHM1"
FT                   /protein_id="CAM07880.1"
FT                   /translation="MADLQKTFQTSFRDAMASCAAGVHVITTDGAAGRYGITMTAVAPV
FT                   TDEPPTVMLCINRSARIIPILSENGSLCINTLADEHQDVAEHFAGLTGLSPEERFAYHI
FT                   WHRGKTGQLEIEGALAHLHGHIVGKHEIGTHFVFYVRLDEIKNCGCKRPALLYFRRQFR
FT                   FLD"
FT   CDS_pept        591329..592024
FT                   /transl_table=11
FT                   /locus_tag="NMA0615"
FT                   /product="putative sugar-phosphate nucleotidyl transferase"
FT                   /note="NMA0615, possible sugar-phosphate nucleotidyl
FT                   transferase, len: 231 aa; Similar to the N-terminal regions
FT                   of many e.g. TR:O08245 (EMBL:Y10907), mtmD,Streptomyces
FT                   argillaceus TDP-D-glucose synthase (355 aa),fasta scores;
FT                   E(): 4.2e-11, 30.7% identity in 241 aa overlap and
FT                   SW:RFBA_XANCA (EMBL:L2394), rfbA, Xanthomonas campestris
FT                   glucose-1-phosphate thymidylyltransferase involved in
FT                   lipopolysaccharide biosynthesis (295 aa),fasta scores; E():
FT                   9.1e-10, 31.7% identity in 240 aa overlap. Of a similar
FT                   length to TR:AAD22456 (EMBL:AF116284) Pseudomonas
FT                   aeruginosa hypothetical protein located downstream of a
FT                   putative virulence factor (224 aa), fasta scores; E(): 0,
FT                   54.0% identity in 226 aa overlap. Similar to NMA0205, fasta
FT                   scores; E(): 7.2e-09,27.9% identity in 247 aa overlap and
FT                   NMA0188, fasta scores; E(): 7.2e-09, 27.9% identity in 247
FT                   aa overlap. Contains Pfam match to entry PF00483
FT                   NTP_transferase,Nucleotidyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0615"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07881"
FT                   /db_xref="GOA:A0A0U1RHM2"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RHM2"
FT                   /protein_id="CAM07881.1"
FT                   /translation="MKAMILAAGRGERMHPLTDTTPKPLLDVAGKPLIGWHLCRLKQAG
FT                   FTEIVINHAWLGRQIEDALGDGSAYGVNIAYSPEPAGGLETAGGIARALPLLGGQPFLV
FT                   VNGDVLTDIDFTAAFQTASSLPEHISAHLWLVENPPHNPDGDFSLLPDGSVRPEVNGGN
FT                   GLTFSGVGIYRPEMFDGIEAGSVAKLAPVLRGEMRQNRVSGQKHTGLWLDVGTVCRLKE
FT                   AQALAGAWK"
FT   CDS_pept        complement(592270..592701)
FT                   /transl_table=11
FT                   /locus_tag="NMA0616"
FT                   /product="putative integral membrane protein"
FT                   /note="NMA0616, probable integral membrane protein, len:
FT                   143 aa; similar to bacterial hypothetical proteins e.g.
FT                   SW:YCB6_PSEDE (EMBL:M62866) Pseudomonas denitrificans
FT                   hypothetical protein (141 aa), fasta scores; E():
FT                   1.4e-30,55.4% identity in 139 aa overlap. Contains Pfam
FT                   match to entry PF00892 DUF6, Integral membrane protein.
FT                   Contains hydrophobic, probable membrane-spanning regions"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0616"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07882"
FT                   /db_xref="GOA:A0A0U1RHM3"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RHM3"
FT                   /protein_id="CAM07882.1"
FT                   /translation="MGSNAWLFWALASAGFASLTAIFAKMGLQGIDSDFATFIRTLVIL
FT                   AALLLFLTYTGKWQGVNGFTGKNWTFLILSGLATGASWLAYFKALQLGNASQVAPVDKF
FT                   SLVLVALMAVVFLDERPNTQEWIGLGLVTAGVLVLALKR"
FT   CDS_pept        592876..594552
FT                   /transl_table=11
FT                   /locus_tag="NMA0617"
FT                   /product="putative formate--tetrahydrofolate ligase"
FT                   /EC_number="6.3.4.3"
FT                   /note="NMA0617, fhs, probable formate--tetrahydrofolate
FT                   ligase, len: 558 aa; similar to many e.g. SW:FTHS_CLOCY
FT                   (EMBL:L12465), fhs, Clostridium cylindrosporum
FT                   formate--tetrahydrofolate ligase (EC 6.3.4.3) (556
FT                   aa),fasta scores; E(): 0, 62.7% identity in 555 aa overlap.
FT                   Contains Pfam match to entry PF01268
FT                   FTHFS,Formate--tetrahydrofolate ligase, PS00721
FT                   Formate--tetrahydrofolate ligase signature 1 and PS00722
FT                   Formate--tetrahydrofolate ligase signature 2"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0617"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07883"
FT                   /db_xref="GOA:Q9JVY8"
FT                   /db_xref="InterPro:IPR000559"
FT                   /db_xref="InterPro:IPR020628"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9JVY8"
FT                   /protein_id="CAM07883.1"
FT                   /translation="MSFKTDAEIAQSSTMRPIGEIAAKLGLNVDNIEPYGHYKAKINPA
FT                   EAFKLPQKQGRLILVTAINPTPAGEGKTTVTIGLADALRHIGKDSVIALREPSLGPVFG
FT                   VKGGAAGGGYAQVLPMEDINLHFTGDFHAIGAANNLLAAMLDNHIYQGNELNIDPKRVL
FT                   WRRVVDMNDRQLRNIIDGMGKPVDGVMRPDGFDITVASEVMAVFCLAKDISDLKERLGN
FT                   ILVAYAKDGSPVYAKDLKANGAMAALLKDAIKPNLVQTIEGTPAFVHGGPFANIAHGCN
FT                   SVTATRLAKHLADYAVTEAGFGADLGAEKFCDIKCRLAGLKPDAAVVVATVRALKYNGG
FT                   VERANLGEENLDALEKGLPNLLKHISNLKNVFGLPVVVALNRFVSDSDAELAMIEKACA
FT                   EHGVEVSLTEVWGKGGAGGADLARKVVNAIESQTNNFGFAYDVELGIKDKIRAIAQKVY
FT                   GAEDVDFSAEASAEIASLEKLGLDKMPICMAKTQYSLSDNAKLLGCPEDFRIAVRGITV
FT                   SAGAGFIVALCGNMMKMPGLPKVPAAEKIDVDAEGVIHGLF"
FT   CDS_pept        594667..595758
FT                   /transl_table=11
FT                   /locus_tag="NMA0618"
FT                   /product="hypothetical protein NMA0618"
FT                   /note="NMA0618, hypothetical protein, len: 363 aa, shows
FT                   very weak similarity to parts of GTP-binding proteins e.g.
FT                   SW:OBG_BACSU (EMBL:M24537), obg, Bacillus subtilis
FT                   essential GTP-binding protein (428 aa), blastp scores;
FT                   Expect = 3.8e-09 and TR:O30861 (EMBL:AF019407),
FT                   cgtA,Caulobacter crescentus GTP-binding protein (354
FT                   aa),blastp scores; Expect = 1.1e-09. Highly similar to
FT                   other hypothetical proteins e.g. SW:YCHF_HAEIN
FT                   (EMBL:U32723),HI0393, Haemophilus influenzae probable
FT                   GTP-binding protein (362 aa), fasta scores; E(): 0, 69.5%
FT                   identity in 361 aa overlap. Contains PS00017
FT                   ATP/GTP-binding site motif A (P-loop)"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0618"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07884"
FT                   /db_xref="GOA:A0A0U1RHM4"
FT                   /db_xref="InterPro:IPR004396"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR012676"
FT                   /db_xref="InterPro:IPR013029"
FT                   /db_xref="InterPro:IPR023192"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031167"
FT                   /db_xref="InterPro:IPR041706"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RHM4"
FT                   /protein_id="CAM07884.1"
FT                   /translation="MSLKCGIVGLPNVGKSTLFNALTQSGIEAANYPFCTIEPNVGIVE
FT                   VPDPRMAELAKIVNPQKMQPAIVEFVDIAGLVAGASKGEGLGNQFLANIRETDAIVNVV
FT                   RCFDDDNIVHVAGRVDPIADIETIGTELALADLASVEKAIVREEKRARSGDKDAQKLVD
FT                   LCKKLLPHLDEGKPVRSFGLDAEERAMLKPLFLLTAKPAMYVGNVAEDGFENNPHLDRL
FT                   KELAAKENAPVVAVCAAMESEIAELEDDEKAEFLAEMGLEEPGLNRLIRAGYDLLGLQT
FT                   YFTAGVKEVRAWTIHKGDTAPQAAGVIHTDFERGFIRAQVISYDDFVSLGGEAKAKEAG
FT                   KMRVEGKEYVVQDGDVMHFLFNV"
FT   CDS_pept        596020..597888
FT                   /transl_table=11
FT                   /locus_tag="NMA0619"
FT                   /product="putative lipopolysaccharide modification
FT                   acyltransferase"
FT                   /note="NMA0619, possible lipopolysaccharide modification
FT                   acyltransferase, len: 622 aa; similar to TR:P74874
FT                   (EMBL:U65941), oafA, Salmonella typhimurium integral
FT                   membrane protein responsible for acetylation of the
FT                   O-antigen (609 aa), fasta scores; E(): 0, 28.0% identity in
FT                   624 aa overlap and to TR:P72134 (EMBL:U50396),
FT                   wbpC,Pseudomonas aeruginosa CDS involved in O-antigen (629
FT                   aa),fasta scores; E(): 0, 33.8% identity in 619 aa overlap.
FT                   Also similar to several CDS from Caenorhabditis elegans
FT                   e.g. TR:O02306 (EMBL:Z81147), T09E11.4, Caenorhabditis
FT                   elegans hypothetical protein (650 aa), fasta scores; E():
FT                   1.3e-24, 29.9% identity in 344 aa overlap. Contains
FT                   hydrophobic, probable membrane-spanning regions"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0619"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07885"
FT                   /db_xref="GOA:A0A0U1RHM5"
FT                   /db_xref="InterPro:IPR002656"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RHM5"
FT                   /protein_id="CAM07885.1"
FT                   /translation="MSQALPYRPDIDTLRAAAVLSVIVFHIEKNWLPGGFLGVDIFFVI
FT                   SGFLMTTILHREMSGGGRFSLKAFYIRRIKRILPAFFAVLAATLAGGFFLFTKDDFFLL
FT                   WKSALTALGFASNLYFARGKDYFDPAQEEKPLLHIWSLSVEEQFYFVFPILLLLVARKS
FT                   LRVQFGFLAALCALSLAASFIPSALDKYYLPHLRACELLIGSLTAVWMRCRQPAVGRRC
FT                   AAVGALFAVCILSTCLFSYSEQTAYFPGPAALIPCLAVAALIYFNHYEHPLKKFFQSKI
FT                   TVAAGLISYSLYLWHWPILAFMRYIGPDNLPPYSPAAAVVLILLLSLFSYHCIEKPFKK
FT                   WQGSFAQSVLWIYALPMLILGAGSFFAMRLPFMAQYDRLGLTRSNTSCHNNTGKQCLWG
FT                   DTEKQPELLVLGDSHADHYKTFFDAVGKKEKWAATMVSADACAYVEGYASRVFQNWAAC
FT                   RAVYRYAEEHLPRYSKVVLAMRWGSQMPENSRSLAYDAGFFQKFDRMLHKLSSEKQAVY
FT                   LMADNLASSYNVQRAYILSSRIPGYRQALRPDDESTLKANARIRELAAKYPNVYIIDAA
FT                   AYIPADFQIGGLPVYSDTDHINPYGGTELAKRFSEKQRFLNTRHNH"
FT   CDS_pept        597950..599245
FT                   /transl_table=11
FT                   /locus_tag="NMA0620"
FT                   /product="putative tyrosyl-tRNA synthetase"
FT                   /EC_number="6.1.1.1"
FT                   /note="NMA0620, tyrS, probable tyrosyl-tRNA synthetase,len:
FT                   431 aa; similar to many e.g. SW:SYY_ECOLI (EMBL:J01719),
FT                   tyrS, Escherichia coli tyrosyl-tRNA synthetase (EC 6.1.1.1)
FT                   (423 aa), fasta scores; E(): 0,63.1% identity in 431 aa
FT                   overlap. Contains Pfam match to entry PF00579 tRNA-synt_1b,
FT                   tRNA synthetases class I (W and Y) and PS00178
FT                   Aminoacyl-transfer RNA synthetases class-I signature"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0620"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07886"
FT                   /db_xref="GOA:Q9JVY6"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002305"
FT                   /db_xref="InterPro:IPR002307"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR024088"
FT                   /db_xref="InterPro:IPR024107"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9JVY6"
FT                   /protein_id="CAM07886.1"
FT                   /translation="MSVIQDLQSRGLIAQTTDIEALDALLNEQKIALYCGFDPTADSLH
FT                   IGHLLPVLALRRFQQAGHTPIALVGGATGMIGDPSFKAAERSLNSAETVAGWVESIRNQ
FT                   LTPFLSFEGGNAAIMANNADWFGKMNCLDFLRDIGKHFSVNAMLNKESVKQRIDRDGAG
FT                   ISFTEFAYSLLQGYDFAELNKRHGAVLEIGGSDQWGNITAGIDLTRRLNQKQVFGLTLP
FT                   LVTKSDGTKFGKTEGGAVWLNAKKTSPYQFYQFWLKVADADVYKFLKYFTFLSIEEIDA
FT                   IEAKDKASGTKPEAQRILAEEMTRLIHGEAALQAAQRISESLFAEDQSSLTESDFEQLA
FT                   LDGLPAFEVSDGINVVEALVKTGLASSNKEARGFVNSKAVLLNGKPAEANNPNHAAERP
FT                   DDACLLTDEHKRFGKYTILRRGKRNHALLVWK"
FT   CDS_pept        599508..600464
FT                   /transl_table=11
FT                   /locus_tag="NMA0621"
FT                   /product="putative riboflavin kinase/FMN
FT                   adenylyltransferase"
FT                   /EC_number="2.7.1.26"
FT                   /EC_number="2.7.7.2"
FT                   /note="NMA0621, ribF, probable riboflavin kinase/FMN
FT                   adenylyltransferase, len: 318 aa; similar to many e.g.
FT                   SW:RIBF_CORAM (EMBL:D37967), ribF, Corynebacterium
FT                   ammoniagenes riboflavin biosynthesis protein (EC 2.7.1.26)
FT                   (EC 2.7.7.2) (338 aa), fasta scores; E(): 6e-18, 32.4%
FT                   identity in 321 aa overlap and SW:RIBF_ECOLI (EMBL:M10428),
FT                   ribF, Escherichia coli riboflavin biosynthesis protein (313
FT                   aa), fasta scores; E(): 0, 48.6% identity in 313 aa
FT                   overlap"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0621"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07887"
FT                   /db_xref="GOA:A0A0U1RHM6"
FT                   /db_xref="InterPro:IPR002606"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015864"
FT                   /db_xref="InterPro:IPR015865"
FT                   /db_xref="InterPro:IPR023465"
FT                   /db_xref="InterPro:IPR023468"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RHM6"
FT                   /protein_id="CAM07887.1"
FT                   /translation="MTACFTTYPNITMRIRLGRHNSPDFPHGAAVTIGNFDGVHLGHKH
FT                   ILQKLRLEADTRGLPVVAVVFEPQPKEFFALRTGRMPPCRISPLRTKLELLEGTGCVDA
FT                   VWVLCFDRNFSEISAQAFIDRLLRQTLNTRYLLVGDDFRFGAGREGCFELLAQQPDMQT
FT                   ERTPSVIVEDIRTSSTAVRQALSDGNLAYAKKLLGHDYVLSGRVVHGRKLGRTLNAPTA
FT                   NIRLPRHRYALGGVFVVEADGAFGTRRGVASFGFNPTVDSGCSQKLEVHLFDFQGDLYG
FT                   QRLNVRFLHKLRDEEKFDGMAELKRQIAADMEAAKCW"
FT   CDS_pept        600606..603395
FT                   /transl_table=11
FT                   /locus_tag="NMA0622"
FT                   /product="putative isoleucyl-tRNA synthetase"
FT                   /EC_number="6.1.1.5"
FT                   /note="NMA0622, ileS, probable isoleucyl-tRNA
FT                   synthetase,len: 929 aa; similar to many e.g. SW:SYI_ECOLI
FT                   (EMBL:D10483), ileS, Escherichia coli isoleucyl-tRNA
FT                   synthetase (EC 6.1.1.5) (937 aa), fasta scores; E():
FT                   0,53.1% identity in 948 aa overlap. Contains Pfam match to
FT                   entry PF00133 tRNA-synt_1, tRNA synthetases class I (I, L,M
FT                   and V) and PS00178 Aminoacyl-transfer RNA synthetases
FT                   class-I signature"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0622"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07888"
FT                   /db_xref="GOA:Q9JVY4"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002301"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR010663"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR023585"
FT                   /db_xref="InterPro:IPR033708"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9JVY4"
FT                   /protein_id="CAM07888.1"
FT                   /translation="MTDYSKTVNLLESPFPMRGNLAKREPAWLKSWYEQKRYQKLREIA
FT                   KGRPKFILHDGPPYANGDIHIGHAVNKILKDIIIRSKTQAGFDAPYVPGWDCHGLPIEV
FT                   MVEKLHGKDMPKARFRELCREYAAEQIARQKKDFIRLGVLGDWDNPYLTMDFKTEADTV
FT                   RMLGEIYKSGYLYRGAKPVQFCLDCGSSLAEAEVEYKDKVSPAIDVGYPFKDTAALATA
FT                   FGLAGIEGKAFAVIWTTTPWTLPASQAVSAGADVVYQLIDTPTGKLVLAKDLAEDALKR
FT                   YGFSDGIAILAETTGDKLENLHMNHPFLERDIPMLNGEHVTTDAGTGLVHTAPAHGLED
FT                   YAVCNKYGIELYNPVNAEGKYIGETPRVAGMRVWEANSVILQWLEETGNLLASSKIEHS
FT                   YAHCWRHKTPLIYRATGQWFVGMDKAGADGKTLRDKAIKAVDDTEFFPSWGRARLEAMI
FT                   EGRPDWVVSRQRYWGTPMTFFVHKETGELHPNSAELLEKVAQRIEEKGIEAWFSLDKGE
FT                   LLSAEDCEHYDKLSDTMDVWFDSGSTHYSVLKQREELDWPADLYLEGSDQHRGWFQSSM
FT                   LTGCASSMGRAPYKQLLTHGFVVDQNGRKMSKSIGNVVAPQEVYNEFGADILRLWAAST
FT                   DYSGELAISKEILKRVTESYRRIRNTLSFLFANLSDFNPIEDAVQQADMVEIDRYALVL
FT                   ARRLQERVAGDFYPRYAFHFAVKEMVSFCSEDLGAFYLDILKDRLYTTKADSRARRSAQ
FT                   TALYHITRSLVLLIAPILCFTGEEAWDIIGGGAEDSVLFHTWHEFPTINEKAEAELVKK
FT                   WTAIREAREAVTAAIEPLRADKTVGSSLQAEAEITAPEEMAGYLNALGEELRFALLVSK
FT                   AEVKVGSELAVAAKASDGEKCERCWHYTRDVGAVAGHETVCKRCAENVGGEGETRHYA"
FT   CDS_pept        604582..605079
FT                   /transl_table=11
FT                   /locus_tag="NMA0623"
FT                   /product="putative lipoprotein signal peptidase"
FT                   /EC_number="3.4.23.36"
FT                   /note="NMA0623, lsp, probable lipoprotein signal peptidase,
FT                   len: 165 aa; similar to many e.g. SW:LSPA_PSEFL
FT                   (EMBL:M35366), lspA, Pseudomonas fluorescens lipoprotein
FT                   signal peptidase (EC 3.4.23.36) (170 aa), fasta scores;
FT                   E(): 4.9e-26, 49.4% identity in 156 aa overlap. Contains
FT                   Pfam match to entry PF01252 Peptidase_A8, Signal
FT                   peptidase(SPase) II and PS00855 Signal peptidases II
FT                   signature. Contains hydrophobic, probable membrane-spanning
FT                   regions"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0623"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07889"
FT                   /db_xref="GOA:P65264"
FT                   /db_xref="InterPro:IPR001872"
FT                   /db_xref="UniProtKB/Swiss-Prot:P65264"
FT                   /protein_id="CAM07889.1"
FT                   /translation="MSSSVSSKTRYWVLALAAIVLDQWSKWAVLSSFQYRERVNVIPSF
FT                   FDLTLVYNPGAAFSFLADQGGWQKYFFLVLAVAVSAYLVRAILRDEFATLGKTGAAMII
FT                   GGALGNVIDRLIHGHVVDFLLFYWQNWFYPAFNIADSFICVGAVLAVLDNIVHRKTQEE
FT                   KY"
FT   CDS_pept        605108..606076
FT                   /transl_table=11
FT                   /locus_tag="NMA0624"
FT                   /product="lytB protein"
FT                   /note="NMA0624, lytB, len: 322 aa; highly similar to
FT                   proteins involved in antibiotic resistance e.g.
FT                   SW:LYTB_ECOLI (EMBL:X54945), lytB, Escherichia coli gene
FT                   involved in penicillin tolerance (316 aa), fasta scores;
FT                   E(): 0, 62.5% identity in 307 aa overlap and TR:Q9ZFL0
FT                   (EMBL:AF098521), lytB, Burkholderia pseudomallei gene
FT                   involved polymyxin B resistance (313 aa), fasta scores;
FT                   E(): 0, 53.9% identity in 304 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0624"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07890"
FT                   /db_xref="GOA:P65191"
FT                   /db_xref="InterPro:IPR003451"
FT                   /db_xref="UniProtKB/Swiss-Prot:P65191"
FT                   /protein_id="CAM07890.1"
FT                   /translation="MNEKTIILANPRGFCAGVDRAISIVERALEEFGAPIYVRHEVVHN
FT                   KFVVDNLREKGAVFIEDLAEVPPGATLVYSAHGVSKAVRQEAAERGFRVFDATCPLVTK
FT                   VHKEVARLDAQDCEIIMIGHKGHVEVEGTMGQLAPGKMLLVETVGDVAKLEVRNPDKLA
FT                   YVSQTTLSVDETKDIIAALNARFPNIRNPHKEDICYATTNRQTAVKELAEQCDIVIVVG
FT                   SPNSSNSNRLREVAASRGIDAYMVDNAGYLQRAWFEGKNKVGVTAGASAPEVLVREVLA
FT                   TIRGWGHETVREGEGAEESIVFVLPKELRREGETKPDLCKR"
FT   CDS_pept        complement(606164..606643)
FT                   /transl_table=11
FT                   /locus_tag="NMA0625"
FT                   /product="putative phosphatase"
FT                   /note="NMA0625, possible phosphatase, len: 159 aa; shows
FT                   weak similarity to phosphoglycolate phosphatases e.g.
FT                   SW:GPHC_ALCEU (EMBL:M68904), cbbzC, Alcaligenes eutrophus
FT                   chromosomal phosphoglycolate phosphatase (231 aa), fasta
FT                   scores; E(): 6.5e-08, 30.2% identity in 172 aa overlap and
FT                   SW:GPH_ECOLI (EMBL:Z19601), gph, Escherichia coli
FT                   phosphoglycolate phosphatase (252 aa), fasta scores; E():
FT                   4.2e-05, 23.1% identity in 173 aa overlap. The N-terminus
FT                   may have been removed by insertion of the neighbouring IS
FT                   element as this CDS appears to be shorter"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0625"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07891"
FT                   /db_xref="GOA:A0A0U1RHM7"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RHM7"
FT                   /protein_id="CAM07891.1"
FT                   /translation="MPSETAIADITRTYSAHYLNPNNRNMTLFPDALPCLDKLKAQGYW
FT                   LAVATGKGRAGLDNAISQTATGGYWLATACAGEYPSKPSPEMVFGICGELGLDPKEALV
FT                   VGDTAHDLHMAANAGAAAVGVATGAHSREQLLSAPHLAVLDGLSELPGFLAQHYA"
FT   CDS_pept        complement(606828..607611)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="NMA0626"
FT                   /product="putative transposase (pseudogene)"
FT                   /note="NMA0626, pseudogene, probable transposase, len: 784
FT                   bp; highly similar to SW:TRA6_NEIME (EMBL:Z11857) Neisseria
FT                   meningitidis B15 transposase for insertion sequence element
FT                   IS1106 (ORF 1) (288 aa), fasta scores; E(): 0, 93.9%
FT                   identity in 230 aa overlap. The N-terminus is missing and a
FT                   frameshift occurs 31 codons from the start of the remaining
FT                   CDS"
FT   CDS_pept        complement(607686..607973)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="NMA0627"
FT                   /product="putative transposase (pseudogene)"
FT                   /note="NMA0627, pseudogene, probable transposase, len: 288
FT                   bp; highly similar to TR:CAB44967 (EMBL:AJ24284) Neisseria
FT                   meningitidis strain Z2491 putative transposase for IS1106A3
FT                   (335 aa), fasta scores; E(): 0, 95.8% identity in 96 aa
FT                   overlap"
FT   CDS_pept        complement(609568..609894)
FT                   /transl_table=11
FT                   /locus_tag="NMA0629"
FT                   /product="hypothetical protein NMA0629"
FT                   /note="NMA0629, len: 108 aa; unknown"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0629"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07894"
FT                   /db_xref="GOA:A0A0U1RHM8"
FT                   /db_xref="InterPro:IPR019199"
FT                   /db_xref="InterPro:IPR021127"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RHM8"
FT                   /protein_id="CAM07894.1"
FT                   /translation="MSEAKFMRIIVFFDLPVITAAKRKAANQFRQFLLKDGYQMLQLSV
FT                   YSRIVKGRDSLQKHHNRLCANLPQEGSIRCLEITEKQYAAMKLLLGELKTQEKKVNSDQ
FT                   LLLF"
FT   CDS_pept        complement(609887..610801)
FT                   /transl_table=11
FT                   /locus_tag="NMA0630"
FT                   /product="hypothetical protein NMA0630"
FT                   /note="NMA0630, len: 304 aa; unknown, shows weak similarity
FT                   to TR:BAA80229 (EMBL:AP000061), APE1240,Aeropyrum pernix
FT                   hypothetical protein (340 aa), fasta scores; E(): 0.00016,
FT                   27.1% identity in 266 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0630"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07895"
FT                   /db_xref="GOA:A0A0U1RHM9"
FT                   /db_xref="InterPro:IPR002729"
FT                   /db_xref="InterPro:IPR019855"
FT                   /db_xref="InterPro:IPR042206"
FT                   /db_xref="InterPro:IPR042211"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RHM9"
FT                   /protein_id="CAM07895.1"
FT                   /translation="MTWRSLLIQNGGKLSLQRRQLLIQQNGESHTVPLEDIAVIIIENR
FT                   ETLITAPLLSALAEHGATLLTCDEQFLPCGQWLPYAQYHRQLKILKLQLNISEPLKKQL
FT                   WQHIVRQKILNQAFVADETGNDLAAKRLRTLASEVRSGDTGNREAQAAALYFQALFGEK
FT                   FTRNDNNAVNAALNYTYAVLRAAVARALTLYGWLPALGLFHRSELNPFNLADDFIEPLR
FT                   PLADLTVIHLYEQGRLKTELTLGIKQHLIKILYYQTSIERQHFSTLAAIDKMISSFQAG
FT                   VTDKNAKQLKLPEILPLKEYQYE"
FT   CDS_pept        complement(610868..614116)
FT                   /transl_table=11
FT                   /locus_tag="NMA0631"
FT                   /product="hypothetical protein NMA0631"
FT                   /note="NMA0631, len: 1082 aa; unknown"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0631"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07896"
FT                   /db_xref="GOA:A1IQ68"
FT                   /db_xref="InterPro:IPR003615"
FT                   /db_xref="InterPro:IPR028629"
FT                   /db_xref="InterPro:IPR033114"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR041383"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1IQ68"
FT                   /protein_id="CAM07896.1"
FT                   /translation="MAAFKPNPINYILGLDIGIASVGWAMVEIDEDENPICLIDLGVRV
FT                   FERAEVPKTGDSLAMARRLARSVRRLTRRRAHRLLRARRLLKREGVLQAADFDENGLIK
FT                   SLPNTPWQLRAAALDRKLTPLEWSAVLLHLIKHRGYLSQRKNEGETADKELGALLKGVA
FT                   DNAHALQTGDFRTPAELALNKFEKESGHIRNQRGDYSHTFSRKDLQAELILLFEKQKEF
FT                   GNPHVSGGLKEGIETLLMTQRPALSGDAVQKMLGHCTFEPAEPKAAKNTYTAERFIWLT
FT                   KLNNLRILEQGSERPLTDTERATLMDEPYRKSKLTYAQARKLLGLEDTAFFKGLRYGKD
FT                   NAEASTLMEMKAYHAISRALEKEGLKDKKSPLNLSPELQDEIGTAFSLFKTDEDITGRL
FT                   KDRIQPEILEALLKHISFDKFVQISLKALRRIVPLMEQGKRYDEACAEIYGDHYGKKNT
FT                   EEKIYLPPIPADEIRNPVVLRALSQARKVINGVVRRYGSPARIHIETAREVGKSFKDRK
FT                   EIEKRQEENRKDREKAAAKFREYFPNFVGEPKSKDILKLRLYEQQHGKCLYSGKEINLG
FT                   RLNEKGYVEIDHALPFSRTWDDSFNNKVLVLGSENQNKGNQTPYEYFNGKDNSREWQEF
FT                   KARVETSRFPRSKKQRILLQKFDEDGFKERNLNDTRYVNRFLCQFVADRMRLTGKGKKR
FT                   VFASNGQITNLLRGFWGLRKVRAENDRHHALDAVVVACSTVAMQQKITRFVRYKEMNAF
FT                   DGKTIDKETGEVLHQKTHFPQPWEFFAQEVMIRVFGKPDGKPEFEEADTPEKLRTLLAE
FT                   KLSSRPEAVHEYVTPLFVSRAPNRKMSGQGHMETVKSAKRLDEGVSVLRVPLTQLKLKD
FT                   LEKMVNREREPKLYEALKARLEAHKDDPAKAFAEPFYKYDKAGNRTQQVKAVRVEQVQK
FT                   TGVWVRNHNGIADNATMVRVDVFEKGDKYYLVPIYSWQVAKGILPDRAVVQGKDEEDWQ
FT                   LIDDSFNFKFSLHPNDLVEVITKKARMFGYFASCHRGTGNINIRIHDLDHKIGKNGILE
FT                   GIGVKTALSFQKYQIDELGKEIRPCRLKKRPPVR"
FT   CDS_pept        complement(614394..617828)
FT                   /transl_table=11
FT                   /locus_tag="NMA0632"
FT                   /product="putative DNA polymerase III, alpha subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="NMA0632, dnaE, probable DNA polymerase III, alpha
FT                   subunit, len: 1144 aa; similar to many e.g. SW:DP3A_VIBCH
FT                   (EMBL:U30472), dnaE, Vibrio cholerae DNA polymerase
FT                   III,alpha subunit (EC 2.7.7.7) (1159 aa), fasta scores;
FT                   E(): 0, 46.2% identity in 1170 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0632"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07897"
FT                   /db_xref="GOA:Q9JVX8"
FT                   /db_xref="InterPro:IPR003141"
FT                   /db_xref="InterPro:IPR004013"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR004805"
FT                   /db_xref="InterPro:IPR011708"
FT                   /db_xref="InterPro:IPR016195"
FT                   /db_xref="InterPro:IPR029460"
FT                   /db_xref="InterPro:IPR040982"
FT                   /db_xref="InterPro:IPR041931"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9JVX8"
FT                   /protein_id="CAM07897.1"
FT                   /translation="MTEPTYIPLRLHTEFSITDGMVRIKKLIAKAQEYGLPALGISDLM
FT                   NEFGLVKFYKACRSAGIKPIGAADVRIGNPDAPDKPFRAMLIIRNDAGYLRLSELLTAA
FT                   YVGKDRNVHHAELNPEWLENGDNSGLICLSGAHYGEVGVNLLNGNEDAARAAALKYAAW
FT                   FPDAFYLELQRLPERPEWEACVSGSVKLAEELGLPVVATHPTQFMSRDDFNAHEARVCI
FT                   AGGWVLTDKKRPRDFTPSQFFIPPETMAERFSDLPEALENTVEIAKRCNLHITLGKNFL
FT                   PLFPTPDGLSLDDYLVKLSNEGLQERMVQLYPDEAERAAKMPEYQERLDFELNIIIQMK
FT                   FPGYFLIVQDFINWAKTHGCPVGPGRGSGAGSLVAYSLKITDLDPLKYALLFERFLNPE
FT                   RVSMPDFDVDFCQANRGRVIEYVREKYGAEAVSQIVTFGTMSSKAVIRDVGRVLELPFT
FT                   LCDKLSKLIPLEANKPLGLDDAMKAEPQIQELIEAEEADELITLAKKLEDLTRGLGMHA
FT                   GGVLIAPGKISDYSPVYQADESASPVSMYDKGDVEDVGLVKFDFLGLRNLTIIEMAQNN
FT                   IKNTTGDIVDVGTIPLDDQTAYQIFRDANTTAVFQFESTGMKKMLKTAHTTKFEELIAF
FT                   VSLYRPGPMDNIPDFVARMKGQEFQYIHPLLEGILAPTYGIMVYQEQVMQAAQIIGGYS
FT                   LGGADLLRRAMGKKKPEEMVKHREIFAEGAAKQGISREKSDEIFNYMEKFAGYGFNKSH
FT                   AAAYALISYQTAWLKAHYPAEFMAATMSSELDNTDQLKHFYDDCRANGIEFLPPDINES
FT                   DYRFTPYPDMKIRYALGAIKGTGEAAVESITSARQSGGKFTGLLDFCERVGKEHMNRRT
FT                   LEALIRGGAFDSIEPNRAMLLANIDLAMNNADQKAANANQGGLFDMMEDAIEPVRLIDA
FT                   PMWSESEKLAEEKTVIGFYLSGHPFGPYAQEVRQIAPQKLSKLKPQDSVRLAGFVTAVR
FT                   TMMGKRGKIAFVSLEDLSGQVEIMVGGQTLENCADCLKADQVLIIESKVSRDDYGGGDG
FT                   LRILANQVMTLQTARERYARSLSLALAPHHDIGELVQLLAAHQLPDTPRIPLQLSYANE
FT                   KASGRLQVPPKWTVTPSSALFGELETLLGSRSVRVNW"
FT   CDS_pept        618360..618593
FT                   /transl_table=11
FT                   /locus_tag="NMA0633"
FT                   /product="hypothetical protein NMA0633"
FT                   /note="NMA0633, len: 77 aa; unknown, similar to
FT                   SW:YBCJ_ECOLI (EMBL:D10588), ybcJ, Escherichia coli
FT                   hypothetical protein (70 aa), fasta scores; E():
FT                   7.7e-07,47.8% identity in 67 aa overlap and to the
FT                   N-terminal half of TR:Q48692 (EMBL:X89367) Lactococcus
FT                   lactis hypothetical protein (120 aa), fasta scores; E():
FT                   5.4e-05, 43.9% identity in 66 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0633"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07898"
FT                   /db_xref="GOA:A0A0U1RHN0"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RHN0"
FT                   /protein_id="CAM07898.1"
FT                   /translation="MEATVYLEDNEYIALCDLLKLAGLAESGGQAKAFIAEGLVLRNGE
FT                   TETRKTAKIRSGEVIEFDGARLEIADGYDPEA"
FT   CDS_pept        618565..618780
FT                   /transl_table=11
FT                   /locus_tag="NMA0634"
FT                   /product="hypothetical protein NMA0634"
FT                   /note="NMA0634, len: 71 aa; unknown"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0634"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07899"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RHN1"
FT                   /protein_id="CAM07899.1"
FT                   /translation="MPMDTTLKHKAEALLGEPLLDEPVRPESWECCGSDCGDACIQTIY
FT                   WADKARYDAQRRKLKEAGWAEDENAV"
FT   CDS_pept        619076..619912
FT                   /transl_table=11
FT                   /locus_tag="NMA0635"
FT                   /product="hypothetical protein NMA0635"
FT                   /note="NMA0635, len: 278 aa; unknown, similar to
FT                   hypothetical proteins e.g. SW:YCIV_HAEIN
FT                   (EMBL:U32820),HI1400, Haemophilus influenzae hypothetical
FT                   protein (274 aa), fasta scores; E(): 0, 45.8% identity in
FT                   275 aa overlap and TR:Q9ZQI9 (EMBL:AC006218),
FT                   F17L24.11,Arabidopsis thaliana hypothetical protein (312
FT                   aa), fasta scores; E(): 4.5e-20, 33.0% identity in 227 aa
FT                   overlap"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0635"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07900"
FT                   /db_xref="GOA:A0A0U1RHN2"
FT                   /db_xref="InterPro:IPR003141"
FT                   /db_xref="InterPro:IPR004013"
FT                   /db_xref="InterPro:IPR016195"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RHN2"
FT                   /protein_id="CAM07900.1"
FT                   /translation="MIDLHCHSTVSDGMLSPAEVVRLAHQNGCTLLALTDHDHTGGIAE
FT                   ARAEADRLGLRLINGVEISVTWRGRTIHVVGLDFDERDENLQNLLAQVRQGRLKRLEAI
FT                   AAKLEKKGIGGAYDGALALAANKEMVSRTHVAEFLIQAGHVKNKQQAFIKYLGDGKSCA
FT                   VRHEWATLEDCVSAVNGAGGMAVIAHPMRYDLSATAKRNLFEEFKNLGGAGIEVHSGNC
FT                   CKNDRLNYALLAERFGMLASAGSDFHRLNDFSGGILGACPELPENCRPVWAHFSRH"
FT   CDS_pept        complement(619964..621256)
FT                   /transl_table=11
FT                   /locus_tag="NMA0636"
FT                   /product="putative valine--pyruvate aminotransferase"
FT                   /EC_number="2.6.1.66"
FT                   /note="NMA0636, avtA, probable valine--pyruvate
FT                   aminotransferase, len: 430 aa; similar to SW:AVTA_ECOLI
FT                   (EMBL:U00039), avtA, Escherichia coli valine--pyruvate
FT                   aminotransferase (EC 2.6.1.66) (417 aa), fasta scores; E():
FT                   0, 47.9% identity in 426 aa overlap. Highly similar to
FT                   TR:AAC25982 (EMBL:AF014804), avtA, Neisseria meningitidis
FT                   MC58 valine--pyruvate aminotransferase (430 aa), fasta
FT                   scores; E(): 0, 96.5% identity in 430 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0636"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07901"
FT                   /db_xref="GOA:A0A0U1RHN3"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RHN3"
FT                   /protein_id="CAM07901.1"
FT                   /translation="MQFSAFGEKFTQHSGILQLMDDLGDALKSDKPVNMLGGGNPARIP
FT                   EIDRAFAGIFSKLAAEHAVENIGNYSNPQGDAVLIDALTAFLNREYGWNLTADNIALTN
FT                   GSQNAFFYLFNLFGGKFKLSDGTSAEKAILLPLAPEYIGYADVHIEGRHFVSVKPKIEN
FT                   VEHEGEAGFFKYRVDFDALESLPGLKEEKIGAICCSRPTNPTGNVLTDGEMARLDALAR
FT                   EHGIPLIIDNAYGMPFPNIIYSDVTLNWHENIILCFSLSKVGLPGVRTGIIVAAPEVVK
FT                   AVSSLNAIVNLAPTRFGAAIAAPLLESGEMKRLADQVIRPFYRNQAQTAVSLLKRELGA
FT                   YPMKIHKPEGAIFLWLWFENLPVPSQTLYEMLKAEGTLIIPGEHFFIGIDTRDYPHAGE
FT                   CIRMSIAQDAETLEKGIAAIGKTVRKLYDNV"
FT   CDS_pept        complement(621312..623222)
FT                   /transl_table=11
FT                   /locus_tag="NMA0637"
FT                   /product="pilin glycosylation protein"
FT                   /note="NMA0637, pglD, pilin glycosylation protein, len: 636
FT                   aa; highly similar to TR:AAC25981 (EMBL:AF014804) pglD from
FT                   Neisseria meningitidis MC58 (636 aa), fasta scores; E(): 0,
FT                   96.7% identity in 636 aa overlap. Similar to many genes
FT                   implicated in lipopolysaccharide biosynthesis e.g.
FT                   TR:O05349 (EMBL:Y07788), rfbU, Vibrio cholerae
FT                   mannosyl-transferase essential for O-antigen biosynthesis
FT                   (621 aa), fasta scores; E(): 0, 47.7% identity in 616 aa
FT                   overlap"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0637"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07902"
FT                   /db_xref="GOA:A0A0U1RHN4"
FT                   /db_xref="InterPro:IPR003869"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RHN4"
FT                   /protein_id="CAM07902.1"
FT                   /translation="MTLETLIALPRNIKKICFLIHDFLMIFIAFWFTQSLKADYSNEWF
FT                   DPANWQSFLLTALLTIGLFVRMGLYRAVTRFISFRILSTALAGSIVSAVLFFLNTLIFE
FT                   ERLRLALPIVYFLLLFVSVTGSRMVLRGLLSEHPKKQMIPVIIYGAGRSGRQLLEAVKQ
FT                   MREYSAAAFVDDDPKLWHTIIYDLAVYQPDAIAFLIERYGVEKILLAIPGATQEQRRRI
FT                   ISKLEAYPCEVLTIPGMKDLMDGKISIGTLKKISVSDLLGRDSVAPDNRLMSADIEGKT
FT                   VMVTGAGGSIGSELCRQIIRRRPEKLLLFELSEFALYAIEKELRETCIQKRLNTEILPF
FT                   LGSVQNRTLLEHVMTAFSVATVYHAAAYKHVPMVEFNTVEGIRNNIFGTLECALAATTS
FT                   GVRTFVLISTDKAVRPTNTMGASKRMAELCLQALAAEPGQKTRFSMVRFGNVLGSSGSV
FT                   VPLFEKQIAEGGPLTLTHPDITRYFMTIPEAAQLVIQAGAMGTGGDVFVLDMGESVKII
FT                   DLARQMITLSGLKPKTPEQPDGDIEIFITGLRPGEKLYEELLIDDNVRKTGHPRIMTAD
FT                   EAMLPWHELSALLNRIRAACDRYDQQAIRTLLINAPTGFAPSDGICDLLWVRETHRKNA
FT                   V"
FT   CDS_pept        complement(623270..624445)
FT                   /transl_table=11
FT                   /locus_tag="NMA0638"
FT                   /product="pilin glycosylation protein"
FT                   /note="NMA0638, pglC, pilin glycosylation protein, len: 404
FT                   aa; highly similar to TR:AAC25980 (EMBL:AF014804) pglC from
FT                   Neisseria meningitidis MC58 (391 aa), fasta scores; E(): 0,
FT                   95.1% identity in 391 aa overlap. Contains Pfam match to
FT                   entry PF01041 DegT_DnrJ_EryC1,DegT/DnrJ/EryC1/StrS family"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0638"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07903"
FT                   /db_xref="GOA:A0A0U1RHN5"
FT                   /db_xref="InterPro:IPR000653"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RHN5"
FT                   /protein_id="CAM07903.1"
FT                   /translation="MLNTSLSPWPCFIQEEADAVSKVLLSNKVNYWTGSECREFEKEFA
FT                   AFAGTRYAVALSNGTLALDVALKAMGIGAGDDVIVTSRTFLASASCIVNAGANPVFADV
FT                   DLNSQNISAETVKAVLTPNTKAIIVVHLAGMPAEMDGIMALAKEHDLWVIEDCAQAHGA
FT                   KYKGKSVGSIGHVGAWSFCQDKIMTTGGEGGMVTTNDKTLWEKMWSYKDHGKSYDAVYH
FT                   REHAPGFRWLHESFGTNWRMMEMQAVIGRIQLKRMPEWTARRQENAAKLAESLGKFKSI
FT                   RLVEVADYIEHAQYKFYVFVKPEHLKEGWTRDRIVNELNARKVPCYQGSCSEVYLEKAF
FT                   DNTPWRPKERLKNAVELGDTSLMFLVHPTLTDGEIAFCKKHIEAVLTEAAR"
FT   CDS_pept        complement(624523..625764)
FT                   /transl_table=11
FT                   /locus_tag="NMA0639"
FT                   /product="pilin glycosylation protein"
FT                   /note="NMA0639, pglB, pilin glycosylation protein, len: 413
FT                   aa; highly similar to TR:AAC25979 (EMBL:AF014804) pglB from
FT                   Neisseria meningitidis MC58 (413 aa), fasta scores; E(): 0,
FT                   94.6% identity in 410 aa overlap. Possibly a transferase;
FT                   N-terminal half is similar to the C-terminal half of e.g.
FT                   SW:RFBP_SALTY (EMBL:X56793), rfbP, Salmonella typhimurium
FT                   undecaprenyl-phosphate galactosephosphotransferase (476
FT                   aa), blastp scores; Expect = 1.5e-24. Contains an
FT                   hydrophobic, possible membrane-spanning region near the
FT                   N-terminus. Contains Pfam match to entry PF00132 hexapep,
FT                   Bacterial transferase hexapeptide (four repeats)"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0639"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07904"
FT                   /db_xref="GOA:A0A0U1RHN6"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR003362"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR020019"
FT                   /db_xref="InterPro:IPR041561"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RHN6"
FT                   /protein_id="CAM07904.1"
FT                   /translation="MSKFFKRLFDIVASASGLIFLSPVFLILIYLIRKNLGSPVFFFQE
FT                   RPGKDGKPFKMVKFRSMHDALDSDGILLPDGERLTPFGKKLRAASLDELPELWNVLKGD
FT                   MSLVGPRPLLMQYLPLYDNFQNRRHEMKPGITGWAQVNGRNALSWDERFACDIWYIDHF
FT                   SLCLDIKILLLTVKKVLIKEGISAQGEATMPPFTGKRKLAVVGAGGHGKVVAELAAALG
FT                   TYGEIVFLDDRVQGSVNGFPVIGTTLLLENSLSPEQFDIAVAVGNNRIRRQIAEKAAAL
FT                   GFALPVLIHPDSTVSPSATVGQGGVVMAKAVVQADSVLKDGVIVNTAATVDHDCLLDAF
FT                   VHISPGAHLSGNTRIGEESWIGTGACSRQQIRIGSRATIGAGAVVVRDVSDGMTVAGNP
FT                   AKPLAGKNTETLRS"
FT   CDS_pept        complement(625757..626920)
FT                   /transl_table=11
FT                   /locus_tag="NMA0640"
FT                   /product="hypothetical protein NMA0640"
FT                   /note="NMA0640, len: 387 aa; unknown, shows very weak
FT                   similarity to galactosyl transferases e.g. SW:RFAB_SALTY
FT                   (EMBL:AF026386), rfaB, Salmonella typhimurium
FT                   lipopolysaccharide 1,6-galactosyltransferase (359 aa),fasta
FT                   scores; E(): 0.053, 25.3% identity in 324 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:NMA0640"
FT                   /db_xref="EnsemblGenomes-Tr:CAM07905"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RHN7"
FT                   /protein_id="CAM07905.1"
FT                   /translation="MNITIVAPYCSLPSEPYFNRFWYLAERLSQSHDVLLITSRFRHYD
FT                   KSFRRHEDAAATSNGRLRVKLLDEPGYRKNVSLARVASHRVFVRNLARWLHSPQAAEQD
FT                   IVYSAYPLMATNLLLGKHKARLGYKLIVDVQDVWPESFSSVVPFLKKVPHKLLPFASRA
FT                   NRAYRCADALIAVSQTYLDRAKEANPNVPGETVYIGTDFAAIAPPRFRSKTVRLFYLGT
FT                   LSYSYDVETVCKGVRKLLDDGENVELHIMGGGPDLEKLKQYENRAIKFYGYLPYSEMMS
FT                   IAKACDIAVNAIHSHAMQSVTNKLSDYMALQKPILNSQNNAEVLDLLNLLPHENYRSGD
FT                   VDSFVQAAKNILKRKDDPVQSDEIVRRFRRDISYRKIVNLIERLAHE"
FT   CDS_pept        complement(join(626940..627518,627521..628021))
FT                   /transl_table=11
FT                   /locus_tag="NMA0641"
FT                   /product="pseudogene (putative glycosyl transferase)"
FT                   /note="NMA0641, possible glycosyl transferase,
FT                   pseudogene,len: 1079 bp; shows weak similarity to the
FT                   C-terminal half of many e.g. SW:CAPM_STAAU (EMBL:U10927),
FT                   capM,Staphylococcus aureus type 1 capsular polysaccharide
FT                   biosynthesis protein (380 aa), fasta scores; E():
FT                   6.4e-09,26.8% identity in 190 aa overlap and TR:O84910
FT                   (EMBL:AF010183), wbpZ, Pseudomonas aeruginosa
FT                   glycosyltransferase involved in A-band polysaccharide
FT