(data stored in SCRATCH zone)

EMBL: AL161564

ID   AL161564; SV 2; linear; genomic DNA; STD; PLN; 196286 BP.
XX
AC   AL161564;
XX
DT   16-MAR-2000 (Rel. 63, Created)
DT   14-NOV-2006 (Rel. 89, Last updated, Version 3)
XX
DE   Arabidopsis thaliana DNA chromosome 4, contig fragment No. 64
XX
KW   .
XX
OS   Arabidopsis thaliana (thale cress)
OC   Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
OC   Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae; Pentapetalae;
OC   rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis.
XX
RN   [1]
RP   1-82307
RA   Peters S.A., van Staveren M., Dirkse W., Stiekema W., Mewes H.W.,
RA   Lemcke K., Mayer K.F.X.;
RT   ;
RL   Unpublished.
XX
RN   [2]
RP   50686-155423,144355-196286
RA   Rose M., Hempel S., Entian K.-D., Mewes H.W., Lemcke K., Mayer K.F.X.;
RT   ;
RL   Unpublished.
XX
RN   [3]
RP   77316-77804
RA   Volckaert G., Grymonprez B., Voet M., Robben J., Mewes H.W., Lemcke K.,
RA   Mayer K.F.X.;
RT   ;
RL   Unpublished.
XX
RN   [4]
RP   1-196286
RA   EU Arabidopsis sequencing project;
RT   ;
RL   Submitted (10-MAR-2000) to the INSDC.
RL   MIPS, at the Max-Planck-Institut fuer Biochemie, Am Klopferspitz 18a,
RL   D-82152 Martinsried, FRG, E-mail:
RL   lemcke@mips.biochem.mpg.de,mayer@mips.biochem.mpg.de Project Coordinator:
RL   Mike Bevan, Molecular Genetics Department, Cambridge Laboratory, John Innes
RL   Centre, Colney Lane, NR4 7UJ Norwich, UK, E-mail: michael.bevan@bbsrc.ac.uk
XX
DR   MD5; 62f02a19c8d2010dee1f29e6f0106c6c.
DR   ENA-CON; AJ270060.
DR   RFAM; RF00005; tRNA.
XX
CC   Information on performance of analysis and a more detailed annotation
CC   of this entry and other sequences of chromosomes 3, 4 and 5 can be
CC   viewed at: http://www.mips.biochem.mpg.de/proj/thal/
CC   this fragment has an overlap with ATCHRIV63 at the 5' end and an overlap
CC   with ATCHRIV65 at the 3' end.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..196286
FT                   /organism="Arabidopsis thaliana"
FT                   /chromosome="4"
FT                   /variety="Columbia"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:3702"
FT   gene            6687..8444
FT                   /gene="AT4g25770"
FT   CDS_pept        complement(join(6687..6833,6920..7036,7083..7163,
FT                   7278..7370,7494..7733,7782..7882,7945..8042,8134..8444))
FT                   /gene="AT4g25770"
FT                   /product="putative protein"
FT                   /note="similarity to hypothetical protein T27I1.6 -
FT                   Arabidopsis thaliana, PIR2:T00623"
FT                   /db_xref="InterPro:IPR007751"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q9SW06"
FT                   /protein_id="CAB79432.1"
FT                   /translation="MIASFSRFQISIPDLIPSSPRFLPPSQNQFRFRLYLQFPAQPKNL
FT                   CQMEWMNRLGIGCFAANRSKRELTTEIDNGGEDFFDADVMESAEKPDHLVVMVNGIVGS
FT                   AADWKYAAEQFVKKFPDKVLVHRACFLTYRYCGSESNSATLTFDGVDKMGERLANEVVF
FT                   GCIVVSSVLGVVKHRSGLKKISFVAHSLGGLVARYAIGKLYEQPGEVDSLDSPSKEKSA
FT                   RGGEIAGLEPMNFITFATPHLGSRGHRQFPILCGLPFLERTASQTAHLAAGRTGKHLFL
FT                   IDMLIISSYDLNRSALNAFKRRVAYANRLSMVFDYFYHLQEFALTNEKAMVGWRTSSIR
FT                   RPNELPKPNLLATDPNYPHIVYVERGNVDNGSCQSTSTVVTEQDTDLEGFALFLT"
FT   exon            complement(6687..6833)
FT                   /number=1
FT   intron          complement(6834..6919)
FT                   /number=1
FT   exon            complement(6920..7036)
FT                   /number=2
FT   intron          complement(7037..7082)
FT                   /number=2
FT   exon            complement(7083..7163)
FT                   /number=3
FT   intron          complement(7164..7277)
FT                   /number=3
FT   exon            complement(7278..7370)
FT                   /number=4
FT   intron          complement(7371..7493)
FT                   /number=4
FT   exon            complement(7494..7733)
FT                   /number=5
FT   intron          complement(7734..7781)
FT                   /number=5
FT   exon            complement(7782..7882)
FT                   /number=6
FT   intron          complement(7883..7944)
FT                   /number=6
FT   exon            complement(7945..8042)
FT                   /number=7
FT   intron          complement(8043..8133)
FT                   /number=7
FT   exon            complement(8134..8444)
FT                   /number=8
FT   gene            9569..10141
FT                   /gene="AT4g25780"
FT   CDS_pept        9569..10141
FT                   /gene="AT4g25780"
FT                   /product="putative pathogenesis-related protein"
FT                   /note="strong similarity to gene PR-1 protein - Medicago
FT                   truncatula, PIR2:S47171"
FT                   /note="Contains Extracellular proteins
FT                   SCP/Tpx-1/Ag5/PR-1/Sc7 signatures AA147-157;Extracellular
FT                   proteins SCP/Tpx-1/Ag5/PR-1/Sc7 signatures AA173-184"
FT                   /note="contains EST gb:Z26548, AA586201, AA712838,
FT                   AA712715"
FT                   /db_xref="GOA:Q9SW05"
FT                   /db_xref="InterPro:IPR001283"
FT                   /db_xref="InterPro:IPR002413"
FT                   /db_xref="InterPro:IPR014044"
FT                   /db_xref="InterPro:IPR018244"
FT                   /db_xref="InterPro:IPR034111"
FT                   /db_xref="InterPro:IPR035940"
FT                   /db_xref="UniProtKB/TrEMBL:Q9SW05"
FT                   /protein_id="CAB79433.1"
FT                   /translation="MSSSYLRVILLLGALNVVVSLSITNSLITKSATLGQVFRICKNLC
FT                   PGCDHDSLQFLFRHNLVRAARFEPPLIWDRRLQNYAQGWANQRRGDCALRHSVSNGEFN
FT                   LGENIYWGYGANWSPADAVVAWASEKRFYHYGSNTCDAGQMCGHYTQIVWKSTRRVGCA
FT                   RVVCDNGGIFMTCNYDPPGNYIGQKPY"
FT   exon            9569..10141
FT                   /number=1
FT   gene            10710..11752
FT                   /gene="AT4g25790"
FT   CDS_pept        complement(join(10710..11074,11485..11752))
FT                   /gene="AT4g25790"
FT                   /product="putative pathogenesis-related protein"
FT                   /note="strong similarity to gene PR-1 protein - Medicago
FT                   truncatula, PIR2:S47171"
FT                   /note="Contains Extracellular proteins
FT                   SCP/Tpx-1/Ag5/PR-1/Sc7 signatures AA166-176;Extracellular
FT                   proteins SCP/Tpx-1/Ag5/PR-1/Sc7 signatures AA193-204"
FT                   /note="contains EST gb:AA712715, N65358"
FT                   /db_xref="GOA:Q9SW04"
FT                   /db_xref="InterPro:IPR001283"
FT                   /db_xref="InterPro:IPR002413"
FT                   /db_xref="InterPro:IPR014044"
FT                   /db_xref="InterPro:IPR018244"
FT                   /db_xref="InterPro:IPR034111"
FT                   /db_xref="InterPro:IPR035940"
FT                   /db_xref="UniProtKB/TrEMBL:Q9SW04"
FT                   /protein_id="CAB79434.1"
FT                   /translation="MATTTSTQAIVFAIALFLVAIQAVHADYYRHRPQRPITPSPPPYV
FT                   AKPQPLPTPSPKPILYQPPPTYQPPTGSFEQQFLDPHNTVRGGLGLPPLVWDVKIASYA
FT                   TWWANQRRYDCSLTHSTGPYGENLFWGSGSDFTSTFAVESWTVEAKSYNHMTNTCEGDG
FT                   MCGHYTQIVWRETRRLGCARVVCENGAGVFITCNYDPPGNYVGEKPY"
FT   exon            complement(10710..11074)
FT                   /number=1
FT   intron          complement(11075..11484)
FT                   /number=1
FT   exon            complement(11485..11752)
FT                   /number=2
FT   gene            13985..16227
FT                   /gene="AT4g25800"
FT   CDS_pept        join(13985..14010,14239..14669,14761..14921,15016..15219,
FT                   15390..15595,15645..16227)
FT                   /gene="AT4g25800"
FT                   /product="putative calmodulin-binding protein"
FT                   /note="EST GB:F14385 in 5' untranslated region"
FT                   /note="strong similarity to calmodulin-binding protein
FT                   (TCB60) - Nicotianatabacum, PID:g1698548"
FT                   /note="contains EST gb:F14386, F14385, N96168, N96141"
FT                   /db_xref="GOA:Q0WVV6"
FT                   /db_xref="InterPro:IPR012416"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0WVV6"
FT                   /protein_id="CAB79435.1"
FT                   /translation="MNQFCLLVRLSLPLFTGGRVEGEQGATIHVVLIDANTGRPVTVGP
FT                   EASLKLEVVVLGGDFNNEDDEDWTQEEFESHVVKEREGKRPLLTGDLFVVLKEGVGTLG
FT                   EIVFTDNSSWIRSRKFRLGLRVPSGYCDGIRIREAKTEAFSVKDHRGELYKKHYPPALN
FT                   DEVWRLEKIGKDGAFHKRLTAAGIVTVEGFLRQLVRDSTKLRAILGSGMSNKMWDLLVE
FT                   HAKTCVLSGKLYIYYTEDSRSVGVVFNNIYELSGLITEDQYLSADSLSESQKVYVDGLV
FT                   KKAYENWNQVVEYEGESLLNLNQPERLDISQTDPVTALASYSTVPLSQFPEFAIEGWQI
FT                   SPFLYSTSIFTAGYNQTLTTALPHNPQAQFDFVPQQDQFIGIQQPQTQTNIENENVTRL
FT                   VLGPPQSSTGGYQDIKSSADQENLNPFEDWTNLSENDFFSEEEIRQTSHDLLANEDMQQ
FT                   LLFSMGGGKGEDGFTFPSFMQNTPMMQGYDEEGRGRSGKAVVGWLKVKAAMRWGFFIRR
FT                   KAAERRAQIVELHDNNDGK"
FT   exon            13985..14010
FT                   /number=1
FT   intron          14011..14238
FT                   /number=1
FT   exon            14239..14669
FT                   /number=2
FT   intron          14670..14760
FT                   /number=2
FT   exon            14761..14921
FT                   /number=3
FT   intron          14922..15015
FT                   /number=3
FT   exon            15016..15219
FT                   /number=4
FT   intron          15220..15389
FT                   /number=4
FT   exon            15390..15595
FT                   /number=5
FT   intron          15596..15644
FT                   /number=5
FT   exon            15645..16227
FT                   /number=6
FT   gene            17156..18177
FT                   /gene="AT4g25810"
FT   CDS_pept        join(17156..17425,17510..17703,17781..18177)
FT                   /gene="AT4g25810"
FT                   /product="xyloglucan endo-1, 4-beta-D-glucanase (XTR-6)"
FT                   /note="member of the XET-related (XTR) gene family"
FT                   /note="contains EST gb:AI996718.1, Z30849"
FT                   /db_xref="GOA:Q38910"
FT                   /db_xref="InterPro:IPR000757"
FT                   /db_xref="InterPro:IPR008263"
FT                   /db_xref="InterPro:IPR010713"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="InterPro:IPR016455"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q38910"
FT                   /protein_id="CAB79436.1"
FT                   /translation="MAMISYSTIVVALLASFMICSVSANFQRDVEITWGDGRGQITNNG
FT                   DLLTLSLDKASGSGFQSKNEYLFGKIDMQIKLVAGNSAGTVTAYYLKSPGSTWDEIDFE
FT                   FLGNLSGDPYTLHTNVFTQGKGDREQQFKLWFDPTSDFHTYSILWNPQRIIFSVDGTPI
FT                   REFKNMESQGTLFPKNQPMRMYSSLWNAEEWATRGGLVKTDWSKAPFTASYRGFNEEAC
FT                   VVINGQSSCPNVSGQGSTGSWLSQELDSTGQEQMRWVQNNYMIYNYCTDAKRFPQGLPR
FT                   ECLAA"
FT   exon            17156..17425
FT                   /number=1
FT   intron          17426..17509
FT                   /number=1
FT   exon            17510..17703
FT                   /number=2
FT   intron          17704..17780
FT                   /number=2
FT   exon            17781..18177
FT                   /number=3
FT   gene            18811..20077
FT                   /gene="AT4g25820"
FT   CDS_pept        join(18811..19092,19218..19411,19690..20077)
FT                   /gene="AT4g25820"
FT                   /product="putative xyloglucan endo-1, 4-beta-D-glucanase"
FT                   /note="strong similarity to xyloglucan endo-1,
FT                   4-beta-D-glucanase (EC 3.2.1.-) XTR-3 - Arabidopsis
FT                   thaliana (fragment), PIR2:S71222"
FT                   /note="Contains Prenyl group binding site (CAAX box)
FT                   AA285-288"
FT                   /note="contains EST gb:R64778, T41903"
FT                   /db_xref="GOA:Q9ZSU4"
FT                   /db_xref="InterPro:IPR000757"
FT                   /db_xref="InterPro:IPR008263"
FT                   /db_xref="InterPro:IPR010713"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="InterPro:IPR016455"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9ZSU4"
FT                   /protein_id="CAB79437.1"
FT                   /translation="MACFATKQPLLLSLLLAIGFFVVAASAGNFYESFDITWGNGRANI
FT                   FENGQLLTCTLDKVSGSGFQSKKEYLFGKIDMKLKLVAGNSAGTVTAYYLSSKGTAWDE
FT                   IDFEFLGNRTGHPYTIHTNVFTGGKGDREMQFRLWFDPTADFHTYTVHWNPVNIIFLVD
FT                   GIPIRVFKNNEKNGVAYPKNQPMRIYSSLWEADDWATEGGRVKIDWSNAPFKASYRNFN
FT                   DQSSCSRTSSSKWVTCEPNSNSWMWTTLNPAQYGKMMWVQRDFMIYNYCTDFKRFPQGL
FT                   PKECKL"
FT   exon            18811..19092
FT                   /number=1
FT   intron          19093..19217
FT                   /number=1
FT   exon            19218..19411
FT                   /number=2
FT   intron          19412..19689
FT                   /number=2
FT   exon            19690..20077
FT                   /number=3
FT   gene            22189..26099
FT                   /gene="AT4g25830"
FT   CDS_pept        join(22189..22340,22800..22920,22998..23223,24742..26099)
FT                   /gene="AT4g25830"
FT                   /product="putative mitochondrial protein"
FT                   /note="similarity to Homo sapiens h-bcs1 (BCS1) mRNA,
FT                   nuclear gene encoding mitochondrial protein which is
FT                   involved in the expression of functional mitochondrial
FT                   ubiquinol-cytochrome c reductase complex probably via the
FT                   control of expression of Rieske iron-sulphur protein,
FT                   PID:g3599962"
FT                   /note="Contains ATP/GTP-binding site motif A (P-loop)
FT                   AA356-363;Prokaryotic membrane lipoprotein lipid attachment
FT                   site AA14-24"
FT                   /note="contains EST gb:T76352"
FT                   /db_xref="GOA:Q8L8U9"
FT                   /db_xref="InterPro:IPR006459"
FT                   /db_xref="InterPro:IPR006702"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8L8U9"
FT                   /protein_id="CAB79438.1"
FT                   /translation="MVKLRETEVILRLCIVFFLLLTSCLIGLDSQTKEIAYIHKNVSFR
FT                   YLLALEAELYIDVVVAAYNLVQLGLGWYNVEQKTSNPKWFSYLLDQTAAYVVFAGTSAA
FT                   AQHSLLVVTGSRELQWMKWCYKFTRFCFQMGSAIILNYIAAALMVLLSSISAFNLFRLY
FT                   SPKQIDGVNTNELYNAVQLYLSSSVSIAGNRLSLTRAVNSSSVTFGLSNNDSIVDTFNS
FT                   VTVVWEHIVTQRQTQTFAWRPMPEEKRGFTLRIKKKDKNLILDSYLDYIMEKANEIRRL
FT                   NQDRLLYTNSRGGSLDSRGLPWESVPFKHPSTFDTLAMDPVKKQQIMEDLKDFAECQSF
FT                   YERTGRAWKRGYLLYGPPGTGKSSMIAAMANYLRYDIYDLELTEVKSNSELRKLLMKTS
FT                   SKSIIVIEDIDCSINLTNRNKKQSTGSYNEPEMLTGSGLGDDLGDGNTITLSGLLNFTD
FT                   GLWSCCGSERIFVFTTNHIEKLDPALLRSGRMDMHIHMSYCTFSSVKILLRNYLGFEEG
FT                   DLNDVVLKELAEVVDRAEITPADVSEALIKNRRDKERAVRELLVDLRSRVERNEKNGKS
FT                   RVQNVSLEEQENRAFDSLYAEENGGEEEEIEDNICKSSDDCS"
FT   exon            22189..22340
FT                   /number=1
FT   intron          22341..22799
FT                   /number=1
FT   exon            22800..22920
FT                   /number=2
FT   intron          22921..22997
FT                   /number=2
FT   exon            22998..23223
FT                   /number=3
FT   intron          23224..24741
FT                   /number=3
FT   exon            24742..26099
FT                   /number=4
FT   gene            27719..29181
FT                   /gene="AT4g25840"
FT   CDS_pept        join(27719..27737,28015..28239,28431..28491,28621..28768,
FT                   28886..28965,29049..29181)
FT                   /gene="AT4g25840"
FT                   /product="putative protein"
FT                   /note="strong similarity to Human GS1 (protein of unknown
FT                   function) mRNA, PID:g183653"
FT                   /note="contains EST gb:AA712184"
FT                   /db_xref="GOA:F4JTE7"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/Swiss-Prot:F4JTE7"
FT                   /protein_id="CAB79439.1"
FT                   /translation="MDGLLLDTEKFYTEVQEKILARYNKTFDWSLKAKMMGRKAIEAAR
FT                   LFVDESGISDSLSAEDFIVERESMLQDLFPTSDLMPGASRLLRHLHGKGIPICIATGTH
FT                   TRHFDLKTQRHRELFSLMHHVVRGDDPEVKEGKPAPDGFLAASRRFEDGPVDPRKVLVF
FT                   EDAPSGVQAAKNAGMNVIMVPDSRLDKSYCNVADQVLASLLDFKPEEWGLPSFQDSHN"
FT   exon            27719..27737
FT                   /number=1
FT   intron          27738..28014
FT                   /number=1
FT   exon            28015..28239
FT                   /number=2
FT   intron          28240..28430
FT                   /number=2
FT   exon            28431..28491
FT                   /number=3
FT   intron          28492..28620
FT                   /number=3
FT   exon            28621..28768
FT                   /number=4
FT   intron          28769..28885
FT                   /number=4
FT   exon            28886..28965
FT                   /number=5
FT   intron          28966..29048
FT                   /number=5
FT   exon            29049..29181
FT                   /number=6
FT   gene            32708..35116
FT                   /gene="AT4g25850"
FT   CDS_pept        join(32708..32848,33700..33948,34036..34132,34382..34679,
FT                   34765..35116)
FT                   /gene="AT4g25850"
FT                   /product="putative protein"
FT                   /note="EST GB:Z48414 marks 5' end, unspliced"
FT                   /note="similarity to N.crassa mRNA for putative
FT                   oxysterol-binding protein, PID:e314043"
FT                   /note="contains EST gb:Z48414, Z48413"
FT                   /db_xref="GOA:Q9SW00"
FT                   /db_xref="InterPro:IPR000648"
FT                   /db_xref="InterPro:IPR037239"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9SW00"
FT                   /protein_id="CAB79440.1"
FT                   /translation="MRKHLVLAKPFSLEDEKDSEHTASNVIRKILSLFKTVRPGSDLTN
FT                   FQLPPQLNLPRSQLQCYGEMVYSFVGQDLLGECSRRDLPIERLKSVVTWNISTLRPVVF
FT                   GMSPYNSVLGETHHVSNGHINVIAEQVVHHPPVSALHATHEQENIDVTWCQYFTPKFRG
FT                   THVDVEVKGKRVMKLLNHIETYEMDQPRLIMRFLPAPGAYWAGKVKIKCPETDLEAELH
FT                   LISDSFIERFRGNNNRSIKGKIFESSSGNQLYNIFGHWDRTVMAKNIKTGELEVIYNAK
FT                   ENITGLKPPTVKNLEEVTESESTMVWSEVSEGILKKDWERAREAKIVVEEKQRASLKQR
FT                   EASGESWVPKHFLVVKDGKDWDCSPLQPTVPPAPLVIT"
FT   exon            32708..32848
FT                   /number=1
FT   intron          32849..33699
FT                   /number=1
FT   exon            33700..33948
FT                   /number=2
FT   intron          33949..34035
FT                   /number=2
FT   exon            34036..34132
FT                   /number=3
FT   intron          34133..34381
FT                   /number=3
FT   exon            34382..34679
FT                   /number=4
FT   intron          34680..34764
FT                   /number=4
FT   exon            34765..35116
FT                   /number=5
FT   misc_feature    35246..35534
FT                   /note="EST GB:Z48413 match, no obvious ORF"
FT   gene            35932..37989
FT                   /gene="AT4g25860"
FT   CDS_pept        join(35932..36072,36428..36676,36929..37025,37244..37541,
FT                   37632..37989)
FT                   /gene="AT4g25860"
FT                   /product="putative protein"
FT                   /note="similarity to N.crassa mRNA for putative
FT                   oxysterol-binding protein, PID:e314043"
FT                   /note="contains EST gb:Z48414"
FT                   /db_xref="GOA:Q9SVZ9"
FT                   /db_xref="InterPro:IPR000648"
FT                   /db_xref="InterPro:IPR037239"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9SVZ9"
FT                   /protein_id="CAB79441.1"
FT                   /translation="MRRQLVLAKPFSLEDEKDSELTASSVIRKILSLIKTVRPGSDLTN
FT                   FQLPPQLILPRSRLQCYGEMIYSFGGQDLLGECSRRNIPIERLKSVVTWNISTLRPVVV
FT                   GMSPYNPILGETHHVSNGYINVLTEQVMHHPPVSALHATHEQENIDVTWCQYFTPKFRG
FT                   AYVDVEVNGKRIMKLLHHKETYEMDQPRLIMKFLPAPGAHWAGKVKIKCPETDLEAELH
FT                   LISDSFIERFRGNNNRSIKGKIFESSSGNQLYNIFGHWDRTVMAKNLKTGGLEVIYNAN
FT                   ENITGLKPPTVKNLQEVMESESTIVWSEVSEGILKKDWERAREAKILVEEKQREALKQR
FT                   EASGESWVPKHFSVVKDGKDWHCSPLQPTVPRAPLVITEK"
FT   exon            35932..36072
FT                   /number=1
FT   intron          36073..36427
FT                   /number=1
FT   exon            36428..36676
FT                   /number=2
FT   intron          36677..36928
FT                   /number=2
FT   exon            36929..37025
FT                   /number=3
FT   intron          37026..37243
FT                   /number=3
FT   exon            37244..37541
FT                   /number=4
FT   intron          37542..37631
FT                   /number=4
FT   exon            37632..37989
FT                   /number=5
FT   gene            38293..40199
FT                   /gene="AT4g25870"
FT   CDS_pept        complement(join(38293..38430,38507..38545,38626..38748,
FT                   38836..38898,39015..39095,39220..39310,39400..39471,
FT                   39558..39757,39837..40199))
FT                   /gene="AT4g25870"
FT                   /product="putative protein"
FT                   /note="similarity to other hypothetical proteins
FT                   Arabidopsis thaliana"
FT                   /note="contains EST gb:AI998971.1, AI822764.1, N37831,
FT                   AA720168"
FT                   /db_xref="GOA:Q9SVZ8"
FT                   /db_xref="InterPro:IPR003406"
FT                   /db_xref="UniProtKB/TrEMBL:Q9SVZ8"
FT                   /protein_id="CAB79442.1"
FT                   /translation="MGETQKILQGPRHHTSLKKPLWVVLTVSVTSMLLICTHMYPKHGK
FT                   SSSCHGLYSTRGCEDALSKWLPVHVRKFTDEEIAARAVVRDILRTPPFITNNSKIAFLF
FT                   LTPGTLPFEKLWDEFFKGHEGKFSIYIHPSKERPVHISRHFSDREIHSDEVTWGRISMV
FT                   DAEKRLLVSALEDPDNQHFVLVSESCIPLHTFDYTYRYLLYSNVSFIESFVDPGPHGTG
FT                   RHMEHMLPEIAKEDFRKGAQWFTMKRQHAIIVMADGLYYSKFREYCGPGIEADKNCIAD
FT                   EHYLPTFFNMIDPMGISNWSVTFVDWSERRWHPKTYGGNEISLEFMKNVTSEDMSVHVT
FT                   SVGKHGDELHWPCTWNGIKRPCYLFARKFHPDTLDTLVNLFPNYTNTAV"
FT   exon            complement(38293..38430)
FT                   /number=1
FT   intron          complement(38431..38506)
FT                   /number=1
FT   exon            complement(38507..38545)
FT                   /number=2
FT   intron          complement(38546..38625)
FT                   /number=2
FT   exon            complement(38626..38748)
FT                   /number=3
FT   intron          complement(38749..38835)
FT                   /number=3
FT   exon            complement(38836..38898)
FT                   /number=4
FT   intron          complement(38899..39014)
FT                   /number=4
FT   exon            complement(39015..39095)
FT                   /number=5
FT   intron          complement(39096..39219)
FT                   /number=5
FT   exon            complement(39220..39310)
FT                   /number=6
FT   intron          complement(39311..39399)
FT                   /number=6
FT   exon            complement(39400..39471)
FT                   /number=7
FT   intron          complement(39472..39557)
FT                   /number=7
FT   exon            complement(39558..39757)
FT                   /number=8
FT   intron          complement(39758..39836)
FT                   /number=8
FT   exon            complement(39837..40199)
FT                   /number=9
FT   gene            43980..47540
FT                   /gene="AT4g25880"
FT   CDS_pept        join(43980..44277,44338..44474,44572..45649,45723..45937,
FT                   46025..46132,46209..46421,46554..46664,46757..46951,
FT                   47034..47205,47518..47540)
FT                   /gene="AT4g25880"
FT                   /product="pumilio-like protein"
FT                   /note="EST GB:Aa394891 probably hybrid"
FT                   /note="similarity to abdominal segment formation protein
FT                   pumilio - fruitfly, PIR2:A46221"
FT                   /note="contains EST gb:AA597645, AA394891"
FT                   /db_xref="GOA:Q9C5E7"
FT                   /db_xref="InterPro:IPR001313"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR033133"
FT                   /db_xref="InterPro:IPR033712"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9C5E7"
FT                   /protein_id="CAB79443.1"
FT                   /translation="MATENPIRISGSNERWSNSRKVSVPNRSGSAPPNMEGSFLAVDNL
FT                   LSRQGGSVYNNLMLPRYGFEEPVTTHPSSKHSLNRIPSPPIYYPTEYQFIDNRVGKLST
FT                   HKEVSEDESSQQLSVNSVSDRTDGLDIRLSPGSQSLADFRQDDTSSGQTPQHSRSNSSN
FT                   GEVNTADESGNFSELSDDVVVKDNAASTARASIGNEKSPDESTIISKMKSTNISGPGTA
FT                   KYPREPRYGQPERQPHQQQNNATWIQGGSNMGSHGVNDAVIGAGQFHYGQPYKFSGDGQ
FT                   PVLQSSGFTPPLLYTATQTAYMTSPAHVYNMQSPAVYSPQYGYGPYTNMIPQFMPGYPS
FT                   HGSVPVVVSPDFIPQLSGPSAGSVVHGGEMQYAEKLYVPPGQPSFPDPMYMQYCQQSFG
FT                   QMEPLAPRNHTNAPESQKDDPKFLRQIRGPSNSNMARPGMGVNYYGIQPNMGIMVQYLP
FT                   THLGPPLSPGHVPYVEAYPGWQPQGSLEGANGPRLCNFLEELKSGKEVSSRLRFLPNYM
FT                   ITNLSKILFPFSADQHGSRFIQQKLENCKPEEKAAVFREILPHACKLMTDVFGNYVIQK
FT                   FFEYGNSTQRKELADQLMGQIVPLSLQMYGCRVIQKALDVIEPDQRVRLARELDGQVMR
FT                   CVRDQNGNHVIQKCIENIPADKVGFMLYAFRGQVSSLSMHPYGCRVIQRLLERCSHDHQ
FT                   CRFITEEILESVCVLSKDQYGNYVTQHVLEKGTSEERERIGRKLSGHIVQLSLHKFASN
FT                   VIEKCLEYGGRVERDLIIKEIAGPDESYNSLLMMMKDQYGNYVVQKIFETCTADQRLTL
FT                   FSRVRMHASALKKYTYGKHIVSRLEQPSIEENQELRR"
FT   exon            43980..44277
FT                   /number=1
FT   intron          44278..44337
FT                   /number=1
FT   exon            44338..44474
FT                   /number=2
FT   intron          44475..44571
FT                   /number=2
FT   exon            44572..45649
FT                   /number=3
FT   intron          45650..45722
FT                   /number=3
FT   exon            45723..45937
FT                   /number=4
FT   intron          45938..46024
FT                   /number=4
FT   exon            46025..46132
FT                   /number=5
FT   intron          46133..46208
FT                   /number=5
FT   exon            46209..46421
FT                   /number=6
FT   intron          46422..46553
FT                   /number=6
FT   exon            46554..46664
FT                   /number=7
FT   intron          46665..46756
FT                   /number=7
FT   exon            46757..46951
FT                   /number=8
FT   intron          46952..47033
FT                   /number=8
FT   exon            47034..47205
FT                   /number=9
FT   intron          47206..47517
FT                   /number=9
FT   exon            47518..47540
FT                   /number=10
FT   gene            48089..48855
FT                   /gene="AT4g25890"
FT   CDS_pept        complement(join(48089..48250,48658..48855))
FT                   /gene="AT4g25890"
FT                   /product="putative acidic ribosomal protein"
FT                   /note="strong similarity to acidic ribosomal protein P3a -
FT                   maize, PIR2:T02037"
FT                   /note="contains EST gb:Z18207, AI997264.1, Z17905,
FT                   AA597503, N96427, Z47687, AA728671, AA728491"
FT                   /db_xref="GOA:Q9SVZ6"
FT                   /db_xref="InterPro:IPR027534"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9SVZ6"
FT                   /protein_id="CAB79444.1"
FT                   /translation="MGVFTFVCKNGGGAWSAKQHEGELESSASSTYELQRKLVQVSLSA
FT                   DSSGGVQSSFSLVSPTSAVFQVIVGGGGGGGFSAGGAASSGGGAGEAAAAPKEDEKKKE
FT                   ESEEEEGDFGFDLFG"
FT   exon            complement(48089..48250)
FT                   /number=1
FT   intron          complement(48251..48657)
FT                   /number=1
FT   exon            complement(48658..48855)
FT                   /number=2
FT   gene            49952..51859
FT                   /gene="AT4g25900"
FT   CDS_pept        join(49952..50110,50230..50304,50651..50707,50791..50945,
FT                   51064..51198,51290..51392,51445..51580,51690..51859)
FT                   /gene="AT4g25900"
FT                   /product="possible apospory-associated like protein"
FT                   /note="strong similarity to Pennisetum ciliare possible
FT                   apospory-associated mRNA clone pSUB C, PID:g549984"
FT                   /note="contains EST gb:AI999411.1, AI997551.1"
FT                   /db_xref="GOA:Q9SVZ5"
FT                   /db_xref="InterPro:IPR008183"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR014718"
FT                   /db_xref="InterPro:IPR025532"
FT                   /db_xref="UniProtKB/TrEMBL:Q9SVZ5"
FT                   /protein_id="CAB79445.1"
FT                   /translation="MGNKRNLGFVIFFWALVVAVVATAIEHRRNERTKGVNGLDKIIIR
FT                   DRRGRSAEVYLYGGQVSSWKNENGEELLVMSSKAIFQPPTPIRGGIPVLFPQYSNTGPL
FT                   PSHGFVRQRFWEVETKPPPLPSLSTAHVDLIVRSSNEDLKIWPHKFEYRLRVALGHDGD
FT                   LTLTSRVKNTDTKPFNFTFALHPYFAVSNISEIHVEGLHNLDYLDQQKNRTRFTDHEKV
FT                   ITFNAQSITKKKHTLQKKLDRLYLSTPDQLRIVDHKKKKTIVVHKEGQVDAVVWNPWDK
FT                   KVSDLGVEDYKRFVTVESAAVAKPITVNPGKEWKGILHVSVVPSNRKA"
FT   exon            49952..50110
FT                   /number=1
FT   intron          50111..50229
FT                   /number=1
FT   exon            50230..50304
FT                   /number=2
FT   intron          50305..50650
FT                   /number=2
FT   exon            50651..50707
FT                   /number=3
FT   misc_feature    50685..82307
FT                   /note="overlap to BAC F20B18; please refer to this entry
FT                   for analysis and annotation"
FT   misc_feature    50686..82308
FT                   /note="overlap to BAC F14M19; please also refer to
FT                   EMBL:AL049480 for analysis and annotation"
FT   intron          50708..50790
FT                   /number=3
FT   exon            50791..50945
FT                   /number=4
FT   intron          50946..51063
FT                   /number=4
FT   exon            51064..51198
FT                   /number=5
FT   intron          51199..51289
FT                   /number=5
FT   exon            51290..51392
FT                   /number=6
FT   intron          51393..51444
FT                   /number=6
FT   exon            51445..51580
FT                   /number=7
FT   intron          51581..51689
FT                   /number=7
FT   exon            51690..51859
FT                   /number=8
FT   gene            52627..53557
FT                   /gene="AT4g25910"
FT   CDS_pept        join(52627..52692,52778..52895,52971..53269,53366..53557)
FT                   /gene="AT4g25910"
FT                   /product="nitrogen fixation like protein"
FT                   /note="similarity to nitrogen fixation protein nifU -
FT                   Anabaena sp., Pir2:D34443"
FT                   /note="contains EST gb:AA404940"
FT                   /db_xref="GOA:Q84RQ7"
FT                   /db_xref="InterPro:IPR001075"
FT                   /db_xref="InterPro:IPR034904"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q84RQ7"
FT                   /protein_id="CAB79446.1"
FT                   /translation="MNLSLSTAEKNPNFRSSLLNSKNAISDTLGVSSKCSTFLRGQFQR
FT                   IHFSWLQHTRPLRKRTVFGHVSCVMPLTEENVERVLDEVRPSLMADGGNVALHEIDGLV
FT                   VVLKLQGACGSCPSSSMTLKMGIESRLRDKIPEIMSVEQFLESETGGLELNDENIEKVL
FT                   SELRPYLSGTGGGGLELVEIDGYVVKVRLTGPAAGVMTVRVALTQKLRETIPSIGAVQL
FT                   LE"
FT   exon            52627..52692
FT                   /number=1
FT   intron          52693..52777
FT                   /number=1
FT   exon            52778..52895
FT                   /number=2
FT   intron          52896..52970
FT                   /number=2
FT   exon            52971..53269
FT                   /number=3
FT   intron          53270..53365
FT                   /number=3
FT   exon            53366..53557
FT                   /number=4
FT   gene            53938..55304
FT                   /gene="AT4g25920"
FT   CDS_pept        join(53938..53998,54156..54831,54944..55304)
FT                   /gene="AT4g25920"
FT                   /product="putative protein"
FT                   /note="similarity to other hypothetical proteins
FT                   Arabidopsis thaliana"
FT                   /db_xref="InterPro:IPR005174"
FT                   /db_xref="UniProtKB/TrEMBL:Q9SZG7"
FT                   /protein_id="CAB79447.1"
FT                   /translation="MSKLIINRIFKPSVCKNFLVPFPFLLIDYILNNPNSSSDGRVTTN
FT                   VYGNEKEVLIKDKDLKEEVCDAMTVGFSRDGLRVELCGNHGDVCSPTIFYKPTDPEIED
FT                   LTVDLPPLPTGSQIQSLVMSSLPKRDKNWVVVVKLLGSQLSMCRPFGSRKWINIQTKPQ
FT                   NINPSSSIMFSKKEKKFYVPTPGGNILCYLDPHSEDDDLIDFVELEFDDLPKSVFQELA
FT                   DVSTCSRTDHLVESPTGQLFLVKWYGEDLEDIDNTTLYNVTKKFMVFKEGEKPSCVYTK
FT                   KMIYTEDIGDLCIFVGHSEAFCVPASSSPGLKPNCIYFVGYNFGVYDLTTKTCTMFLTK
FT                   DDNPLRKLEFPYWPPPASFPVLAPN"
FT   exon            53938..53998
FT                   /number=1
FT   intron          53999..54155
FT                   /number=1
FT   exon            54156..54831
FT                   /number=2
FT   intron          54832..54943
FT                   /number=2
FT   exon            54944..55304
FT                   /number=3
FT   gene            55840..57856
FT                   /gene="AT4g25930"
FT   CDS_pept        join(55840..55868,55914..56139,56731..57458,57535..57856)
FT                   /gene="AT4g25930"
FT                   /product="putative protein"
FT                   /note="similarity to other hypothetical proteins
FT                   Arabidopsis thaliana"
FT                   /db_xref="InterPro:IPR005174"
FT                   /db_xref="UniProtKB/TrEMBL:Q9SZG8"
FT                   /protein_id="CAB79448.1"
FT                   /translation="MAPHQTQEERYGHNLMRNHNKVETLVHMASQFMVFRAEESWEEKY
FT                   VYYTEDIGDLCIFLGHSEAFCIQASSGSSLTASILWAITLRSHSKQVRMFSSKPTYPYL
FT                   LIDHLLKTTEHCSNDQVYYDDKYYEKNLVIKDQGLAEEVREVMTVGFSHKDDWRVHLEK
FT                   SEDSSTSLMMVSNTSFVPVKHQLPPLSSNCRIQNVAISNSVDIKKEDLVVAVKFFGSDV
FT                   SLCKPFSDSSSEWININTSGSVHPFSSLTYSKKNKKFLSVSPSGTYLWYLDLHFDEDDV
FT                   EPYSSYLYFREDPLLRLYKMDLEDYIWRFRTDHLAELPSGEHFLVKWFFKDVMMNVGKI
FT                   TQKTDGFKVFRVDTICGHLTNTQDIGDLCIFLGHGEAYCVPASSSPGLRPNSIYYVGCN
FT                   FGVHDIATDTTTNFYTHSNVPLRSTEFPYWPLPLS"
FT   exon            55840..55868
FT                   /number=1
FT   intron          55869..55913
FT                   /number=1
FT   exon            55914..56139
FT                   /number=2
FT   intron          56140..56730
FT                   /number=2
FT   exon            56731..57458
FT                   /number=3
FT   intron          57459..57534
FT                   /number=3
FT   exon            57535..57856
FT                   /number=4
FT   gene            58255..61163
FT                   /gene="AT4g25940"
FT   CDS_pept        complement(join(58255..58665,58762..58895,58977..59052,
FT                   59134..59337,59439..59516,59747..59812,59901..60017,
FT                   60093..60206,60283..60410,60507..60645,60737..60834,
FT                   60912..60981,61074..61163))
FT                   /gene="AT4g25940"
FT                   /product="predicted protein destination factor"
FT                   /note="similarity to synapse-enriched clathrin adaptor
FT                   protein LAP - Drosophila melanogaster, PID:g4160434"
FT                   /note="Contains Carbamoyl-phosphate synthase subdomain
FT                   signatures AA370-377"
FT                   /db_xref="GOA:Q8VYT2"
FT                   /db_xref="InterPro:IPR008942"
FT                   /db_xref="InterPro:IPR011417"
FT                   /db_xref="InterPro:IPR013809"
FT                   /db_xref="InterPro:IPR014712"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8VYT2"
FT                   /protein_id="CAB79449.1"
FT                   /translation="MATFNSFRKAVGAIKDSTTVSIAKVNSEFKDLDVAIVKATNHVES
FT                   APKERHIRRIFSATSVVQPRADVAYCIHALAKRLSKTRNWVVAIKVLIVIHRTLREGDP
FT                   TFREELLNYSHRGHILRISNFKDDTSPLAWDCSAWIRTYALFLEERLECYRVLKYDIEA
FT                   ERLPKGSGASSKNVDFNASQTYRTRMLSDEELLEQLPALQQLLYRLIGCQPEGSAYSNY
FT                   LIQYALALVLKESFKIYCAINDGIINLVDMFFEMSRHDAVKALNIYKRAGQQPPPSFLA
FT                   TMEDYIKEAPQSGSVQKKLEYQEKEEEEQEEEEAEHSVQPEEPAEADNQKENSEGDQPL
FT                   IEEEEEDQEKIEEEDAKPSFLIDTDDLLGLNEINPKAAEIEDRNALALAIYPPGHEAPG
FT                   PSNILSLIETGGSGWELALVTPQNNNNNNNPRPAPNTKLAGGFDNLLLDSLYEDDSARR
FT                   QIQLTNAGYGHGGIDTTAAPPNPFQMQQDPFAMSNNIAPPTNVQMAMQQQQQQQMTMMH
FT                   QSPYNYTHPHDYHQNHHHHQFSAGPSPSNPFGDAFLALPPPPGSAGPQQNNHHHMLL"
FT   exon            complement(58255..58665)
FT                   /number=1
FT   intron          complement(58666..58761)
FT                   /number=1
FT   exon            complement(58762..58895)
FT                   /number=2
FT   intron          complement(58896..58976)
FT                   /number=2
FT   exon            complement(58977..59052)
FT                   /number=3
FT   intron          complement(59053..59133)
FT                   /number=3
FT   exon            complement(59134..59337)
FT                   /number=4
FT   intron          complement(59338..59438)
FT                   /number=4
FT   exon            complement(59439..59516)
FT                   /number=5
FT   intron          complement(59517..59746)
FT                   /number=5
FT   exon            complement(59747..59812)
FT                   /number=6
FT   intron          complement(59813..59900)
FT                   /number=6
FT   exon            complement(59901..60017)
FT                   /number=7
FT   intron          complement(60018..60092)
FT                   /number=7
FT   exon            complement(60093..60206)
FT                   /number=8
FT   intron          complement(60207..60282)
FT                   /number=8
FT   exon            complement(60283..60410)
FT                   /number=9
FT   intron          complement(60411..60506)
FT                   /number=9
FT   exon            complement(60507..60645)
FT                   /number=10
FT   intron          complement(60646..60736)
FT                   /number=10
FT   exon            complement(60737..60834)
FT                   /number=11
FT   intron          complement(60835..60911)
FT                   /number=11
FT   exon            complement(60912..60981)
FT                   /number=12
FT   intron          complement(60982..61073)
FT                   /number=12
FT   exon            complement(61074..61163)
FT                   /number=13
FT   gene            62278..62787
FT                   /gene="AT4g25950"
FT   CDS_pept        complement(join(62278..62415,62490..62590,62700..62787))
FT                   /gene="AT4g25950"
FT                   /product="V-ATPase G-subunit like protein"
FT                   /note="strong similarity to G subunit of Vacuolar-type
FT                   H+-ATPase (vag1) - Arabidopsis thaliana, PID:e1330303"
FT                   /note="contains EST gb:T41851, AI993061.1, T42344"
FT                   /db_xref="GOA:Q9SZH0"
FT                   /db_xref="InterPro:IPR005124"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9SZH0"
FT                   /protein_id="CAB79450.1"
FT                   /translation="MDSLRGQGGIQMLLTAEQEAGRIVSAARTAKLARMKQAKDEAEKE
FT                   MEEYRSRLEEEYQTQVSGTDQEADAKRLDDETDVRITNLKESSSKVSKDIVKMLIKYVT
FT                   TTAA"
FT   exon            complement(62278..62415)
FT                   /number=1
FT   intron          complement(62416..62489)
FT                   /number=1
FT   exon            complement(62490..62590)
FT                   /number=2
FT   intron          complement(62591..62699)
FT                   /number=2
FT   exon            complement(62700..62787)
FT                   /number=3
FT   gene            66021..71888
FT                   /gene="AT4g25960"
FT   CDS_pept        join(66021..66263,66510..66564,66653..66828,67686..67886,
FT                   67993..68252,68356..68896,69016..69395,69513..69910,
FT                   70028..70269,70351..70598,70719..71131,71266..71606,
FT                   71685..71888)
FT                   /gene="AT4g25960"
FT                   /product="P-glycoprotein-2 (pgp2)"
FT                   /note="Contains ABC transporters family signature
FT                   AA500-514;ABC transporters family signature
FT                   AA1129-1143;ATP/GTP-binding site motif A (P-loop)
FT                   AA396-403;ATP/GTP-binding site motif A (P-loop)
FT                   AA1025-1032;Prokaryotic membrane lipoprotein lipid
FT                   attachment site AA35-45"
FT                   /note="contains EST gb:AA042620, Z34558"
FT                   /db_xref="GOA:Q8LPK2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8LPK2"
FT                   /protein_id="CAB79451.1"
FT                   /translation="MQPSGDPAPEKEKEMTQPKVSLLKLFSFADFYDCVLMTLGSVGAC
FT                   IHGASVPIFFIFFGKLINIIGLAYLFPKQASHRVAKYSLDFVYLSVAILFSSWLEVACW
FT                   MHTGERQAAKMRRAYLRSMLSQDISLFDTEASTGEVISAITSDILVVQDALSEKVGNFL
FT                   HYISRFIAGFAIGFTSVWQISLVTLSIVPLIALAGGIYAFVAIGLIARVRKSYIKAGEI
FT                   AEEVIGNVRTVQAFTGEERAVRLYREALENTYKYGRKAGLTKGLGLGSMHCVLFLSWAL
FT                   LVWFTSVVVHKDIADGGKSFTTMLNVVIAGLSLGQAAPDISAFVRAKAAAYPIFKMIER
FT                   NTVTKTSAKSGRKLGKVDGHIQFKDATFSYPSRPDVVIFDRLNLAIPAGKIVALVGGSG
FT                   SGKSTVISLIERFYEPISGAVLLDGNNISELDIKWLRGQIGLVNQEPALFATTIRENIL
FT                   YGKDDATAEEITRAAKLSEAISFINNLPEGFETQVGERGIQLSGGQKQRIAISRAIVKN
FT                   PSILLLDEATSALDAESEKSVQEALDRVMVGRTTVVVAHRLSTVRNADIIAVVHEGKIV
FT                   EFGNHENLISNPDGAYSSLLRLQETASLQRNPSLNRTLSRPHSIKYSRELSRTRSSFCS
FT                   ERESVTRPDGADPSKKVKVTVGRLYSMIRPDWMYGVCGTICAFIAGSQMPLFALGVSQA
FT                   LVSYYSGWDETQKEIKKIAILFCCASVITLIVYTIEHICFGTMGERLTLRVRENMFRAI
FT                   LKNEIGWFDEVDNTSSMLASRLESDATLLKTIVVDRSTILLQNLGLVVTSFIIAFILNW
FT                   RLTLVVLATYPLVISGHISEKLFMQGYGGDLNKAYLKANMLAGESVSNIRTVAAFCAEE
FT                   KILELYSRELLEPSKSSFRRGQIAGLFYGVSQFFIFSSYGLALWYGSTLMDKGLAGFKS
FT                   VMKTFMVLIVTALAMGETLALAPDLLKGNQMVASVFEILDRKTQIVGETSEELNNVEGT
FT                   IELKGVHFSYPSRPDVVIFRDFDLIVRAGKSMALVGQSGSGKSSVISLILRFYDPTAGK
FT                   VMIEGKDIKKLDLKALRKHIGLVQQEPALFATTIYENILYGNEGASQSEVVESAMLANA
FT                   HSFITSLPEGYSTKVGERGVQMSGGQRQRIAIARAILKNPAILLLDEATSALDVESERV
FT                   VQQALDRLMANRTTVVVAHRLSTIKNADTISVLHGGKIVEQGSHRKLVLNKSGPYFKLI
FT                   SLQQQQQP"
FT   exon            66021..66263
FT                   /number=1
FT   intron          66264..66509
FT                   /number=1
FT   exon            66510..66564
FT                   /number=2
FT   intron          66565..66652
FT                   /number=2
FT   exon            66653..66828
FT                   /number=3
FT   intron          66829..67685
FT                   /number=3
FT   exon            67686..67886
FT                   /number=4
FT   intron          67887..67992
FT                   /number=4
FT   exon            67993..68252
FT                   /number=5
FT   intron          68253..68355
FT                   /number=5
FT   exon            68356..68896
FT                   /number=6
FT   intron          68897..69015
FT                   /number=6
FT   exon            69016..69395
FT                   /number=7
FT   intron          69396..69512
FT                   /number=7
FT   exon            69513..69910
FT                   /number=8
FT   intron          69911..70027
FT                   /number=8
FT   exon            70028..70269
FT                   /number=9
FT   intron          70270..70350
FT                   /number=9
FT   exon            70351..70598
FT                   /number=10
FT   intron          70599..70718
FT                   /number=10
FT   exon            70719..71131
FT                   /number=11
FT   intron          71132..71265
FT                   /number=11
FT   exon            71266..71606
FT                   /number=12
FT   intron          71607..71684
FT                   /number=12
FT   exon            71685..71888
FT                   /number=13
FT   gene            72703..77602
FT                   /gene="AT4g25970"
FT   CDS_pept        join(72703..72888,72983..73062,73151..73175,73416..73484,
FT                   73731..73820,73904..73954,74199..74282,74487..74578,
FT                   74678..74827,74924..75008,75237..75348,75477..75577,
FT                   75912..75979,76154..76319,76473..76568,76662..76736,
FT                   76824..76916,77098..77184,77270..77320,77477..77602)
FT                   /gene="AT4g25970"
FT                   /product="putative phosphatidylserine decarboxylase"
FT                   /note="similarity to phosphatidylserine decarboxylase (EC
FT                   4.1.1.65) 2 - yeast, Pir2:S64484"
FT                   /note="Contains EF-hand calcium-binding domain
FT                   AA168-180;EF-hand calcium-binding domain
FT                   AA204-216;Prokaryotic membrane lipoprotein lipid attachment
FT                   site AA137-147"
FT                   /note="contains EST gb:AI997096.1, AA650898, AA395305,
FT                   AA597565, R30270, T43958"
FT                   /db_xref="GOA:A4GNA8"
FT                   /db_xref="InterPro:IPR002048"
FT                   /db_xref="InterPro:IPR003817"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="InterPro:IPR033177"
FT                   /db_xref="InterPro:IPR033179"
FT                   /db_xref="InterPro:IPR035892"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4GNA8"
FT                   /protein_id="CAB79452.1"
FT                   /translation="MGNGNSTETKESRRSKMRKKIQNFRSRRRLSRPGSGSVSGLASQR
FT                   SVSADDFAGIALLTLIGAEMKFKDKWLACVSFGEQTFRSEISDSTEKPIWNSTNRLLKN
FT                   NIVGYCELDLLDFVVQEPDSTCKSFDLLDPASSNVVGSMFVSCSVEDPVETETCFAKRI
FT                   LSIVDYDEDGKLSFSEFSDLMNAFGNVVAANKKEELFKAADLNGDGVVTIDELAALLAV
FT                   QQEQEPIINSCPVCGEALQLDKLNAMIHMTLCFDEGTGNQMTGGFLTDRQASYGWMFKL
FT                   SEWTHLSTYDVGLNTGSSASHIVVIDRKTKRLVEELIDSKIVMSMRAIYQSKIGLRLMD
FT                   QGAKEILQNLSEKQGKKMNSVESAQNIPSFLEFFKDQINMAEVKYPLDHFKVRKGNSWW
FT                   SFYLQTFNEFFVRELKPGARPIACMDQDDVAVSAADCRLMAFQSVDDSTRFWIKGRKFS
FT                   IKGLLGNDVQSDAFLDGSLVIFRLAPQDYHRFHSPVSGVIEKFVNVSGSLYTVNPIAVN
FT                   SKYCNVFTENKRTIVIISTAEFGKVAFVAIGATMVGSISFVRQEGDHVKKGDELGYFSF
FT                   GGSTVICVFEKDSIKIDEDLLANSARSLETLVTVGMQLGVSFPKLENCVLEP"
FT   exon            72703..72888
FT                   /number=1
FT   intron          72889..72982
FT                   /number=1
FT   exon            72983..73062
FT                   /number=2
FT   intron          73063..73150
FT                   /number=2
FT   exon            73151..73175
FT                   /number=3
FT   intron          73176..73415
FT                   /number=3
FT   exon            73416..73484
FT                   /number=4
FT   intron          73485..73730
FT                   /number=4
FT   exon            73731..73820
FT                   /number=5
FT   intron          73821..73903
FT                   /number=5
FT   exon            73904..73954
FT                   /number=6
FT   intron          73955..74198
FT                   /number=6
FT   exon            74199..74282
FT                   /number=7
FT   intron          74283..74486
FT                   /number=7
FT   exon            74487..74578
FT                   /number=8
FT   intron          74579..74677
FT                   /number=8
FT   exon            74678..74827
FT                   /number=9
FT   intron          74828..74923
FT                   /number=9
FT   exon            74924..75008
FT                   /number=10
FT   intron          75009..75236
FT                   /number=10
FT   exon            75237..75348
FT                   /number=11
FT   intron          75349..75476
FT                   /number=11
FT   exon            75477..75577
FT                   /number=12
FT   intron          75578..75911
FT                   /number=12
FT   exon            75912..75979
FT                   /number=13
FT   intron          75980..76153
FT                   /number=13
FT   exon            76154..76319
FT                   /number=14
FT   intron          76320..76472
FT                   /number=14
FT   exon            76473..76568
FT                   /number=15
FT   intron          76569..76661
FT                   /number=15
FT   exon            76662..76736
FT                   /number=16
FT   intron          76737..76823
FT                   /number=16
FT   exon            76824..76916
FT                   /number=17
FT   intron          76917..77097
FT                   /number=17
FT   exon            77098..77184
FT                   /number=18
FT   intron          77185..77269
FT                   /number=18
FT   exon            77270..77320
FT                   /number=19
FT   intron          77321..77476
FT                   /number=19
FT   exon            77477..77602
FT                   /number=20
FT   gene            77856..79970
FT                   /gene="AT4g25980"
FT   CDS_pept        join(77856..78203,78278..78460,78542..78704,79549..79970)
FT                   /gene="AT4g25980"
FT                   /product="putative peroxidase"
FT                   /note="similarity to peroxidase (EC 1.11.1.7) precursor,
FT                   cationic (clonePNC2) - peanut, PIR2:B38265"
FT                   /note="Contains Peroxidases signatures
FT                   AA226-236;Prokaryotic membrane lipoprotein lipid attachment
FT                   site AA231-241"
FT                   /note="contains EST gb:AA395305, AI997096.1, AA650898"
FT                   /db_xref="GOA:Q9SZH2"
FT                   /db_xref="InterPro:IPR000823"
FT                   /db_xref="InterPro:IPR002016"
FT                   /db_xref="InterPro:IPR010255"
FT                   /db_xref="InterPro:IPR019793"
FT                   /db_xref="InterPro:IPR033905"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9SZH2"
FT                   /protein_id="CAB79453.1"
FT                   /translation="MSVSIPVLMKRLCLYNSLSLFLFHLFPSPSLALSFSVELNLLKAQ
FT                   MVWANAKMRLALSLVTVFFGISLANLEVGFYSNTCPQAESIVKRVVSGAALSDPNLPAI
FT                   LLRLHFHDCFVEGCDGSILVNNGAISEKNAFGHEGVRGFEIVEAVKAELEAACPGVVSC
FT                   SDIVALAARDAISLANGPAYEVPTGRRDGRVSNMSLAKDMPEVSDSIEILKAKFMQKGL
FT                   NAKDLVLLSAAHTIGTTACFFMSKRLYDFLPGGQPDPTINPTFLPELTTQCPQNGDINV
FT                   RLPIDRFSERLFDKQILQNIKDGFAVLQTDAGLYEDVTTRQVVDSYLGMLNPFFGPTFE
FT                   SDFVKAIVKMGKIGVKTGFKGEIRRVCSAFN"
FT   exon            77856..78203
FT                   /number=1
FT   intron          78204..78277
FT                   /number=1
FT   exon            78278..78460
FT                   /number=2
FT   intron          78461..78541
FT                   /number=2
FT   exon            78542..78704
FT                   /number=3
FT   intron          78705..79548
FT                   /number=3
FT   exon            79549..79970
FT                   /number=4
FT   gene            80606..82006
FT                   /gene="AT4g25990"
FT   CDS_pept        complement(join(80606..80764,81029..82006))
FT                   /gene="AT4g25990"
FT                   /product="putative protein"
FT                   /note="contains EST gb:N95864, T13854, AI997884.1"
FT                   /db_xref="GOA:Q9SZH3"
FT                   /db_xref="InterPro:IPR010402"
FT                   /db_xref="UniProtKB/TrEMBL:Q9SZH3"
FT                   /protein_id="CAB79454.1"
FT                   /translation="MSSCAYSFELEMMKSPPSNNTPSPSSTISETNSPPFSISTRRPRT
FT                   PRKRPNQTYDEAAALLSTAYPKIFSSKKAKTQIFGTNKSPLSDYDEASQLLLPYVSIEE
FT                   NEFLFNPTIPTKTEHFLEQKEVSFDDLEVNGFGVLDDFDAESILDEEIEEGIDSFMGNI
FT                   ESNDGDRENCYRVGRLEEIMKNAWNGRFRLGLGLRSSLRQNNDENWWKFPTVEFDQISP
FT                   RIQTTAAAAADDGQSNVVDSSKIKTIVTAEGDKKKKKKKKKKKVAPAAAESKSSEVTDS
FT                   NPKLEQRVSPLLKLDYDGVLEAWSGKESPFSDEILGSDADGVDFHVRLGEIDLFGESGM
FT                   REASVLRYKEKRRNRLFSKKIRYQVRKLNADQRPRMKV"
FT   exon            complement(80606..80764)
FT                   /number=1
FT   intron          complement(80765..81028)
FT                   /number=1
FT   exon            complement(81029..82006)
FT                   /number=2
FT   gene            85743..88002
FT                   /gene="AT4g26000"
FT   CDS_pept        join(85743..86102,86337..86589,86749..86897,86980..87237,
FT                   87396..87587,87727..88002)
FT                   /gene="AT4g26000"
FT                   /product="putative nucleic acid binding protein"
FT                   /note="similarity to single-stranded nucleic acid-binding
FT                   protein CBP - mouse, PIR2:S78515"
FT                   /db_xref="GOA:Q9SZH4"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR004088"
FT                   /db_xref="InterPro:IPR036612"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9SZH4"
FT                   /protein_id="CAB79455.1"
FT                   /translation="MAAVADSVENNGSINLPENENLIPAGFSAAALLDENSGAFPELNQ
FT                   PDSLAAAETTFPDTNDSAEERWPGWPGDCVFRMIVPVTKVGAIIGRKGDFIKKMCEETR
FT                   ARIKVLDGPVNTPDRIVLISGKEEPEAYMSPAMDAVLRVFRRVSGLPDNDDDDVQNAGS
FT                   VFSSVRLLVASTQAINLIGKQGSLIKSIVENSGASVRILSEEETPFYAAQDERIVDLQG
FT                   EALKILKALEAIVGHLRRFLVDHTVVPLFEKQYLARVSQTRQEEPLAESKSSLHTISSN
FT                   LMEPDFSLLARREPLFLERDSRVDSRVQPSGVSIYSQDPVLSARHSPGLARVSSAFVTQ
FT                   VSQTMQIPFSYAEDIIGVEGANIAYIRRRSGATITIKESPHPDQITVEIKGTTSQVQTA
FT                   EQLIQEFIINHKEPVSVSGGYARIDSGYVPAYPPQLSNRQEPLPSTYMGTEPVQYRPTA
FT                   YSQLGGPSTYTPTLTGQTYGSEYRPASDVGGYSSYNL"
FT   exon            85743..86102
FT                   /number=1
FT   intron          86103..86336
FT                   /number=1
FT   exon            86337..86589
FT                   /number=2
FT   intron          86590..86748
FT                   /number=2
FT   exon            86749..86897
FT                   /number=3
FT   intron          86898..86979
FT                   /number=3
FT   exon            86980..87237
FT                   /number=4
FT   intron          87238..87395
FT                   /number=4
FT   exon            87396..87587
FT                   /number=5
FT   intron          87588..87726
FT                   /number=5
FT   exon            87727..88002
FT                   /number=6
FT   gene            89116..90151
FT                   /gene="AT4g26010"
FT   CDS_pept        join(89116..89343,89420..90151)
FT                   /gene="AT4g26010"
FT                   /product="putative peroxidase"
FT                   /note="strong similarity to peroxidase ATP13a - Arabidopsis
FT                   thaliana, PID:e264765"
FT                   /note="Contains Peroxidases signatures AA53-64"
FT                   /note="contains EST gb:AA605546"
FT                   /db_xref="GOA:Q93V93"
FT                   /db_xref="InterPro:IPR000823"
FT                   /db_xref="InterPro:IPR002016"
FT                   /db_xref="InterPro:IPR010255"
FT                   /db_xref="InterPro:IPR019794"
FT                   /db_xref="InterPro:IPR033905"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q93V93"
FT                   /protein_id="CAB79456.1"
FT                   /translation="MRSITALFFLFCFLAPSALAQLRTGFYSRSCPRAESIVASVVANR
FT                   FRSDKSITAAFLRMQFHDCFVRVRKLLLCVHGCDASLLIDPRPGRPSEKSTGPNASVRG
FT                   YEIIDEAKRQLEAACPRTVSCADIVTLATRDSVALAGGPRFSVPTGRRDGLRSNPNDVN
FT                   LPGPTIPVSASIQLFAAQGMNTNDMVTLIGGGHSVGVAHCSLFQDRLSDRAMEPSLKSS
FT                   LRRKCSSPNDPTTFLDQKTSFTVDNAIYGEIRRQRGILRIDQNLGLDRSTSGIVSGYAS
FT                   SNTLFRKRFAEALVKMGTIKVLTGRSGEIRRNCRVFNN"
FT   exon            89116..89343
FT                   /number=1
FT   intron          89344..89419
FT                   /number=1
FT   exon            89420..90151
FT                   /number=2
FT   gene            90712..92491
FT                   /gene="AT4g26020"
FT   CDS_pept        complement(join(90712..90848,90987..91082,91175..91308,
FT                   91391..91464,91797..91852,91940..92045,92198..92353,
FT                   92429..92491))
FT                   /gene="AT4g26020"
FT                   /product="hypothetical protein"
FT                   /db_xref="GOA:Q1PE49"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1PE49"
FT                   /protein_id="CAB79457.1"
FT                   /translation="MAATSDEQMNLLLSSFDQIYEEKPKSNSITIISSSEIKSIRSPSL
FT                   IEPNELRNLEILISSCCISLTGSFRDDLDFKIGLNEINVYRSKSNVESSRREVLEISNK
FT                   NLKEENERLKKLYTESLNNFADQEHRNALESLRQKHVTKVEELEYKIRSLLVEKATNDM
FT                   VIDRLRQDLTANKSHIQAMSKKLDRVVTEVECKYELEIQDLKDCLLMEQAEKNDISNKL
FT                   QSLQKELLISRTSIAEKQRDTTSNRQVETLKQKLMKLRKENEILKRKLSSS"
FT   exon            complement(90712..90848)
FT                   /number=1
FT   intron          complement(90849..90986)
FT                   /number=1
FT   exon            complement(90987..91082)
FT                   /number=2
FT   intron          complement(91083..91174)
FT                   /number=2
FT   exon            complement(91175..91308)
FT                   /number=3
FT   intron          complement(91309..91390)
FT                   /number=3
FT   exon            complement(91391..91464)
FT                   /number=4
FT   intron          complement(91465..91796)
FT                   /number=4
FT   exon            complement(91797..91852)
FT                   /number=5
FT   intron          complement(91853..91939)
FT                   /number=5
FT   exon            complement(91940..92045)
FT                   /number=6
FT   intron          complement(92046..92197)
FT                   /number=6
FT   exon            complement(92198..92353)
FT                   /number=7
FT   intron          complement(92354..92428)
FT                   /number=7
FT   exon            complement(92429..92491)
FT                   /number=8
FT   gene            94000..94662
FT                   /gene="AT4g26030"
FT   CDS_pept        94000..94662
FT                   /gene="AT4g26030"
FT                   /product="hypothetical protein"
FT                   /note="Contains Zinc finger, C2H2 type, domain AA160-181"
FT                   /db_xref="GOA:Q9SZH7"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="UniProtKB/TrEMBL:Q9SZH7"
FT                   /protein_id="CAB79458.1"
FT                   /translation="MVSPFSMPFIAQTSGFVNYSQVFITQTIAKRYHALIPTSNMVIVQ
FT                   NDNDRVNRFMTSYPPILKSTVNPPNDFDKQYETFTPKPIDFFCSQQDYACRQHLDIFSS
FT                   SPKHYHEQYVHKNGRSVKYICKPTEVLEEIHDEIDYEKDGGWIYSLPFEKDSSFICLKC
FT                   NSLFDTSQMLVVHTELIHSKNETKKRLKLHHQEFHGKSHKINKDQTGGQSCRRKLRQ"
FT   exon            94000..94662
FT                   /number=1
FT   gene            95298..95666
FT                   /gene="AT4g26040"
FT   CDS_pept        95298..95666
FT                   /gene="AT4g26040"
FT                   /product="hypothetical protein"
FT                   /db_xref="GOA:Q9SZH8"
FT                   /db_xref="UniProtKB/TrEMBL:Q9SZH8"
FT                   /protein_id="CAB79459.1"
FT                   /translation="MKYNLKHTEDKNFVKSKPLSKGSKQTIVGEKITKMKEESHKTKQT
FT                   KTEDPITKETYQARQRTLLQRDYLLVHIEDLLPKQVFAVSVINDYLVCIQAQGLEPMSD
FT                   VGLLGKHQFYLRTYHYFV"
FT   exon            95298..95666
FT                   /number=1
FT   gene            98988..101612
FT                   /gene="AT4g26050"
FT   CDS_pept        join(98988..99263,100435..100604,100681..101092,
FT                   101322..101612)
FT                   /gene="AT4g26050"
FT                   /product="putative leucine-rich-repeat protein"
FT                   /note="similarity to leucine-rich-repeat protein -
FT                   Helianthus annuus, PID:e120583"
FT                   /note="Contains Myc-type, 'helix-loop-helix' dimerization
FT                   domain signature AA183-198"
FT                   /db_xref="GOA:Q8RWE5"
FT                   /db_xref="InterPro:IPR001611"
FT                   /db_xref="InterPro:IPR003591"
FT                   /db_xref="InterPro:IPR032675"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8RWE5"
FT                   /protein_id="CAB79460.1"
FT                   /translation="MGYEQMNQMTMTTTAMMKNYNKKGLINTPQKKMTRRSVSAIDGGA
FT                   AATAKEGDRRQNIKTLDLSGMSLASLSASSINLASISKLDLSNNNIQKIPESLVARMLN
FT                   LWALDLQSNQLKTLPNSIGCLSKLKFLNVSGNYLQSLPKTIEDCRSLEELNANFNELTR
FT                   LPDAIGFELTNLTKLSVNSNKLVLLPNSVSYLTSLRVLDARLNRLSSLPEDLENLVNLQ
FT                   VLNVSQNFQHLTTLPYSVGLLISLVELDVSYNGITVLPDSLGCLRRIQKLSVEGNPLIS
FT                   PPFEVVEQGLEALKQYMSEKMTESYKKTPTKKKSWGIGKLVKYGLSSSPGRSTGREDGK
FT                   EGFINVSDYRQIDGIASPRHVSLFNPRRLLSPLSAYFSPPRY"
FT   exon            98988..99263
FT                   /number=1
FT   intron          99264..100434
FT                   /number=1
FT   exon            100435..100604
FT                   /number=2
FT   intron          100605..100680
FT                   /number=2
FT   exon            100681..101092
FT                   /number=3
FT   intron          101093..101321
FT                   /number=3
FT   exon            101322..101612
FT                   /number=4
FT   gene            103435..104418
FT                   /gene="AT4g26060"
FT   CDS_pept        complement(join(103435..103488,103574..103691,
FT                   103785..103899,104021..104125,104409..104418))
FT                   /gene="AT4g26060"
FT                   /product="putative protein"
FT                   /note="EST t76182 spans intron in 5' untranslated region,
FT                   EST t76182 marks 5' end"
FT                   /note="contains EST gb:AI993300.1, AA404921"
FT                   /db_xref="GOA:Q9SZI0"
FT                   /db_xref="UniProtKB/TrEMBL:Q9SZI0"
FT                   /protein_id="CAB79461.1"
FT                   /translation="MGETVKERGDGSAELVKSVADKHAGLVRPVAKYYSAVKDAMVCGK
FT                   GRYTLVKDVDEVENGVYDKPLPCFGCGIGWFSFLLGFVFPFLWYYATLLYFGNYYRKDP
FT                   RERAGLAASAITAMGFSLLLLVIVVFWWL"
FT   exon            complement(103435..103488)
FT                   /number=1
FT   intron          complement(103489..103573)
FT                   /number=1
FT   exon            complement(103574..103691)
FT                   /number=2
FT   intron          complement(103692..103784)
FT                   /number=2
FT   exon            complement(103785..103899)
FT                   /number=3
FT   intron          complement(103900..104020)
FT                   /number=3
FT   exon            complement(104021..104125)
FT                   /number=4
FT   intron          complement(104126..104408)
FT                   /number=4
FT   exon            complement(104409..104418)
FT                   /number=5
FT   gene            106260..108158
FT                   /gene="AT4g26070"
FT   CDS_pept        join(106260..106330,106610..106694,106781..106915,
FT                   107002..107226,107326..107508,107617..107840,
FT                   107924..107969,108063..108158)
FT                   /gene="AT4g26070"
FT                   /product="mitogen activated protein kinase kinase (nMAPKK)"
FT                   /note="Contains Protein kinases signatures and profile
FT                   AA74-97;Protein kinases signatures and profile AA186-198"
FT                   /note="contains EST gb:F15483, T22531, Z24533"
FT                   /db_xref="GOA:Q94A06"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q94A06"
FT                   /protein_id="CAB79462.1"
FT                   /translation="MNRGSLCPNPICLPPLEQSISKFLTQSGTFKDGDLRVNKDGIQTV
FT                   SLSEPGAPPPIEPLDNQLSLADLEVIKVIGKGSSGNVQLVKHKLTQQFFALKVIQLNTE
FT                   ESTCRAISQELRINLSSQCPYLVSCYQSFYHNGLVSIILEFMDGGSLADLLKKVGKVPE
FT                   NMLSAICKRVLRGLCYIHHERRIIHRDLKPSNLLINHRGEVKITDFGVSKILTSTSSLA
FT                   NSFVGTYPYMSPERISGSLYSNKSDIWSLGLVLLECATGKFPYTPPEHKKGWSSVYELV
FT                   DAIVENPPPCAPSNLFSPEFCSFISQCVQKDPRDRKSAKELLEHKFVKMFEDSDTNLSA
FT                   YFTDAGSLIPPLAN"
FT   exon            106260..106330
FT                   /number=1
FT   intron          106331..106609
FT                   /number=1
FT   exon            106610..106694
FT                   /number=2
FT   intron          106695..106780
FT                   /number=2
FT   exon            106781..106915
FT                   /number=3
FT   intron          106916..107001
FT                   /number=3
FT   exon            107002..107226
FT                   /number=4
FT   intron          107227..107325
FT                   /number=4
FT   exon            107326..107508
FT                   /number=5
FT   intron          107509..107616
FT                   /number=5
FT   exon            107617..107840
FT                   /number=6
FT   intron          107841..107923
FT                   /number=6
FT   exon            107924..107969
FT                   /number=7
FT   intron          107970..108062
FT                   /number=7
FT   exon            108063..108158
FT                   /number=8
FT   gene            108694..110291
FT                   /gene="AT4g26080"
FT   CDS_pept        complement(join(108694..109052,109145..109250,
FT                   109382..109672,109743..110291))
FT                   /gene="AT4g26080"
FT                   /product="protein phosphatase ABI1"
FT                   /note="ESTs GB:T41705 and GB:H36868 in 5' untranslated
FT                   region, one AA difference between PIR2:A54588 and this
FT                   protein"
FT                   /note="protein phosphatase 2C involved in ABA signal
FT                   transduction"
FT                   /note="Contains ATP/GTP-binding site motif A (P-loop)
FT                   AA264-271;EF-hand calcium-binding domain AA93-105;Protein
FT                   phosphatase 2C signature AA172-180"
FT                   /note="contains EST gb:W43346"
FT                   /db_xref="GOA:P49597"
FT                   /db_xref="InterPro:IPR000222"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR015655"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="PDB:3JRQ"
FT                   /db_xref="PDB:3KDJ"
FT                   /db_xref="PDB:3NMN"
FT                   /db_xref="UniProtKB/Swiss-Prot:P49597"
FT                   /protein_id="CAB79463.1"
FT                   /translation="MEEVSPAIAGPFRPFSETQMDFTGIRLGKGYCNNQYSNQDSENGD
FT                   LMVSLPETSSCSVSGSHGSESRKVLISRINSPNLNMKESAAADIVVVDISAGDEINGSD
FT                   ITSEKKMISRTESRSLFEFKSVPLYGFTSICGRRPEMEDAVSTIPRFLQSSSGSMLDGR
FT                   FDPQSAAHFFGVYDGHGGSQVANYCRERMHLALAEEIAKEKPMLCDGDTWLEKWKKALF
FT                   NSFLRVDSEIESVAPETVGSTSVVAVVFPSHIFVANCGDSRAVLCRGKTALPLSVDHKP
FT                   DREDEAARIEAAGGKVIQWNGARVFGVLAMSRSIGDRYLKPSIIPDPEVTAVKRVKEDD
FT                   CLILASDGVWDVMTDEEACEMARKRILLWHKKNAVAGDASLLADERRKEGKDPAAMSAA
FT                   EYLSKLAIQRGSKDNISVVVVDLKPRRKLKSKPLN"
FT   exon            complement(108694..109052)
FT                   /number=1
FT   intron          complement(109053..109144)
FT                   /number=1
FT   exon            complement(109145..109250)
FT                   /number=2
FT   intron          complement(109251..109381)
FT                   /number=2
FT   exon            complement(109382..109672)
FT                   /number=3
FT   intron          complement(109673..109742)
FT                   /number=3
FT   exon            complement(109743..110291)
FT                   /number=4
FT   gene            113059..115788
FT                   /gene="AT4g26090"
FT   CDS_pept        113059..115788
FT                   /gene="AT4g26090"
FT                   /product="disease resistance protein RPS2"
FT                   /note="EST GB:AA394692 in 3' untranslated region"
FT                   /note="leucine-rich repeat class of plant disease
FT                   resistance genes"
FT                   /note="Contains ATP/GTP-binding site motif A (P-loop)
FT                   AA182-189"
FT                   /note="contains EST gb:T88149, R64932, AA651048, N65834"
FT                   /db_xref="GOA:Q42484"
FT                   /db_xref="InterPro:IPR001611"
FT                   /db_xref="InterPro:IPR002182"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032675"
FT                   /db_xref="PDB:2FT5"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q42484"
FT                   /protein_id="CAB79464.1"
FT                   /translation="MDFISSLIVGCAQVLCESMNMAERRGHKTDLRQAITDLETAIGDL
FT                   KAIRDDLTLRIQQDGLEGRSCSNRAREWLSAVQVTETKTALLLVRFRRREQRTRMRRRY
FT                   LSCFGCADYKLCKKVSAILKSIGELRERSEAIKTDGGSIQVTCREIPIKSVVGNTTMME
FT                   QVLEFLSEEEERGIIGVYGPGGVGKTTLMQSINNELITKGHQYDVLIWVQMSREFGECT
FT                   IQQAVGARLGLSWDEKETGENRALKIYRALRQKRFLLLLDDVWEEIDLEKTGVPRPDRE
FT                   NKCKVMFTTRSIALCNNMGAEYKLRVEFLEKKHAWELFCSKVWRKDLLESSSIRRLAEI
FT                   IVSKCGGLPLALITLGGAMAHRETEEEWIHASEVLTRFPAEMKGMNYVFALLKFSYDNL
FT                   ESDLLRSCFLYCALFPEEHSIEIEQLVEYWVGEGFLTSSHGVNTIYKGYFLIGDLKAAC
FT                   LLETGDEKTQVKMHNVVRSFALWMASEQGTYKELILVEPSMGHTEAPKAENWRQALVIS
FT                   LLDNRIQTLPEKLICPKLTTLMLQQNSSLKKIPTGFFMHMPVLRVLDLSFTSITEIPLS
FT                   IKYLVELYHLSMSGTKISVLPQELGNLRKLKHLDLQRTQFLQTIPRDAICWLSKLEVLN
FT                   LYYSYAGWELQSFGEDEAEELGFADLEYLENLTTLGITVLSLETLKTLFEFGALHKHIQ
FT                   HLHVEECNELLYFNLPSLTNHGRNLRRLSIKSCHDLEYLVTPADFENDWLPSLEVLTLH
FT                   SLHNLTRVWGNSVSQDCLRNIRCINISHCNKLKNVSWVQKLPKLEVIELFDCREIEELI
FT                   SEHESPSVEDPTLFPSLKTLRTRDLPELNSILPSRFSFQKVETLVITNCPRVKKLPFQE
FT                   RRTQMNLPTVYCEEKWWKALEKDQPNEELCYLPRFVPN"
FT   exon            113059..115788
FT                   /number=1
FT   gene            116348..118971
FT                   /gene="AT4g26100"
FT   CDS_pept        complement(join(116348..116596,116709..116824,
FT                   116916..116979,117056..117138,117212..117338,
FT                   117427..117511,117601..117664,117784..117845,
FT                   117952..118022,118115..118210,118302..118450,
FT                   118543..118612,118761..118801,118896..118971))
FT                   /gene="AT4g26100"
FT                   /product="Col-0 casein kinase I-like protein"
FT                   /note="several discrepancies between PID:g549973 and this
FT                   protein"
FT                   /note="Contains Protein kinases signatures and profile
FT                   AA15-38;Protein kinases signatures and profile AA124-136"
FT                   /note="contains EST gb:AI992386.1, AI823126.1, H77130,
FT                   H37603, N96161, AI822644.1, T13780, R90041, Z17920"
FT                   /db_xref="GOA:P42158"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/Swiss-Prot:P42158"
FT                   /protein_id="CAB79465.1"
FT                   /translation="MEPRVGNKFRLGRKIGSGSFGEIYLGTNIHTNEELAIKLENVKTK
FT                   HPQLLYESKLYRILQGGTGVPNVKWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKS
FT                   VLMLADQMINRVEFFHSKSFLHRDLKPDNFLMGLGRRANQVYIIDFGLAKKYRDSTTHQ
FT                   HIPYRENKNLTGTARYASMNTHLGIEQSRRDDLESLGYILMYFLKGSLPWQGLKAGTKK
FT                   QKYERISEKKVSTSIEALCRGYPSEFASYFHYCRSLRFDDKPDYAYLKRIFRDLFIREG
FT                   FQFDYVFDWTILKYQQSQLTAPPSRALNPAVGTSAALPPGISNIDRYTGEEEGRPHMES
FT                   SRRRVSGALDNSGNISNQPTSSSARDSMIPSSSLFAQSAGSSRRVTAVSGSRDNFPGSE
FT                   ELLQRSRTGDVSRGVIPRNSPGEAGKSTRRHYESVVKGIDNLQVSDEHHPH"
FT   exon            complement(116348..116596)
FT                   /number=1
FT   intron          complement(116597..116708)
FT                   /number=1
FT   exon            complement(116709..116824)
FT                   /number=2
FT   intron          complement(116825..116915)
FT                   /number=2
FT   exon            complement(116916..116979)
FT                   /number=3
FT   intron          complement(116980..117055)
FT                   /number=3
FT   exon            complement(117056..117138)
FT                   /number=4
FT   intron          complement(117139..117211)
FT                   /number=4
FT   exon            complement(117212..117338)
FT                   /number=5
FT   intron          complement(117339..117426)
FT                   /number=5
FT   exon            complement(117427..117511)
FT                   /number=6
FT   intron          complement(117512..117600)
FT                   /number=6
FT   exon            complement(117601..117664)
FT                   /number=7
FT   intron          complement(117665..117783)
FT                   /number=7
FT   exon            complement(117784..117845)
FT                   /number=8
FT   intron          complement(117846..117951)
FT                   /number=8
FT   exon            complement(117952..118022)
FT                   /number=9
FT   intron          complement(118023..118114)
FT                   /number=9
FT   exon            complement(118115..118210)
FT                   /number=10
FT   intron          complement(118211..118301)
FT                   /number=10
FT   exon            complement(118302..118450)
FT                   /number=11
FT   intron          complement(118451..118542)
FT                   /number=11
FT   exon            complement(118543..118612)
FT                   /number=12
FT   intron          complement(118613..118760)
FT                   /number=12
FT   exon            complement(118761..118801)
FT                   /number=13
FT   intron          complement(118802..118895)
FT                   /number=13
FT   exon            complement(118896..118971)
FT                   /number=14
FT   gene            121175..123965
FT                   /gene="AT4g26110"
FT   CDS_pept        join(121175..121220,121343..121386,121582..121677,
FT                   121838..121930,122083..122173,122267..122328,
FT                   122418..122602,122741..122918,122997..123040,
FT                   123178..123367,123473..123490,123894..123965)
FT                   /gene="AT4g26110"
FT                   /product="nucleosome assembly protein I-like protein"
FT                   /note="strong similarity to nucleosome assembly protein 1
FT                   (NAP-1) - soybean, PIR2:S60892"
FT                   /note="contains EST gb:H36668, T42955, R83963"
FT                   /db_xref="GOA:Q9SZI2"
FT                   /db_xref="InterPro:IPR002164"
FT                   /db_xref="InterPro:IPR037231"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9SZI2"
FT                   /protein_id="CAB79466.1"
FT                   /translation="MSNDKDSFNVSDLTAALKDEDRAGLVNALKNKLQNLAGQRSDVLE
FT                   NLTPNVRKRVDALRDIQSQHDELEAKFREERAILEAKYQTLYQPLYVKRYEIVNGTTEV
FT                   ELAPEDDTKVDQGEEKTAEEKGVPSFWLTALKNNDVISEEVTERDEGALKYLKDIKWCK
FT                   IEEPKGFKLEFFFDTNPYFKNTVLTKSYHMIDEDEPLLEKAMGTEIDWYPGKCLTQKIL
FT                   KKKPKKGSKNTKPITKLEDCESFFNFFSPPEVPDEDEDIDEERAEDLQNLMEQDYDIGS
FT                   TIREKIIPRAVSWFTGEAMEAEDFEIDDDEEDDIDEDEDEEDEEDEEDDDDEDEEESKT
FT                   KKKPSIGNKKGGRSQIVGEGKQDERPPECKQQ"
FT   exon            121175..121220
FT                   /number=1
FT   intron          121221..121342
FT                   /number=1
FT   exon            121343..121386
FT                   /number=2
FT   intron          121387..121581
FT                   /number=2
FT   exon            121582..121677
FT                   /number=3
FT   intron          121678..121837
FT                   /number=3
FT   exon            121838..121930
FT                   /number=4
FT   intron          121931..122082
FT                   /number=4
FT   exon            122083..122173
FT                   /number=5
FT   intron          122174..122266
FT                   /number=5
FT   exon            122267..122328
FT                   /number=6
FT   intron          122329..122417
FT                   /number=6
FT   exon            122418..122602
FT                   /number=7
FT   intron          122603..122740
FT                   /number=7
FT   exon            122741..122918
FT                   /number=8
FT   intron          122919..122996
FT                   /number=8
FT   exon            122997..123040
FT                   /number=9
FT   intron          123041..123177
FT                   /number=9
FT   exon            123178..123367
FT                   /number=10
FT   intron          123368..123472
FT                   /number=10
FT   exon            123473..123490
FT                   /number=11
FT   intron          123491..123893
FT                   /number=11
FT   exon            123894..123965
FT                   /number=12
FT   gene            124911..126950
FT                   /gene="AT4g26120"
FT   CDS_pept        join(124911..125468,125539..126277,126363..126566,
FT                   126649..126950)
FT                   /gene="AT4g26120"
FT                   /product="NPR1 like protein"
FT                   /note="strong similarity to regulatory protein NPR1 -
FT                   Arabidopsis thaliana, PID:g1773295"
FT                   /note="contains EST gb:AI997958.1, T22612, AA395706"
FT                   /db_xref="GOA:Q9SZI3"
FT                   /db_xref="InterPro:IPR000210"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR011333"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="InterPro:IPR021094"
FT                   /db_xref="InterPro:IPR024228"
FT                   /db_xref="InterPro:IPR036770"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9SZI3"
FT                   /protein_id="CAB79467.1"
FT                   /translation="MATTTTTTTARFSDSYEFSNTSGNSFFAAESSLDYPTEFLTPPEV
FT                   SALKLLSNCLESVFDSPETFYSDAKLVLAGGREVSFHRCILSARIPVFKSALATVKEQK
FT                   SSTTVKLQLKEIARDYEVGFDSVVAVLAYVYSGRVRSPPKGASACVDDDCCHVACRSKV
FT                   DFMVEVLYLSFVFQIQELVTLYERQFLEIVDKVVVEDILVIFKLDTLCGTTYKKLLDRC
FT                   IEIIVKSDIELVSLEKSLPQHIFKQIIDIREALCLEPPKLERHVKNIYKALDSDDVELV
FT                   KMLLLEGHTNLDEAYALHFAIAHCAVKTAYDLLELELADVNLRNPRGYTVLHVAAMRKE
FT                   PKLIISLLMKGANILDTTLDGRTALVIVKRLTKADDYKTSTEDGTPSLKGGLCIEVLEH
FT                   EQKLEYLSPIEASLSLPVTPEELRMRLLYYENRVALARLLFPVETETVQGIAKLEETCE
FT                   FTASSLEPDHHIGEKRTSLDLNMAPFQIHEKHLSRLRALCKTVELGKRYFKRCSLDHFM
FT                   DTEDLNHLASVEEDTPEKRLQKKQRYMELQETLMKTFSEDKEECGKSSTPKPTSAVRSN
FT                   RKLSHRRLKVDKRDFLKRPYGNGD"
FT   exon            124911..125468
FT                   /number=1
FT   repeat_region   124915..124937
FT   intron          125469..125538
FT                   /number=1
FT   exon            125539..126277
FT                   /number=2
FT   intron          126278..126362
FT                   /number=2
FT   exon            126363..126566
FT                   /number=3
FT   intron          126567..126648
FT                   /number=3
FT   exon            126649..126950
FT                   /number=4
FT   gene            128866..129726
FT                   /gene="AT4g26130"
FT   CDS_pept        complement(128866..129726)
FT                   /gene="AT4g26130"
FT                   /product="uncharacterized protein"
FT                   /note="weak similarity to cotton fiber expressed protein 1
FT                   - Gossypium hirsutum, PID:g3264828"
FT                   /note="contains EST gb:T20837, AA712947"
FT                   /db_xref="GOA:Q9SZI4"
FT                   /db_xref="InterPro:IPR008480"
FT                   /db_xref="InterPro:IPR025520"
FT                   /db_xref="UniProtKB/TrEMBL:Q9SZI4"
FT                   /protein_id="CAB79468.1"
FT                   /translation="MELLTSLTNWLTPTTLFLLLNFTIATIFITNRFSSCSRKHNQHQD
FT                   GYGSSGHDQNQARFGRPPSLIDRVKSINFHLYNSPSPESEIHYSGSDPNPNPPPSLLQR
FT                   VKSINMPYFKFPQHNSEGDYAAYELMTQPDETNRVDPIDKIPEDDVTTEPRFGAPSLLQ
FT                   RVKSIKLPSLYRSDPDPTPEVQTHTRTKSESSKPATKKKKKATKKMMKSASERHIGREE
FT                   EETVEAVEKRRPETMRVERTTSIGDGGEEGVDDKASNFINKFKQQLKLQRLDSFLRYRE
FT                   MLKND"
FT   exon            complement(128866..129726)
FT                   /number=1
FT   gene            131682..136286
FT                   /gene="AT4g26140"
FT   CDS_pept        complement(join(131682..131793,131873..132078,
FT                   132185..132298,132383..132493,132577..132686,
FT                   132762..132868,132971..133152,133248..133409,
FT                   133505..133623,133716..133800,133884..133989,
FT                   134134..134222,134949..135092,135207..135299,
FT                   135389..135455,135555..135667,135757..135852,
FT                   136113..136286))
FT                   /gene="AT4g26140"
FT                   /product="putative beta-galactosidase"
FT                   /note="strong similarity to beta-galactosidase precursor -
FT                   Carica papaya, PID:g3869280"
FT                   /note="Contains Glycosyl hydrolases family 35 putative
FT                   active site AA174-186"
FT                   /note="contains EST gb:T41862, T42972, AI994377.1, N37457,
FT                   N96962, N96096, N38429, F14066, AA657315, F14142, W43678,
FT                   Z26762, Z26106, AA395011, Z37275, AI100297, T42501"
FT                   /db_xref="GOA:Q9SCV0"
FT                   /db_xref="InterPro:IPR001944"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR019801"
FT                   /db_xref="InterPro:IPR031330"
FT                   /db_xref="InterPro:IPR041392"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9SCV0"
FT                   /protein_id="CAB79469.1"
FT                   /translation="MGLNFREKAWILLGILCCSSLICSVKAIVTYDRKAVIINGQRRIL
FT                   LSGSIHYPRSTPEMWPDLIQKAKDGGLDVIQTYVFWNGHEPSPGQYYFEDRYDLVKFIK
FT                   VVQQAGLYVHLRIGPYVCAEWNFGGFPVWLKYVPGMVFRTDNEPFKAAMQKFTEKIVRM
FT                   MKEEKLFETQGGPIILSQIENEYGPIEWEIGAPGKAYTKWVAEMAQGLSTGVPWIMCKQ
FT                   DDAPNSIINTCNGFYCENFKPNSDNKPKMWTENWTGWFTEFGGAVPYRPAEDIALSVAR
FT                   FIQNGGSFINYYMYHGGTNFDRTAGEFIATSYDYDAPLDEYGLPREPKYSHLKRLHKVI
FT                   KLCEPALVSADPTVTSLGDKQEAHVFKSKSSCAAFLSNYNTSSAARVLFGGSTYDLPPW
FT                   SVSILPDCKTEYYNTAKVQVRTSSIHMKMVPTNTPFSWGSYNEEIPSANDNGTFSQDGL
FT                   VEQISITRDKTDYFWYLTDITISPDEKFLTGEDPLLTIGSAGHALHVFVNGQLAGTAYG
FT                   SLEKPKLTFSQKIKLHAGVNKLALLSTAAGLPNVGVHYETWNTGVLGPVTLNGVNSGTW
FT                   DMTKWKWSYKQIGTKGEALSVHTLAGSSTVEWKEGSLVAKKQPLTWYKSTFDSPTGNEP
FT                   LALDMNTMGKGQMWINGQNIGRHWPAYTARGKCERCSYAGTFTEKKCLSNCGEASQRWY
FT                   HVPRSWLKPTNNLVIVLEEWGGEPNGISLVKRTAK"
FT   exon            complement(131682..131793)
FT                   /number=1
FT   intron          complement(131794..131872)
FT                   /number=1
FT   exon            complement(131873..132078)
FT                   /number=2
FT   intron          complement(132079..132184)
FT                   /number=2
FT   exon            complement(132185..132298)
FT                   /number=3
FT   intron          complement(132299..132382)
FT                   /number=3
FT   exon            complement(132383..132493)
FT                   /number=4
FT   intron          complement(132494..132576)
FT                   /number=4
FT   exon            complement(132577..132686)
FT                   /number=5
FT   intron          complement(132687..132761)
FT                   /number=5
FT   exon            complement(132762..132868)
FT                   /number=6
FT   intron          complement(132869..132970)
FT                   /number=6
FT   exon            complement(132971..133152)
FT                   /number=7
FT   intron          complement(133153..133247)
FT                   /number=7
FT   exon            complement(133248..133409)
FT                   /number=8
FT   intron          complement(133410..133504)
FT                   /number=8
FT   exon            complement(133505..133623)
FT                   /number=9
FT   intron          complement(133624..133715)
FT                   /number=9
FT   exon            complement(133716..133800)
FT                   /number=10
FT   intron          complement(133801..133883)
FT                   /number=10
FT   exon            complement(133884..133989)
FT                   /number=11
FT   intron          complement(133990..134133)
FT                   /number=11
FT   exon            complement(134134..134222)
FT                   /number=12
FT   intron          complement(134223..134948)
FT                   /number=12
FT   exon            complement(134949..135092)
FT                   /number=13
FT   intron          complement(135093..135206)
FT                   /number=13
FT   exon            complement(135207..135299)
FT                   /number=14
FT   intron          complement(135300..135388)
FT                   /number=14
FT   exon            complement(135389..135455)
FT                   /number=15
FT   intron          complement(135456..135554)
FT                   /number=15
FT   exon            complement(135555..135667)
FT                   /number=16
FT   intron          complement(135668..135756)
FT                   /number=16
FT   exon            complement(135757..135852)
FT                   /number=17
FT   intron          complement(135853..136112)
FT                   /number=17
FT   exon            complement(136113..136286)
FT                   /number=18
FT   gene            141673..143122
FT                   /gene="AT4g26150"
FT   CDS_pept        join(141673..141954,142037..142414,142724..143122)
FT                   /gene="AT4g26150"
FT                   /product="putative transcription factor"
FT                   /note="similarity to Arabidopsis thaliana mRNA for GATA
FT                   transcription factor 3, PID:e1254739"
FT                   /note="contains EST gb:AI998668.1"
FT                   /db_xref="GOA:Q9SZI6"
FT                   /db_xref="InterPro:IPR000679"
FT                   /db_xref="InterPro:IPR013088"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9SZI6"
FT                   /protein_id="CAB79470.1"
FT                   /translation="MGSNFHYTIDLNEDQNHQPFFASLGSSLHHHLQQQQQQQQHFHHQ
FT                   ASSNPSSLMSPSLSYFPFLINSRQDQVYVGYNNNTFHDVLDTHISQPLETKNFVSDGGS
FT                   SSSDQMVPKKETRLKLTIKKKDNHQDQTDLPQSPIKDMTGTNSLKWISSKVRLMKKKKA
FT                   IITTSDSSKQHTNNDQSSNLSNSERQNGYNNDCVIRICSDCNTTKTPLWRSGPRGPKSL
FT                   CNACGIRQRKARRAAMATATATAVSGVSPPVMKKKMQNKNKISNGVYKILSPLPLKVNT
FT                   CKRMITLEETALAEDLETQSNSTMLSSSDNIYFDDLALLLSKSSAYQQVFPQDEKEAAI
FT                   LLMALSHGMVHG"
FT   exon            141673..141954
FT                   /number=1
FT   repeat_region   141768..141794
FT   intron          141955..142036
FT                   /number=1
FT   exon            142037..142414
FT                   /number=2
FT   intron          142415..142723
FT                   /number=2
FT   exon            142724..143122
FT                   /number=3
FT   gene            143759..145095
FT                   /gene="AT4g26160"
FT   CDS_pept        join(143759..143977,144350..144532,144697..144861,
FT                   144997..145095)
FT                   /gene="AT4g26160"
FT                   /product="putative thioredoxin"
FT                   /note="similarity to thioredoxin - Lilium longiflorum,
FT                   PID:g308906"
FT                   /note="Contains Thioredoxin family active site AA117-135"
FT                   /note="contains EST gb:N65681, T43004"
FT                   /db_xref="GOA:Q8LEK4"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8LEK4"
FT                   /protein_id="CAB79471.1"
FT                   /translation="MSPTTTSLRSLSFSLYASSNSTPISTPIEARQLLSSCNRFYGLSS
FT                   SSSSSSLTTSSLIGNLVFSSRNQSLSVKVQALAAETEQPKWWERKAGPNMIDITSAEQF
FT                   LNALKDAGDRLVIVDFYGTWCGSCRAMFPKLCKTAKEHPNILFLKVNFDENKSLCKSLN
FT                   VKVLPYFHFYRGADGQVESFSCSLAKFQKLREAIERHNVGSISNISSSASEKVEDSSE"
FT   exon            143759..143977
FT                   /number=1
FT   intron          143978..144349
FT                   /number=1
FT   exon            144350..144532
FT                   /number=2
FT   misc_feature    144355..155424
FT                   /note="overlap to BAC F20B18; please refer to EMBL:AL049483
FT                   entry for analysis and annotation"
FT   intron          144533..144696
FT                   /number=2
FT   exon            144697..144861
FT                   /number=3
FT   intron          144862..144996
FT                   /number=3
FT   exon            144997..145095
FT                   /number=4
FT   gene            146796..147845
FT                   /gene="AT4g26170"
FT   CDS_pept        <146796..147845
FT                   /gene="AT4g26170"
FT                   /product="putative transcription factor"
FT                   /note="contains EST gb:AI999154.1"
FT                   /db_xref="GOA:F4JU69"
FT                   /db_xref="InterPro:IPR038909"
FT                   /db_xref="UniProtKB/Swiss-Prot:F4JU69"
FT                   /protein_id="CAB79472.1"
FT                   /translation="KQILIGANEKENFREGKDLVGRNRVQGAFQGLYELSHDHGRKDDV
FT                   LVANLGQPESIRSRLRSYSRSFAHHDLLKQGLSQTILPTTQNKSDNQTEEKKSDSEEER
FT                   EVSSDAAEKESNSLPSILRLSRSRPQPVSEKHDDIVDESDSASACGVLLEDGTTCTTTP
FT                   VKGRKRCTEHKGKRLSRVSPGIHIPCEVPTVRECEETENICGVILPDMIRCRSKPVSRR
FT                   KRCEDHKGMRVNAFFFLLNPTERDKAVNEDKSKPETSTGMNQEGSGLLCEATTKNGLPC
FT                   TRSAPEGSKRCWQHKDKTLNHGSSENVQSATASQVICGFKLYNGSVCEKSPVKGRKRCE
FT                   EHKGMRITS"
FT   exon            146796..147845
FT                   /number=1
FT   gene            148726..150350
FT                   /gene="AT4g26180"
FT   CDS_pept        complement(join(148726..148851,148938..149063,
FT                   149156..149340,149437..149545,149649..149856,
FT                   149941..150026,150213..150350))
FT                   /gene="AT4g26180"
FT                   /product="putative mitochondrial carrier protein"
FT                   /note="similarity to Graves disease mitochondrial solute
FT                   carrier protein- bovine, PIR2:S26596"
FT                   /note="Contains Mitochondrial energy transfer proteins
FT                   signature AA37-46"
FT                   /note="contains EST gb:W43405, N38479"
FT                   /db_xref="GOA:F4JU70"
FT                   /db_xref="InterPro:IPR002067"
FT                   /db_xref="InterPro:IPR002167"
FT                   /db_xref="InterPro:IPR018108"
FT                   /db_xref="InterPro:IPR023395"
FT                   /db_xref="UniProtKB/Swiss-Prot:F4JU70"
FT                   /protein_id="CAB79473.1"
FT                   /translation="MAEGEEKNGIIDSIPLFAKELIAGGVTGGIAKTAVAPLERIKILF
FT                   QTRRDEFKRIGLVGSINKIGKTEGLMGFYRGNGASVARIVPYAALHYMAYEEYRRWIIF
FT                   GFPDTTRGPLLDLVAGSFAGGTAVLFTYPLDLVRTKLAYQTQVKAIPVEQIIYRGIVDC
FT                   FSRTYRESGARGLYRGVAPSLYGIFPYAGLKFYFYEEMKRHVPPEHKQDISLKLVCGSV
FT                   AGLLGQTLTYPLDVVRRQMQVERLYSAVKEETRRGTMQTLFKIAREEGWKQLFSGLSIN
FT                   YLKVVPSVAIGFTVYDIMKLHLRVPPREEPEAEAVTTRKRKVFT"
FT   exon            complement(148726..148851)
FT                   /number=1
FT   intron          complement(148852..148937)
FT                   /number=1
FT   exon            complement(148938..149063)
FT                   /number=2
FT   intron          complement(149064..149155)
FT                   /number=2
FT   exon            complement(149156..149340)
FT                   /number=3
FT   intron          complement(149341..149436)
FT                   /number=3
FT   exon            complement(149437..149545)
FT                   /number=4
FT   intron          complement(149546..149648)
FT                   /number=4
FT   exon            complement(149649..149856)
FT                   /number=5
FT   intron          complement(149857..149940)
FT                   /number=5
FT   exon            complement(149941..150026)
FT                   /number=6
FT   intron          complement(150027..150212)
FT                   /number=6
FT   exon            complement(150213..150350)
FT                   /number=7
FT   gene            150936..154745
FT                   /gene="AT4g26190"
FT   CDS_pept        complement(join(150936..151090,151172..151232,
FT                   151327..151512,151763..151826,151897..152008,
FT                   152120..154745))
FT                   /gene="AT4g26190"
FT                   /product="putative protein"
FT                   /note="similarity to mature-parasite-infected erythrocyte
FT                   surface antigen MESA - Plasmodium falciparum, PIR2:A45605"
FT                   /note="Contains ATP/GTP-binding site motif A (P-loop)
FT                   AA487-494"
FT                   /note="contains EST gb:Z34071, F19808"
FT                   /db_xref="InterPro:IPR004274"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:Q9SZJ0"
FT                   /protein_id="CAB79474.1"
FT                   /translation="MESVSVETLSETGNSNDGQTNPELIDKHKKRSGKKKRKSRKLDNE
FT                   VKDNDSHISSQIGNADEAFSSQEKKEGENEKSTSESQVRLSENLLSSLPAESCQRDSVS
FT                   CEEPRATLHHTDPISCEDSLPDDNRKGSSTKKSKRREKKKKKEDLSCEEKLLDEVEKIT
FT                   SEDQVHPPNNPLSNGMVQERSGELTQDSCEKPGAAQICTDPNLSTCKDSLPDATNMTSS
FT                   SKRKRNKRRDRNVLKESGVDIGSTNAEVAVTDNTTTEAEGSRSMSIEENSVASVLINGC
FT                   LKSKVDTVEQLDGTDVQINETVFQTQSTKAKKRKKKKTKTMEACDPLGNTLPTSTESGP
FT                   VECVENNDGNKEKDGNTEVKEDVREVKYDTISEAEGSKSTTKEEKSVASVVISSCLKSK
FT                   DDTVEQKECTDVNISETVAQTQDPKAKRRKKRKTETIEVCDPLGNTLSTSMKSGPVERV
FT                   ENNDGNGGRELISYSASQTENYVNGEENGIQNLGKTKEKETDENTEVKEDVLGAGVCDV
FT                   RSKKRKGKKKKTSSADMEVFEPSGSVECLLNQSNEKDMQNFDGNAGQEFGGEDMTIKIE
FT                   KSATREKSGVQKSGKRKEMTKDKNIESNQDALDAEGVSDDGHKREKRKIKNKTNCESVA
FT                   TMDSESVQSLLYQSNGEGVKNYEGNADGEIASKDLASNIEDSATKGESVQDDKNTKKRK
FT                   KDRKGEVDQDAKGAEGVSTVEVTTKKSKKKKNLLDHKTDNMEEDSIKKNEKKEEVDQND
FT                   LGAEGVSKVEVKTKKSKRKKNSLDHKTDDMEGKDDVSLPRKDEEPEFDREKLETSLSSS
FT                   VLIQNDNVAQGVISSETGDVPRCTCKAQRTRKLVIFDLNGILADIVQGFTGTFLPDGKV
FT                   SYRSVFSTFALRDLMLRYGLPDVCELLELIQNPKCIVFDSSYGLDYMINIVMKNHARNL
FT                   LFCFDQNICTTTKFKTQEKKDKPLFLKDLRRVWDHIGTCISCGKRKYDETNTLLVDDSP
FT                   DKALCNPPHTGIFPSPYQYTNRQDSALGPEGELRKYLERLADAENVQKFVAENPFGQTA
FT                   ITETHESWEFYSKAVEAHK"
FT   exon            complement(150936..151090)
FT                   /number=1
FT   intron          complement(151091..151171)
FT                   /number=1
FT   exon            complement(151172..151232)
FT                   /number=2
FT   intron          complement(151233..151326)
FT                   /number=2
FT   exon            complement(151327..151512)
FT                   /number=3
FT   intron          complement(151513..151762)
FT                   /number=3
FT   exon            complement(151763..151826)
FT                   /number=4
FT   intron          complement(151827..151896)
FT                   /number=4
FT   exon            complement(151897..152008)
FT                   /number=5
FT   intron          complement(152009..152119)
FT                   /number=5
FT   exon            complement(152120..154745)
FT                   /number=6
FT   gene            163771..165410
FT                   /gene="AT4g26200"
FT   CDS_pept        join(163771..163959,164060..164355,164552..165410)
FT                   /gene="AT4g26200"
FT                   /product="1-aminocyclopropane-1-carboxylate synthase-like
FT                   protein"
FT                   /note="strong similarity to ACC synthase , Malus domestica,
FT                   U73816"
FT                   /note="Contains Aminotransferases class-I
FT                   pyridoxal-phosphate attachment site AA282-295"
FT                   /note="contains EST gb:AI993687.1, AA650853, Z33841,
FT                   Z34718, N65643"
FT                   /db_xref="GOA:Q9STR4"
FT                   /db_xref="InterPro:IPR004838"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9STR4"
FT                   /protein_id="CAB79475.1"
FT                   /translation="MGLPLMMERSSNNNNVELSRVAVSDTHGEDSPYFAGWKAYDENPY
FT                   DESHNPSGVIQMGLAENQVSFDLLETYLEKKNPEGSMWGSKGAPGFRENALFQDYHGLK
FT                   TFRQAMASFMEQIRGGKARFDPDRIVLTAGATAANELLTFILADPNDALLVPTPYYPGF
FT                   DRDLRWRTGVKIVPIHCDSSNHFQITPEALESAYQTARDANIRVRGVLITNPSNPLGAT
FT                   VQKKVLEDLLDFCVRKNIHLVSDEIYSGSVFHASEFTSVAEIVENIDDVSVKERVHIVY
FT                   SLSKDLGLPGFRVGTIYSYNDNVVRTARRMSSFTLVSSQTQHMLASMLSDEEFTEKYIR
FT                   INRERLRRRYDTIVEGLKKAGIECLKGNAGLFCWMNLGFLLEKKTKDGELQLWDVILKE
FT                   LNLNISPGSSCHCSEVGWFRVCFANMSENTLEIALKRIHEFMDRRRRF"
FT   exon            163771..163959
FT                   /number=1
FT   intron          163960..164059
FT                   /number=1
FT   exon            164060..164355
FT                   /number=2
FT   intron          164356..164551
FT                   /number=2
FT   exon            164552..165410
FT                   /number=3
FT   gene            170834..171582
FT                   /gene="AT4g26210"
FT   CDS_pept        join(170834..171015,171396..171582)
FT                   /gene="AT4g26210"
FT                   /product="putative protein"
FT                   /note="similarity to predicted protein, Arabidopsis
FT                   thaliana, AC005169"
FT                   /note="contains EST gb:AA041143, N38655, T20700,
FT                   AI998342.1, AA721840, AA586255"
FT                   /db_xref="GOA:Q9STR3"
FT                   /db_xref="InterPro:IPR006808"
FT                   /db_xref="UniProtKB/TrEMBL:Q9STR3"
FT                   /protein_id="CAB79476.1"
FT                   /translation="MASKLLQLKSKACEASKFVSKHGTTYYKQLLDKNKMYIQEPATIE
FT                   KCNELSKQLLYTRLASIPGRSESFWKEVNHVKGLWKNRADLKVEDAGIAALFGLECFAW
FT                   YCAGEIVGRGFTFTGYYP"
FT   exon            170834..171015
FT                   /number=1
FT   intron          171016..171395
FT                   /number=1
FT   exon            171396..171582
FT                   /number=2
FT   gene            172643..173610
FT                   /gene="AT4g26220"
FT   CDS_pept        join(172643..172723,172771..172995,173102..173233,
FT                   173320..173610)
FT                   /gene="AT4g26220"
FT                   /product="caffeoyl-CoA O-methyltransferase-like protein"
FT                   /note="strong similarity to caffeoyl-CoA
FT                   O-methyltransferase, Pinus taeda, AF036095"
FT                   /note="contains EST gb:R84053"
FT                   /db_xref="GOA:Q9C5D7"
FT                   /db_xref="InterPro:IPR002935"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9C5D7"
FT                   /protein_id="CAB79477.1"
FT                   /translation="MAKDEAKGLLKSEELYKVCPYILISTLYILETSVYPREPEVLREL
FT                   RNITHNHPQAGMATAPDAGQLMGMLLNLVNARKTIEVGVFTGYSLLLTALTLPEDGKVI
FT                   AIDMNRDSYEIGLPVIKKAGVEHKIDFKESEALPALDELLNNKVNEGGFDFAFVDADKL
FT                   NYWNYHERLIRLIKVGGIIVYDNTLWGGSVAEPDSSTPEWRIEVKKATLELNKKLSADQ
FT                   RVQISQAALGDGITICRRLY"
FT   exon            172643..172723
FT                   /number=1
FT   intron          172724..172770
FT                   /number=1
FT   exon            172771..172995
FT                   /number=2
FT   intron          172996..173101
FT                   /number=2
FT   exon            173102..173233
FT                   /number=3
FT   intron          173234..173319
FT                   /number=3
FT   exon            173320..173610
FT                   /number=4
FT   tRNA            173887..173958
FT                   /note="Pro-tRNA_(TGG)"
FT   gene            174490..175017
FT                   /gene="AT4g26230"
FT   CDS_pept        join(174490..174569,174738..175017)
FT                   /gene="AT4g26230"
FT                   /product="putative ribosomal protein"
FT                   /note="strong similarity to ribosomal protein L31,
FT                   Nicotiana glutinosa, U23784"
FT                   /note="contains EST gb:AI994297.1, H77007"
FT                   /db_xref="GOA:Q9STR1"
FT                   /db_xref="InterPro:IPR000054"
FT                   /db_xref="InterPro:IPR020052"
FT                   /db_xref="InterPro:IPR023621"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9STR1"
FT                   /protein_id="CAB79478.1"
FT                   /translation="MSEKKGRKEEVVTREYTINLHRRLHSCTFKKKAPKAIKEIRKFAE
FT                   KEMGTKDVRVDVKLNKQIWSKGIRGPPRRIRVRVARKRNDDEDAKEEFFSLVTVAEIPA
FT                   EGLSGLGTKIIEEED"
FT   exon            174490..174569
FT                   /number=1
FT   intron          174570..174737
FT                   /number=1
FT   exon            174738..175017
FT                   /number=2
FT   misc_feature    175264..175547
FT                   /note="EST AA586104 matches to position 30910-31193; no
FT                   obvious genmodel"
FT   gene            176868..177360
FT                   /gene="AT4g26240"
FT   CDS_pept        complement(join(176868..177011,177099..177160,
FT                   177252..177360))
FT                   /gene="AT4g26240"
FT                   /product="putative protein"
FT                   /note="contains EST gb:T45349"
FT                   /db_xref="UniProtKB/TrEMBL:Q9M0J9"
FT                   /protein_id="CAB79479.1"
FT                   /translation="MKKLARKWRRTRRDEDDDKFVLPTSEDVDSRPIDTQEQEEYVRYL
FT                   EEAHAQQSLQWRRVCGSSDLLWSFPLLLHFPAVHVTMGTGTDNLSLSVALFVLLAIPFD
FT                   "
FT   exon            complement(176868..177011)
FT                   /number=1
FT   intron          complement(177012..177098)
FT                   /number=1
FT   exon            complement(177099..177160)
FT                   /number=2
FT   intron          complement(177161..177251)
FT                   /number=2
FT   exon            complement(177252..177360)
FT                   /number=3
FT   gene            178105..179517
FT                   /gene="AT4g26250"
FT   CDS_pept        join(178105..178512,178679..179002,179083..179217,
FT                   179299..179517)
FT                   /gene="AT4g26250"
FT                   /product="putative protein"
FT                   /note="strong similarity to WSI76 protein induced by water
FT                   stress, Oryzasativa, D26537"
FT                   /note="contains EST gb:AI993578.1, Z35046, AI998411.1,
FT                   T22877, R64916, Z27058, AI997927.1, T22604, Z29904"
FT                   /db_xref="GOA:Q8H1S1"
FT                   /db_xref="InterPro:IPR002495"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR030515"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8H1S1"
FT                   /protein_id="CAB79480.1"
FT                   /translation="MAQMSMTVEKSIKADVTVSHDRVKRAYVTFLAGNKDYWMGVVGLA
FT                   KGLRKVKSAYPLVVAILPDVPEEHRQILLAQGCIIREIEPVYPPENKTGYSMAYYVINY
FT                   SKLRIWEVKNFLTICLYLCLFIIRSHRLFFVNFVEYEKMIYLDGDIQVFSNIDHLFDTP
FT                   RGYLYAVKDCFCEISWSKTPQFKIGYCQQCPEKVTWPVESLGSPPPVYFNAGMLVFEPN
FT                   LLTYEDLLRVVQITTPTYFAEQDFLNEYFTDIYKPIPSTYNLVMAMLWRHPEHIDLDQI
FT                   SVIHYCANGSKPWRFDETEEHMDREDIKMLVKKWWDIYEDSSLDYKNFVETESKLSPIN
FT                   ATLASKESVGDVLISLAPSAA"
FT   exon            178105..178512
FT                   /number=1
FT   intron          178513..178678
FT                   /number=1
FT   exon            178679..179002
FT                   /number=2
FT   intron          179003..179082
FT                   /number=2
FT   exon            179083..179217
FT                   /number=3
FT   intron          179218..179298
FT                   /number=3
FT   exon            179299..179517
FT                   /number=4
FT   misc_feature    183446..183756
FT                   /note="EST N65756 matches to position 39092 - 39402; no
FT                   obvious genmodel"
FT   gene            186403..188610
FT                   /gene="AT4g26260"
FT   CDS_pept        join(186403..186433,186618..186762,186912..186993,
FT                   187126..187330,187438..187497,187588..187640,
FT                   187806..187928,188039..188108,188206..188284,
FT                   188378..188459,188584..188610)
FT                   /gene="AT4g26260"
FT                   /product="putative protein"
FT                   /note="strong similarity to PRE87 mRNA, Pinus radiata,
FT                   AF049069"
FT                   /note="contains EST gb:AW032539.1, AI994773.1, N38209,
FT                   AW032536.1"
FT                   /db_xref="GOA:Q8H1S0"
FT                   /db_xref="InterPro:IPR007828"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8H1S0"
FT                   /protein_id="CAB79481.1"
FT                   /translation="MTISVEKPIFEEEVSAFEKSGDNIGELKLDGGFSMPKMDTNDDEA
FT                   FLAPEMNAFGRQFRDYDVESERQKGVEEFYRLQHINQTVDFVKKMRAEYGKLDKMVMSI
FT                   WECCELLNEVVDESDPDLDEPQIQHLLQSAEAIRKDYPNEDWLHLTALIHDLGKVITLP
FT                   QFGGLPQWAVVGDTFPVGCAFDESNVHHKYFVENPDFHNETYNTKNGIYSEGCGLNNVM
FT                   MSWGHDDYMYLVAKENGSTLPSAGQFIIRYHSFYPLHTAGEYTHLMNEEDKENLKWLHV
FT                   FNKYDLYSKSKVHVDVEKVKPYYMSLIKKYFPENLRW"
FT   exon            186403..186433
FT                   /number=1
FT   intron          186434..186617
FT                   /number=1
FT   exon            186618..186762
FT                   /number=2
FT   intron          186763..186911
FT                   /number=2
FT   exon            186912..186993
FT                   /number=3
FT   intron          186994..187125
FT                   /number=3
FT   exon            187126..187330
FT                   /number=4
FT   intron          187331..187437
FT                   /number=4
FT   exon            187438..187497
FT                   /number=5
FT   intron          187498..187587
FT                   /number=5
FT   exon            187588..187640
FT                   /number=6
FT   intron          187641..187805
FT                   /number=6
FT   exon            187806..187928
FT                   /number=7
FT   intron          187929..188038
FT                   /number=7
FT   exon            188039..188108
FT                   /number=8
FT   intron          188109..188205
FT                   /number=8
FT   exon            188206..188284
FT                   /number=9
FT   intron          188285..188377
FT                   /number=9
FT   exon            188378..188459
FT                   /number=10
FT   intron          188460..188583
FT                   /number=10
FT   exon            188584..188610
FT                   /number=11
FT   gene            189558..192049
FT                   /gene="AT4g26270"
FT   CDS_pept        complement(join(189558..189758,189963..190117,
FT                   190196..190241,190339..190604,190690..190819,
FT                   190910..190978,191049..191102,191191..191349,
FT                   191392..191574,191655..191717,191814..191853,
FT                   191913..192049))
FT                   /gene="AT4g26270"
FT                   /product="pyrophosphate-dependent phosphofructo-1-kinase"
FT                   /note="strong similarity to pyrophosphate-dependent
FT                   phosphofructo-1-kinase, Prunus armeniaca, U93272"
FT                   /note="contains EST gb:T22455, Z37484, AI998130.1, Z37183"
FT                   /db_xref="GOA:Q94AA4"
FT                   /db_xref="InterPro:IPR000023"
FT                   /db_xref="InterPro:IPR012004"
FT                   /db_xref="InterPro:IPR022953"
FT                   /db_xref="InterPro:IPR035966"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q94AA4"
FT                   /protein_id="CAB79482.1"
FT                   /translation="MVNFLLVLCYCRLILIHCKTIQLTQWLSKSFLTDVLVTKVPNCVL
FT                   WQYFVDADDSVPQKIVVHKDGPRGIHFRRAGPRQKVYFESDEVHACIVTCGGLCPGLNT
FT                   VIREIVSSLSYMYGVKRILGIDVSFCDCNLLLTKTNTGGYRGFYAKNTVSLDSKVVNDI
FT                   HKRGGTILGTSRGGHDTTKIVDSIQDRGINQVYIIGGDGTQRGASVIFEEIRRRGLKVA
FT                   VIGIPKTIDNDIPVIDKSFGFDTAVEEAQRAINAAHVEAESIENGIGVVKLMGRYSGFI
FT                   AMYATLASRDVDCCLIPESPFYLEGEGGLFEYIEKRLKESGHMVLVIAEGAGQDLMSKS
FT                   MESMTLKDASGNKLLKDVGLWLSQSIKDHFNQKKMVMNLKYIDPTYMIRAVPSNASDNV
FT                   YCTLLAQSAVHGAMAGYTGYISGLVNGRQTYIPFYRITEKQNHVVITDRMWARLLSSTN
FT                   QPSFLGPKDVFDNKEKPMSALLDDGNCNGVVDVPPVTKEITK"
FT   exon            complement(189558..189758)
FT                   /number=1
FT   intron          complement(189759..189962)
FT                   /number=1
FT   exon            complement(189963..190117)
FT                   /number=2
FT   intron          complement(190118..190195)
FT                   /number=2
FT   exon            complement(190196..190241)
FT                   /number=3
FT   intron          complement(190242..190338)
FT                   /number=3
FT   exon            complement(190339..190604)
FT                   /number=4
FT   intron          complement(190605..190689)
FT                   /number=4
FT   exon            complement(190690..190819)
FT                   /number=5
FT   intron          complement(190820..190909)
FT                   /number=5
FT   exon            complement(190910..190978)
FT                   /number=6
FT   intron          complement(190979..191048)
FT                   /number=6
FT   exon            complement(191049..191102)
FT                   /number=7
FT   intron          complement(191103..191190)
FT                   /number=7
FT   exon            complement(191191..191349)
FT                   /number=8
FT   intron          complement(191350..191391)
FT                   /number=8
FT   exon            complement(191392..191574)
FT                   /number=9
FT   intron          complement(191575..191654)
FT                   /number=9
FT   exon            complement(191655..191717)
FT                   /number=10
FT   intron          complement(191718..191813)
FT                   /number=10
FT   exon            complement(191814..191853)
FT                   /number=11
FT   intron          complement(191854..191912)
FT                   /number=11
FT   exon            complement(191913..192049)
FT                   /number=12
FT   gene            193185..194186
FT                   /gene="AT4g26280"
FT   CDS_pept        complement(join(193185..193802,193860..194186))
FT                   /gene="AT4g26280"
FT                   /product="steroid sulfotransferase-like protein"
FT                   /note="strong similarity to steroid sulfotransferase,
FT                   Brassica napus, AF000307"
FT                   /note="contains EST gb:AI998561.1, T75675, AI099956,
FT                   N38431, Z26029, T44617"
FT                   /db_xref="GOA:Q9STQ6"
FT                   /db_xref="InterPro:IPR000863"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9STQ6"
FT                   /protein_id="CAB79483.1"
FT                   /translation="MEKWMNLRDEDLTEETKTLISSLSSEKGYLGRNLCKYQGSWYYYN
FT                   FLQGVLNFQRGFKPQDTDIIVASYPKSGTLWLKALTVALFERTKNPSHDDPMSHPLLSN
FT                   NPHNLLSSSSPRLFSTHTPFHTLQVAVKDSPCKVVYICRDAKDSLVSRWHIVCRSLNKE
FT                   EDRTILESMFESFCSGVCLFGPFWDHILSYWKASLEKPKQVLFMRYDEIKTDPHGQLKK
FT                   LAEFLGCPFSKEEEKNGSLNKILEMCSLPNLSSLEVNKTGKSINGIEYKNHFRKGIVGD
FT                   WKNHLTPEMGSKIDMIMKEKLKDYSEVWFENAL"
FT   exon            complement(193185..193802)
FT                   /number=1
FT   intron          complement(193803..193859)
FT                   /number=1
FT   exon            complement(193860..194186)
FT                   /number=2
FT   gene            196059..196286
FT                   /gene="AT4g26290"
FT   CDS_pept        complement(196059..196286)
FT                   /gene="AT4g26290"
FT                   /product="hypothetical protein"
FT                   /db_xref="GOA:Q9STQ5"
FT                   /db_xref="UniProtKB/TrEMBL:Q9STQ5"
FT                   /protein_id="CAB79484.1"
FT                   /translation="MRSERSSKGPFEEEEEEEEEEEASSVKSDEHIEIEDEDETFAEDP
FT                   ETPITPSSSFVVEIRLPSRMFISSSFVNYV"
FT   exon            complement(196059..196286)
FT                   /number=1
XX
SQ   Sequence 196286 BP; 62221 A; 35063 C; 35154 G; 63848 T; 0 other;
     aagagcaatg ttggcgtttt cgtagggatc acggatgttc tgaagtatct ccatagcgta        60
     ctcaagagaa ttcagctgag aaggaaccgt gaatcccttg gagagcaaga atgcttcaag       120
     taagtcaagc cttccatgat atacaatggt tcctttagaa aggagtaaca cgcgatcgat       180
     gagagacagg atcttgaagc taggttggtg tatggacaag atcacgatcc tttctctgga       240
     cgtcgcaata gatttgagaa tttgaacgac atcgaaagcg gatttactgt ctaaacccga       300
     ggtgggttcg tcgaggagta gtacttccgg atcatgaaga agacttagac caattgaaac       360
     cctcctgcgt tcaccaccgg acaagccttg acctagtctt gtatgtgcaa gatgtgttag       420
     gtttagttct ttgaggagag aagcaacgac actggagact tttgataggt tttttgggag       480
     caagagagag gcggagaaag tgaaggtctc ggagacggtg aggagaggga agaaggtgtc       540
     gtgttgagga acgtaggagg agattttacg gtaagaagaa gggttaataa ggacggagtt       600
     tagaagtatt gagcctgagg tcggggaggt tcttgcggca aggatatcaa ggagagttga       660
     ttttccggcg ccgctagggc caataatggc gaggatttgg gaaggatgag aggtgagagt       720
     gatgttgcgg aggatgaagg aaggttgctc cgccgtgagg aggagcggtg aaagaggttt       780
     ggcgtaggag atggaagagg tggataaagt gtacgactcc attttgagag aaatgtttaa       840
     aggttggaga agggaagtga gtgttgtaaa gagaatttat tgatgcttga gtttggaatg       900
     ttttgtattt tccaatgaaa ttgacaattt ttcagtcttt ttttctttct tatttgtttt       960
     ttgacctttt ggttaattat tttgtctttt ctgtcatttt gaattttgcg ttacatagaa      1020
     ctcatcgaat ataattgtgg tcaaacggtg atgtaaccag gatgcgacag taagacaaga      1080
     gagagtcaga tattgaagag atcattagag attcaagtcc aaattaagat ggagttatta      1140
     gtgagaaggt ggatccagaa gaaacgaaaa ttcttagata tattctcata aagaaagctt      1200
     gctaacagtt acgtatacac acatttattg aaaacatgta aagatggatc aaatgaatat      1260
     gcatgtgtgt catagtgaat atatattgtt gagaaactga gaagaagaaa gccaaagggg      1320
     aatgcagata aaggtcacgg gcctgctgac aattattaca cagaaaattg caaatcacgt      1380
     acaagtctat ttcccaatct ctgcatcttc ctttgtttgt ttggcacaca atttgccaaa      1440
     ccatttttac aattacatat taatgacgtg accagtcctg gatttgaagg agtttctata      1500
     aaaacaatct ggcttaaacg ttagttagtt atagttactt gtggttgctt ttactttagg      1560
     tatatcaccg tacatgcaaa tgaataaact ttaggagtta ataggtgaaa taattgtaaa      1620
     tggtacaatt tctttatcta tgaaagaaaa tattctaaac agaatttgaa tcatattata      1680
     gtaacttgtt atacatatca catatgtgat atgtttatat agtttgttat actaataaag      1740
     cattctcttc actttctttg gccatcaata tatccgtatc tcatgttgtg tttttcctaa      1800
     atttctacac ataataaaaa gtagcatgtt gtttcaaagc cccttaacgg gtacaaaaac      1860
     aagaacagag tgcagggcta aacagaagaa aattgacatt aggaaatcag aaataagccc      1920
     atttgaatgt ggatcaatat tgaaaaaaat gtgtgaaaag caacttgcaa tgtcacaaga      1980
     taaatatacc atgccgtata tatcataact gcaagaacag acccaaaact gaaaagtgaa      2040
     aagaatgtgt gtgggtaagt taaagagtaa tgaaggccga caggcgacag tggaggagga      2100
     tggaccagac cagggtgctg ggcgatgagg acgtctcggc taaaagctga accaccctcc      2160
     actcttaggt cccacaaagg ctggtcctcg ttcacaaatg tactctctca aagaaacacc      2220
     cctttctgct ttattactat tccctctcgt tcctccactt ttttgtagca gcttccacat      2280
     gaatcatgtc ataactgtta caacatattc caaaaaaaaa actatagaat atatgtagga      2340
     aatgttaatc actctgtttt ttttgtatct ttactctttg tttcttctca ctagataccg      2400
     tcctatactt ctattagtgc ataacacttc cttagacact tgcttttaca ctttccaaaa      2460
     ttattttaaa catgtatgta tatgatcatg tcgccatggt tgacgatata tacaattatt      2520
     gtactttcat ctccttttct catcttttct ttcaataaac cttattttta ttaccatatc      2580
     ttctcttttt cttgctagca aatgttgatt attttattgt aattaaactg ttgtttatga      2640
     cttaatgttc aaacttcaaa taacatgtgt gaactgtgag gcatgcaata atgatatttg      2700
     ttgcatatct atcagttttt aaaagtgtca tcatagctct ataaagctgt ctatttaaat      2760
     tagatatacc tatctcaagt tcactaatcc gtatctaaag agaaagaaaa atatcttgat      2820
     aactaaaaat gagttttaga atgtacggag ataagttctg aaaaaaactg aacgagccac      2880
     ctttaaaagt aattagatga agaaataaac acaatttgaa aaactacatg aaagctaatc      2940
     tctgacttga gaagttgaga tatttggaac ctttgttaat tctttcaaca ccgaaaacga      3000
     tttcttagga aatttcaaaa gaaataaaag taaagagggc aagtattctg attgttaacc      3060
     aagcacaaaa tgaagcaccc atcaatcaat cttttcaaca atcaacatac cgattctaat      3120
     tggtctggca gaataattac cggaaaggaa gaagaataga actccaatat ttaattatcg      3180
     tacttaatct gtttgttcga gaaactaaat aatgggttcc taggtatatg tatttatttt      3240
     atacattatc ttcacatgta acgtgcctat ttaacgagaa tatgattccc tatgattcat      3300
     gcacaaacac aaatcaaatc cggaatttaa gtcggatcag ggaataaatt atacagccca      3360
     cacacataat aatttaaaac taatatatac acagtgaggg gatttaaaag taaaacttat      3420
     ctccaaagat taatgtaagc gactagtgat tgtgttggca tattaaccgc acataacatt      3480
     gtttgggggt ttggatgctt taaaaaaggt tctgccttag aaattccttt tagttgacgt      3540
     aatgatatat tattgcttac tgtaatacta gtggacacat taaacaatga tcttaaagta      3600
     cgaatgaaga aattaaagaa aatggaagag gaagaatgtg gaaatggaga acgtaagtga      3660
     aagtgattgg aaactaatgg aatatccgtt tttcctttag tcatggtgga agctgacgct      3720
     gagaacctac ccctccaatt gcactactcg ctctattact ttatctaacc agaagttttt      3780
     taaataccct ttactgtata tagttcttac agttttatac atattgttaa gaactccata      3840
     tatagtgtat aaatggcatt gaaaatagtt ttgagttgaa actcctaaat gatattaaat      3900
     cttgagttta acctaattaa gcaaagtaat aaaaactgat tagccaaaac aaagaggtta      3960
     gttagttcaa cagttaggtt aatgtgcaaa ttgccgtaac aagattatta aataattctt      4020
     aactttaatt aacctctatc cattattgca tttaaaagat actattaatt aaaagccacc      4080
     aataaaaatt taaactttat taaagtacta aagacggata tattaaacaa aacaattatg      4140
     aaaaaaataa gaaaaccaac ttaatacaag ttcaaattaa catccaaaag aaggaaatat      4200
     acatgatttt acaaatgtct tcattgagcc accacgttaa actaatatca tttttgaggt      4260
     tgattaaaaa attattcatg taagtataaa tgcaaaaaaa aactacatct ctatatcaaa      4320
     aaccaatcaa ttgtttactc cattatggaa gatgattccc taaaaaataa tttcgttaat      4380
     actcactcta caaagtacaa ataatgaata ctgacttttt tcatacattc caaaaaaata      4440
     ctgaaaactg aaccatacac aaatccattg cattaagaaa caatccatcc catacgttcc      4500
     tctataaaac gcctctcaca acacaatctc atctcccacc aataaattaa ttactttttt      4560
     aacaaagaaa actttcattt cattcactct tcccaaacag taaaacacac atgcagacaa      4620
     tggaaggacg acaatataat taccaagaca gcataaacgc gagctcctcc atggtggtgc      4680
     ctcactcgcc ttggcactct ccggttcctt atctcttcgg tggtttggcc gccatgttgg      4740
     ctctcatctg cgtcgctctt ctcatcctcg catgttccta ctggagactc tccggctccg      4800
     ctgagagaga tcttgaggcc ggagatgatg ccaaacccga caatgacacc aacaaaacta      4860
     agcacacaga aatgccggag aagtttctcg tcataatggc cggtgatgtc agacctactt      4920
     acttggctac gccagcgact cggtctgagc aaagctgtac ttgcggcgat cataacgaag      4980
     aagaaggaag aagagggtag tgatcaggtg gtatagcaga gcaccggagg ttacggtgag      5040
     ccctccctca tattttgaaa acagagcatt cgttacggag tactccggaa tcgatccgtc      5100
     cggtcttttt gtgtcggttc ataattacgc caaccttacg tgagctgatg ggatataaat      5160
     tagagtttta tttatttcgt atggttttag tttttttttg gttgtctcag ttttcttcaa      5220
     atttttcccg tttatggttc atgaaggaat atccggtaca tgtaaatttt aagagtttga      5280
     atagatgatt gttttggact agcgattaaa gatagaactg aagcttgaca gacaaaataa      5340
     ataaaagata caactaaaat cgtgcgtcct taattcagtt ttcgtgtata gagagacaaa      5400
     aatgttttcc cagtgagaga tgtacagaca tgatgcttac gaaagaggga aagagatgtg      5460
     ttgtgaaaac ttctagtgat gtgccaacaa tgacgcatgc cgaatattaa gctaattcgt      5520
     tgtggcgaac cgaagttgag aattattctc tttgtacctt tattcctaaa tttctagata      5580
     tattactaaa tatcatcaag ttttatcaaa gaacaaatag cctctcaact atacatttct      5640
     ctcttttttt cttttccagg catatccatt tatcattgtt taccattcac tgaaattgaa      5700
     agcattatcg tttatcgttg gacaataaat tgtcgtcttt tggatgatca gtacaatgtg      5760
     aacagtgaca catataatgg atggagacta ctgcaactaa ctgaataatt gtttttctag      5820
     tatgggcaat tggtcactgg ttgtgtcatg tgtttacgtc ctttcgtttt cttgtccaat      5880
     tcctactatg tttattatgt gaacgtgtca aaacaaacga gctcgcaaat gatgccaata      5940
     aaactggaaa accaacaata attgtggaaa aatcgacatt caactggcgc caagtcttat      6000
     gatcaaaaca aaaacttata gaatcgatag tgacaagaga agtatgaacc tttttttttt      6060
     acaaagaacg ggtagatctg tacagattca ttgttcgaca gaactataaa acattttaaa      6120
     taaccatcaa ggaaaaagtg ccaagaactt taccacgatt tgtatcgcat caagcatcat      6180
     actaaatacg atataaataa ccaacaaaaa agagaagaag tttgtgatgc ttatcgcctt      6240
     cttacagtgc tgactaattg cagcggttga aaatgtttag ggctagagac cgaaatgatc      6300
     catcatgtgg aagacaacat ctttgccatc agaatgtaac caatatgttt tcacctacac      6360
     attacaggga aaattatgtc aaatgctctt aacaaaatcg cttttgagtt ttgagttctt      6420
     atcattaaac ttgcctggat ggtactatgc gcgacgtatc gttgcttgct attgtgaaag      6480
     ctgacatcta ctctttccca agatagttga ctgagtccat gtatcatttc ctctacattt      6540
     cacaaaaacc ataacaggac gaagttagtg attctacttg ttataaagaa gaccaatggg      6600
     taatagatag cgaggcaagg atctaccaca ttccataaat ctgatagaga tatcattttt      6660
     tctagcaaat tttgaaaaac aaatagtcaa gtgagaaata aagcaaaacc ttcaagatca      6720
     gtatcttgct ctgttactac tgtagaagtt gactggcaac taccattgtc cacatttcca      6780
     cgttctacgt atacaatgtg tggatagttt ggatccgttg ctagaagatt tggctggaag      6840
     atgagcaggg ataatagtta ttgataaatc ccacaacgtc attaaagatg tgcacaaaat      6900
     ataataagta aagacatacc tttgggagtt catttggacg gcgaattgaa gatgtcctcc      6960
     atccaaccat agctttctca ttagttaagg caaactcttg taaatgatag aaataatcaa      7020
     aaaccattga cagtctcttt aaaaacatgt ttttttcagg gaaggataca atcaaaattc      7080
     acgtttgcat atgccacacg acgcttgaaa gcatttaaag ctgatctgtt gaggtcataa      7140
     gaagagatga tgagcatatc aatctgcaag tcaccaatga aaacacccag aagctagagc      7200
     atttacatga atttcaagtc atcagaatct gtagccatcc ggataagaag tggagcattt      7260
     ccatcatcgt tgtccaccag aaacaaatgc tttccggtcc tcccagcagc caaatgtgca      7320
     gtttgggatg ctgttctttc aagaaacgga aggccacaaa gaatcgggaa ctgagggaat      7380
     gaagacaaga gtaagcatgt catacagatt acagaaagag attatctata tatatatatg      7440
     caaaccttac ataaacattt gacctaggca tgcagtctaa aacatcaatt cacctgtcta      7500
     tgtcctcttg aaccaagatg aggcgttgcg aaagttataa agttcatagg ttctaaccca      7560
     gcaatttcgc ctcctcttgc gctcttctcc ttcgaaggag agtccagaga gtcgacttcc      7620
     cctggctgtt catagagctt ccctatggca tatcttgcaa caagacctcc taatgaatga      7680
     gccacaaaag atatcttctt cagcccactt ctatgcttaa caacacccaa aaccttcaca      7740
     aattttcaaa catagaaatc aaattttaag ttgcaagtta cagaggaaac aacaatgcat      7800
     ccaaatacta cctcattagc tagcctttca cccattttat caacaccatc aaatgtcaac      7860
     gttgcactat tactctcgct acctgcttca tccaatttca tcatcaaaat caaacaaatc      7920
     ataaaattac agagtaatca aaaccacaat atctataggt caagaaacac gcacggtgca      7980
     ctagtacttt atccgggaac ttcttcacga actgctccgc cgcatatttc caatccgccg      8040
     cactaaatca tcatccaaca cagaattagc acagtcttta acccaaacta tagtaatctg      8100
     taattctaat tgaagctctt tgatttagtc tacctgccaa cgattccgtt aaccatgacc      8160
     accaaatgat caggcttctc cgcagactcc ataacatccg catcgaaaaa gtcttctccg      8220
     ccgttgtcga tctccgtcgt cagctctctt ttgcttcgat tcgccgcaaa gcaaccgatt      8280
     ccaagacgat tcatccactc catttgacag agattcttag gttgagctgg aaattgaagg      8340
     tataatctga aacggaactg gttttgacta ggcggaagaa atcgcggtga agacggaatc      8400
     aaatcgggga ttgagatttg gaatctggag aaggacgcga tcatgtggaa gtaaaaggaa      8460
     cacaataaga aggaagttat cttcctgact agcaaactga tgatgacaag tcgcttaact      8520
     tttccggcga agaagtgtta caatttgcgg gttttgcgga ggcgctaagc aacagtagcg      8580
     gtaacataga aacacttggt caaaataagt ttttaaaaaa aatattaata gtggattgat      8640
     aataaattaa aaactataag aggttaatgg tgttgttatt aacaaacaaa aaaactttaa      8700
     ttttggaaga cttgcaaaaa tctacactaa aatgtagaga tttatcaact actattagta      8760
     taggataaat agtaaataaa aattatttca ttgcaagtac atctaatctc aatataaaat      8820
     gtaaagattt atttcattaa aatgtctgga tttgttttct tttctttctt aaaagtaaag      8880
     cacatttaaa tcaattattt caagttactc atttgattat tcatattgca catgtgacat      8940
     gtatgacaaa aaaaaaaatc tctttcacat taaaacgtgt aagtactaat taagtaccaa      9000
     tagaatctct ttcacattct tttgatttcc aatttcgatt tggcttaatc gattgctaaa      9060
     ttcattcgtt tttttcgtcc ttcttctttc ttaatttcat ccctaactat ttgatttatc      9120
     ttccatagta ttttatatca ttgcatggat taaattgatg gccataatgt tgtgagttgt      9180
     gagtgccaat atgggttggc aagcatgctg acttattggc gttttccgtg acgacccacc      9240
     attatcaaat atccgcctat ctaatacgtc caacattagg gtttcacggg acaacacata      9300
     acacaatcat atcatatctc tccaataaaa taatacaatc cataattatc atcaatctcc      9360
     ttttcttttt ctttctaaaa tttacaatct gccagagccg ctacataatt agacagagcc      9420
     gctaaaaaac ccctcaaatt tgtatccata catttccaat tacacagttt atcgtttcct      9480
     tctttttctc tgtatattta aataacacac ttgaacctcc gaatccatta gcacctacaa      9540
     aacaatataa tctcagaaaa gagagaggat gagctcatcc tatttacgag taatattact      9600
     cttaggtgcc cttaatgtcg tcgtttcttt atcaataacc aattctttaa taaccaaatc      9660
     agcaacactc ggtcaggtgt tccgaatctg taagaatttg tgtccgggat gtgaccacga      9720
     ctccttgcag ttcttgttcc gacacaacct ggtccgtgcc gcaagattcg aacctccttt      9780
     gatatgggac cgcagactcc agaactacgc ccaagggtgg gctaatcaaa gaaggggaga      9840
     ttgtgctttg agacactctg tctcaaacgg agagtttaat ctcggcgaga acatctactg      9900
     gggatacggc gccaactggt ctccggccga cgcggtggtt gcatgggcca gcgagaagag      9960
     gttttatcat tacggctcca acacgtgcga cgctggtcag atgtgtggtc attacacaca     10020
     gattgtgtgg aagagcacta ggagggtcgg atgtgcacgt gtggtgtgcg acaatggtgg     10080
     gatcttcatg acttgtaact atgatcctcc cggtaactac atcggccaga aaccctatta     10140
     atttatcatc atttatctat taaaaattct ccaaaataaa gtcatcttac taatttttta     10200
     gaaattatga tgacttttta aaggagatta ggtgggtgta tttgtgtatt ttactagaaa     10260
     atagatctat ttgtgggggt tgtgatacta attatgtatc ttgattattt taattgatgg     10320
     ttgtaattgc atcaacggtt atttatatat ccgtaagaat gcccagtgta caagaatata     10380
     taaaatataa aaagatgata tgatttttgt aaagaaatgc caagtacaaa cggaaaatta     10440
     tattgtttgt gcatattcat atctaagtag tatttagtta tataaaattt aagggaacta     10500
     aggaaggtct tttgtatacc gattaaaatt ttattttggg gacatgacca tcacaaaatg     10560
     aaaagtagaa acaacaaaat gttcataaca ccatcaactt aaaatccata ggatgataag     10620
     ttttaaaaga aacaaaagtc aagaagaata aaaacataga ttaagaaatc accaacgtta     10680
     atttaaaaca actaacgtgt tagacaaagt tagtaaggct tctccccaac gtagttaccc     10740
     ggagggtcgt agttgcaagt gatgaaaact cctgcgccgt tctcgcagac aactctagcg     10800
     caacctaggc gcctggtttc acgccacacg atctgagtgt agtgaccaca cataccatct     10860
     ccttcacacg tgttggtcat gtggttgtag gacttagcct ccacagtcca tgactccact     10920
     gcgaaagtcg atgtaaagtc tgagccactt ccccagaaca agttctcacc gtatgggccg     10980
     gtcgagtggg ttaaggagca gtcgtatctc ctctggttag cccaccatgt tgcatagctt     11040
     gcgatcttta cgtcccacac cagtggaggc aaacctgttg ggaatgaaaa ttttcatatc     11100
     aatatacaac attactaata atttaatttg atatcacaat tatgttaaca aatgttattt     11160
     aattgttcgt ttctttagtg tagtccattt ccttagaaca tgtatgtaat atataaggtc     11220
     tcaaacaaaa caaaatatat ctggtttaat ttctttgtat ctagaaaaca tcaaaatacg     11280
     gatatatttt tgttaatatt ctatatatat cctaatcgtt tttatcttgt agtttcttat     11340
     gaataggact acatatgagt atgacaacaa aaattacaaa gatatatcat aagtgaccgt     11400
     ttatgttgtt tatggtcatg catagtctta taactatgac cacatcgggt cttaattcta     11460
     tttatagtta atatatgaaa gtacctagac cgcctcggac agtattatgt ggatcaagaa     11520
     attgttgttc gaacgagccc gtgggtggtt ggtatgtggg aggaggctga taaaggatag     11580
     gtttggggct gggagttggg agcggctggg gctttgcaac gtagggagga gggctcgggg     11640
     ttataggtcg ctgtgggcgg tgccggtaat agtctgcatg aacggcttgg atggcgacca     11700
     agaaaagggc gattgcgaaa actatggctt gggttgatgt tgtggtcgcc atctgttttc     11760
     ttcgtggagt ggctccaaag attttgtttt ggatggtggt agaaaatgat ttgatgaggg     11820
     tgattattta tatgtttaag ttagtgctta attaattatg acaatgcaat ttgggagtca     11880
     actagaagtg gcttacatgt tcgattatgg ttaccactta ccactttgtt tcgctttagt     11940
     aaaagcgaga gagttgtagt cttgtagata ttttaaccat gcaagtaggt attttatata     12000
     cattttttcc ttagactaaa gatcaataac agagattaaa ttttctaacg gcaatattat     12060
     aagaattagt aataaaaaga aatattatca ttaaaatata aaatgtgagg tttatgatac     12120
     attagttggt ctttagaaaa aaatgtttgt cgactaaaaa aaaaaaaaat agattgaatg     12180
     tagaaatttc aacagagaga aaaagggaaa aaatgtctat ttttcaatac cacttttcaa     12240
     aaaggcccct ccctaaactt ctaattatta gttgtttttt ttacttaagt attactgtaa     12300
     taggtttcct ggaacaaaaa ttgttataaa actagatttt aacctgcggt ataccgcagg     12360
     gacaatttat tttttaaatt agtatatata aaagtttgca aattaaattt atttataaaa     12420
     tatttttatt ttctagttta caattgttat taagtaacgt cctctcaaac ccgtcccaca     12480
     aaaaaaaacc cgcggtacac cgctaattta aatatataat taaaataaat attttacggg     12540
     attgcaattg tattttggtt tgtcaaacaa atatttgttt taaatagttg ccaaaatcta     12600
     gttcaaattt tggagaaata agatttattg gatagataaa gaatgtattt aggtgtgttt     12660
     tgctcttttt aagggattgc aattgtattt tggtttgtca agcatttttt gttttaaata     12720
     gttgttgaaa tctagtttaa attttggaga aatctgcctg acatatgaga ttagaatata     12780
     tttgaaatat tttttgtttg ttaatcaatt tattactaaa aaaaaacaat aattaaaagt     12840
     tagtgacagc cattgtaaat aagtgccaac tacagaattt atttcacaaa atgcctacaa     12900
     aaatgtatat gtagatttta tacaaaaata attgacaaaa ggcaataaaa tagaattgat     12960
     cagctgtaaa agaaaataat cagaaaacaa aaaacacaca aaaatcaaac ctaaaatatg     13020
     acttataaag tttcattttt aatcaactat aaaaccaagt atgttctgac aactccttag     13080
     taaaaactta taatttcgta aaaacaataa aaccgtaccg aaatctggct taaatatttt     13140
     aaaattttat tcaaccaaat caacatattg taaatatagt aaaagaaaca aggagaaatg     13200
     gatataaatt tattaaaata aaaagcagca ctacgtggaa cgtacggctg ttattttata     13260
     taccatcgga aaaagtcaca tttgagaatg tcgtaagtcc cgacacgtga ctagcacggc     13320
     aggtctaccg tagataagcg tagacctcag cacaccgtac cacataataa accacactca     13380
     aactcagtcc gaggttgacc catttaccaa acaaaacaga gaatcgcaga gcaaactata     13440
     gactacacaa aacacttccg tcaccggcga atttactcag gcggtaatct caccggacat     13500
     gtaattctct ctttcccttt ctcgcaattt attattctgt ttgtcaccga gagagtctac     13560
     gcaaagtctt ctgcggagga tttgcttacg ggatttagag tttttctgta gtctgattca     13620
     tgtacttgtg ttgttcgcag atctcagaaa agagggtttt tttattttct ggaggtaata     13680
     atattatgaa gaggaatttc gagaggaacg atgacgacaa gcctgagcga aagcgtcctg     13740
     ctcttgctag gtgagtttct ctgattttaa ccagattgtt tttgaaagtt tcttagtatt     13800
     aaagactttt tctggtccta ttgctttttg tctgcgcagt gtgattgttg aggctctgaa     13860
     agttgacagt ttgcagaagc tttgctcgtc tttggaacct atcctccgcc gagttgtaag     13920
     atttgcttac tctgtttttg ttgtatttgt tctcgtctct ttgaaaagct agttatgttt     13980
     aggtatgaat cagttttgtt tattagtacg gtattggtgc tgagcaggtt agtgaggagg     14040
     tggaacgggc tttagcaaaa ttagtcccta ctaggcttac tacaaggtaa cacctttgtt     14100
     caatgggata cattaatgac catgaaacta gatagtgtat atcctgagac ttgcaactgt     14160
     ttttttcagt tctgtatttt ctccgaaacg aattggaggt ccagatggcc ggaacttgca     14220
     gctgcatttc aagtctagat tatctctccc tttattcact ggaggaagag tggaaggaga     14280
     gcaaggtgct actatccatg ttgtattgat tgatgcaaac acgggtcgtc ctgtaacagt     14340
     tggaccagaa gcttccctga agcttgaggt tgttgttctt gggggtgact ttaacaatga     14400
     agatgatgaa gattggaccc aggaagagtt tgaaagtcat gttgtaaaag agcgtgaagg     14460
     aaagagacct ttgcttactg gagacttgtt tgttgttctc aaggaagggg taggcacttt     14520
     gggtgagatt gttttcacgg ataattcgag ttggattaga agtcgcaagt tcaggcttgg     14580
     tttgagggta ccctctgggt actgtgatgg catacgtata cgtgaagcaa aaacagaagc     14640
     tttctctgtt aaagatcaca ggggcgaatg tatgtgtttt cttttcttgt tctctttttg     14700
     ccttgtgctt gccacttgtt ttcttctaaa tcaacatgtt gttggattgg ttatgtgtag     14760
     tgtacaagaa gcattatcca cctgctttga atgatgaggt gtggaggtta gagaagattg     14820
     gtaaagatgg ggcgtttcat aagaggctaa ccgctgcagg aatagtcact gtggaaggct     14880
     ttctgagaca attggtcaga gattctacaa aattacgggc tgtgagtgcc tcctattacg     14940
     tcaagctcat tgttgttgga tgagaacatt cattcaatgc tcatgagtaa ttatgattat     15000
     ttgatatttg tctagattct tggaagtggc atgtcaaata agatgtggga tttgctagtg     15060
     gagcatgcaa aaacatgtgt cctaagcggt aagctttata tctactatac tgaagattca     15120
     aggtctgttg gcgttgtatt caataacatc tacgagttaa gtggcctcat aactgaagac     15180
     caatacttat ctgctgattc actctctgaa agccaaaagg tctatttcat tctccttatt     15240
     ttcttacact tatttgcctc atgatgtttg gtatattgtt ctggaaaact ctgatttaca     15300
     gatttttgtt ttggtgatgt gtgattatat agttcagttc tgttatatat atgcggtagt     15360
     gtaaattttt tggtgtttaa atctgaaagg tatatgtgga tggactggtg aagaaagcgt     15420
     atgaaaattg gaaccaggtc gtggagtatg aaggcgaatc tcttttaaac ttaaaccagc     15480
     ctgagaggtt ggatatttct cagactgatc ctgtaacagc tctggcaagt tactctacgg     15540
     tgcctcttag tcagtttcct gaattcgcta tagaaggttg gcaaatcagt cccttgtaat     15600
     attactaaat ctcaaatctt atgttctttg ttctgtatca taagtttata ttctacttct     15660
     atctttactg cagggtataa tcaaacgctg acaacagccc tacctcataa cccacaagca     15720
     caatttgatt ttgttcccca gcaagatcag tttatcggaa tacagcaacc tcaaactcaa     15780
     accaacatag agaatgaaaa tgtaactagg ttggttcttg gtcctccaca atcatccaca     15840
     ggtgggtacc aagacatcaa atcttctgct gaccaggaaa atcttaatcc tttcgaagac     15900
     tggacaaacc taagtgagaa tgactttttc tcggaggaag agatccggca aacaagccat     15960
     gacttgttag cgaatgagga catgcaacag ttgctcttca gcatgggagg tggcaaagga     16020
     gaagatggtt ttactttccc atcgtttatg cagaatacac caatgatgca gggatatgat     16080
     gaggagggcc gtgggcgatc aggaaaagcg gttgttggat ggctgaaggt aaaagctgct     16140
     atgagatggg gattcttcat aaggaggaaa gctgctgaga ggagagcaca gattgtggag     16200
     cttcatgata ataacgatgg taaatgaata gtcaggttgc ttgctagtgt atagaagcca     16260
     tgtacagttt agggatgtat aacaacatca cttaccgata tggatttgct tgatttagct     16320
     tattagacaa gaatataatc gatgaaccat gagaaatttg aagactaacc ttcagcagca     16380
     agacaagaag ctgattttct gtctctttaa gtttcaactt tcaacttgca gatatattag     16440
     aagactgact aagtatgggc ctataagccc attaatgtct ctactgaacg cccaacttgt     16500
     gaaaaacatg tctctcatct caattttgtt ttcttttcac atcaacttaa agctacgaga     16560
     accaaacaag tgatgttttt ggtcaaacag gacgaaacat gtatacataa aaagaggtaa     16620
     ttatgttcga taaacatagg tataaataaa ctataagaat ttgttacaac attctttaga     16680
     tttgatatta actgctgttt acatttgaag aactcagtta gttatttaat attttatttt     16740
     atagggtcta gaaattactt gcgtgtgggg actgatcacc gattctaaag aaggctcatc     16800
     ctttggataa tagtatgaaa cttgtcaata aagataagtc atcacaagta gggagatctt     16860
     agctgtgttc catacgccca tctagaaaaa gcgacgatgg tcaagattaa ataactgtat     16920
     ttgaaaaacc aaaaccgcgt caccaactcc aaagccatta ccattagcca tcactttcca     16980
     tcttccagct gttcgaatca ggacgcccct ttttcttcac caaacccatc ggccgataac     17040
     gaaccttcct ctctgactgc ctctgctctt actataaata caaccaatac gacctcatcc     17100
     aaaacccaac aaacctaagc tcaaagccca ccaaaaagaa aacaatcact tagcaatggc     17160
     gatgatcagt tactccacca ttgtggttgc tctgcttgct tcttttatga tttgctctgt     17220
     ttccgccaat tttcaacgag acgtagagat aacttgggga gacggacgtg gacagatcac     17280
     aaacaacggc gatcttctta cactctctct cgacaaagct tcaggctcag gattccaatc     17340
     caagaacgaa tatttgttcg gtaaaatcga catgcagatc aaactcgttg ccggaaactc     17400
     cgctggaact gtcaccgctt actatgtaag tccatttcct ttagtgtttt cttaaagttc     17460
     acatattaag agtgattagg ctaaatgttt tttttgtttg gttctacagt tgaaatcccc     17520
     tggatctaca tgggacgaga ttgactttga gttcttggga aacctaagtg gtgatcctta     17580
     cacacttcat actaatgtct ttacgcaagg aaaaggcgat agagaacaac aattcaaact     17640
     ctggttcgat cccactagtg atttccacac ttactctatc ctctggaacc cacaacgcat     17700
     catgtaagtc caaaattata aaaaataaat cacacttact cttttgaatc taatcttgtt     17760
     tgttttttct atctattcag attctccgtg gatggaactc ccataagaga attcaagaac     17820
     atggaatctc aaggaactct gtttcctaag aaccagccaa tgagaatgta ctctagtcta     17880
     tggaacgctg aagaatgggc cacaaggggt ggtctcgtca aaaccgactg gtctaaagct     17940
     cccttcactg cttcctaccg cggcttcaac gaagaagctt gcgtcgtgat caacggccag     18000
     tcttcatgcc ctaacgtgtc aggacaaggg agtactggtt cgtggttgtc tcaggagcta     18060
     gactcgacgg gtcaagaaca gatgagatgg gtacagaata actacatgat ttacaattac     18120
     tgtacggacg ctaaaaggtt ccctcaaggt cttccacgcg agtgcttagc tgcgtaaagc     18180
     ttttaaacaa atgatccaaa gccatgaaaa gtaatactat tctttgattc atcttataaa     18240
     gtatctgatg tttggttaca tctgtttttt atttattcta tgtaagtata tttgtattcg     18300
     aatattgatc aatcacttta ccaaaataaa acatttgaac gtacgatcag aaaagtttaa     18360
     gtcatagacc tcaacgaaaa gtaaaaacga aaaagttact gtacattatt ttctgagatt     18420
     cttattattg attcctaagc ataattaagc tataaattat atgctattag actattaaat     18480
     aacccaatgt tttatcaata agtagaatcc ttcaactctt ctaatttata aatggccttt     18540
     tgatctaaac taatgtctag cacaaaaaaa gaataataat aataattgtt ttggtgacac     18600
     agaaataata ttccacgaac ctgtctatgt tgaaccgtgt aaggtcgaat aactcgattt     18660
     aaatattatt acatacaaag tttaagacta ccacgtcgat aatgtgcctc cacgaaactc     18720
     tctttatata accacttatt tccacttcat ctaaatccat cgacaaagac ttacctctca     18780
     cggcgagaaa caacagagaa tcggggaaaa atggcgtgtt tcgcaaccaa acagcctctg     18840
     ttgttgtctc tcctccttgc cattggcttc tttgtggtgg ctgcatctgc cggaaacttc     18900
     tatgagagct ttgatatcac ttggggtaat ggtcgtgcca acatattcga gaatggacag     18960
     cttctcactt gtactcttga caaggtctcc ggctcaggtt ttcaatccaa gaaggagtac     19020
     ttgtttggta agatcgacat gaagctcaag cttgtcgctg gaaactctgc tggcaccgtc     19080
     accgcctact acgtacagaa tctacttgtg aaattaattg atttcgaatc ttatatatta     19140
     gagtatcttt tcatctcaaa accaatcggt aataaatgta atatttttaa ctcctaatgt     19200
     tatacatgtt gtggcagcta tcgtcaaaag gcacggcatg ggatgagatt gacttcgagt     19260
     ttttgggaaa tcgcacagga catccttaca ctatccacac caatgtgttc accggaggta     19320
     aaggcgaccg tgagatgcag ttccgtctct ggttcgatcc cactgcggat ttccacacct     19380
     acaccgtcca ctggaaccct gttaacatca tgtgagtata tagtctatca ggaaacccta     19440
     aattgatagt aaattataca atataatcca gtatattaac aaacgtttta ttaattagtt     19500
     catttattat caattggttt ttatataata agcttatgaa cattgacagc gtctaatctc     19560
     atatatttcc tcttttgatg tgatccctta cattgagcac tataaaaaaa aaaaacgagt     19620
     tctcttgaca tctatagaca tatttgatat atatttcttg acattcatgt tggtttcttg     19680
     tgtctgaagc ttccttgtgg atgggatccc aattcgggtg ttcaagaaca acgagaaaaa     19740
     tggggtggct taccctaaga accagccgat gaggatatac tcaagccttt gggaagccga     19800
     tgactgggct acagaaggcg gtcgcgtgaa gatcgactgg agcaacgcac cattcaaggc     19860
     ctcttacaga aacttcaacg accaaagctc atgcagcagg acatcaagct caaaatgggt     19920
     gacttgcgag ccaaacagca actcgtggat gtggacgact ctcaatcctg cccagtacgg     19980
     aaaaatgatg tgggtgcaac gagacttcat gatctacaac tattgtaccg attttaagag     20040
     attccctcaa ggcctcccca aggagtgtaa actttgattc tattatggga attttcaagc     20100
     atttttcttt ccgttttgtt tcatcttgtg atgttacttt gatttatttt gttctttctt     20160
     ttggtgtttc tgagatacga tattacatgt atacgtattc ttcctgagaa aataagaagt     20220
     tgtattactc gataatacat tttatctctc aatgtggtgt gattgtttat tgggtttggc     20280
     gtacaatgaa agctacatca atgtgcttta gaaaaatgca tacgaaaaga aaaacacaac     20340
     aatcaaaaac ccgtgaggta actaaattat ctccatttac aaatatacta acaatactac     20400
     taatttattg ctaagctgtc agctgtcacg accatgataa tgaaaaaaaa aatcatctct     20460
     gttttcttct aaactttaga gtttctcgaa ttttcacata taataaaaat aaccaacagt     20520
     tatggtactc tgttgggtga agatttgcta tgtggatatg taaaatgctt agagtcttta     20580
     cattgtgatt ttagtggctg gttagtggtt attaggttat tacaaacgct tttatctttg     20640
     tacatgatct tcttaagtag ttacagaaat ctcaactttt cttaaactaa acgaatatct     20700
     ttgattttta ttttctttac atcactctta ttgggtctaa ctcactgtaa aattcctgca     20760
     tgtttatatt atgaaattga gaaaatagta aatatatgtt ttaatttcaa agtttaatga     20820
     acgcgttggt tggtccaact aactaatagg gcccaacatt aaagacttta agacccacat     20880
     ttaggaaatg aatttggaca gtccaattta aagcacagaa cgtgtctcaa tacttattca     20940
     gtttatttct tcgacaatga tttttcaaac taaattgcta tttttgatat tcaggatatt     21000
     tcatttcata taattcagtt gcattttcag gatttacaaa ctttgtaatt gtctcctcat     21060
     aatgtcactt tttccttcat tccatccaat ttgtcgtcaa agggcaataa aaataataat     21120
     cacaatgcta aattctgata atcaaatctc aacaaaatat gactcaaatc aaaccctgtt     21180
     gattggacca acgaattaga cacttgagct ttagctcctg tgattttaat gtggtatgct     21240
     tgcagaaaat ttcttaccaa aatgtcaact catctccgag attaagcgta ctatttgcca     21300
     atacccgagt actcggagct aaataataga aaaagaaaaa aagaatacat atctcatgtc     21360
     caaacaatat tttatatact tatttcatga caaaaatcag gaacaaatta aaattttaca     21420
     gatataaaat aggtccacgc aacaaacaca cgttaagttt cattaggttt agattattga     21480
     ataagatgca gaattgtcat tttcaatatt gattagtttc tggtttaagt caatatcacc     21540
     tggtttagag ccactcgtga caatgtataa aaaaattacg taccatctct atatccaaaa     21600
     ctagagacag agatgtgtcg accatgaaac tgtcttaaga actatgacaa tttggtcata     21660
     ggcatagcct aggcaaaaaa acttcattta aaaaaaaaag atcaaaatgt ttcgattata     21720
     aaagattcgt aaggttatat aaaatacaga aagcatgaga tataagtttt ctcaatatta     21780
     caaggttatt ctcaaataat tcaaacgaag attctcgtct aactatcact tttagaggat     21840
     aaggacagaa aattaaatta gaaagtcctg acggaccaaa ttcattagac gcagttggct     21900
     aatcatacat tcaatgccaa tggagaagtc caactgtatt tcatttcaat cttactcata     21960
     caactataca agtgatctgc aaattgccgc gtacatatat gaataagaaa aatacattaa     22020
     aattttatat ccacctgcca aatcctttca acgccaaacc attcccctat ataattatat     22080
     atacaattac aaattttatg ttacagtctt catttattcg cgtaaagatt tcaaaaagta     22140
     gtgaatatat tcttgtagga agctgcaggg gttaaggaga gaaaagggat ggtgaaactg     22200
     agagaaacag aagtgatcct gagactctgc atcgtctttt ttcttctcct cacttcttgt     22260
     ttgatcggtt tggattctca gaccaaagag attgcttata tccacaagaa cgtcagtttc     22320
     agatatttgt tagctctcga gtaagtccat tttcctttat tttttgtcaa ttgtatagat     22380
     ctatgtgtaa tgtaactatt aatctcatct ctttatacag tattgatctc atgatgagat     22440
     cattattgtg ttaaaaaaaa acttgaaact ggccatcaat gtctttaaaa ctcactgaaa     22500
     taataagtct gataaagatt ctatttaatg atttgagttt ttatgagctc tgaaaaagag     22560
     ggtaatgatt tcacagtttt ttgaaggatc ttgtttatta ttttagtaaa attttctgtt     22620
     ttggttaagt ctacatgaaa atgacatttt gttcagtggg gactgctact cttttttgtt     22680
     tttggtttaa caactcttca aatatcctcc cacaaaaaag ttggatataa gttttcattt     22740
     tataattatg tttttgtgtt atgtatgatt attaattaaa agatgtgtat atatgacagg     22800
     gctgagttat acatagatgt tgtggttgct gcgtataatt tggttcaact agggcttggt     22860
     tggtacaatg ttgaacaaaa gacctccaat cccaaatggt tctcttacct cttggatcag     22920
     gtatgcagaa ctctcttcat ttatagatta tcgttgatga cactatatgt gtgtgataat     22980
     acatgttgtt aaaatagacg gcggcatacg tggttttcgc cgggacatca gccgcggcgc     23040
     aacactcatt gctagtggtg acgggttcaa gggagcttca gtggatgaaa tggtgctaca     23100
     agttcacaag gttctgtttt cagatgggaa gtgccatcat cttaaactac attgcggcag     23160
     ctctcatggt cctcctctct tccatctccg ccttcaacct cttccgtctc tattccccta     23220
     aacgtttttt tcgctttaag tcatcctcct aattaactac tgtgggagtc atttcttaat     23280
     ctgaaataat gttgatcaat gtgaagtaaa tggctgaaaa attgatttgt gtgatcttcc     23340
     actatgaaca ataaatatca tcagtctatt gcttgagaaa aaaatatagg tgtctcagtg     23400
     tatgtacgta tgtaaactta tttttgtcta aaactaataa cttttccttg tacttgattt     23460
     ttggtattca ataatatttt ggtggtagtg tatactagac aaaaatttag gatcggctct     23520
     aaagtctgga aggcctaaac ggagagaaaa agaagaccat taatcagtta ggactcagta     23580
     gccttgctag atgcctagat ggatcatgca tgaggtttaa aacatgaaaa aaagagtttg     23640
     gatcttacca aaaagagtga tagattatga tcggggtcgg gatgatgagg tagttgtgat     23700
     gagaagaaga ggaagtgagg ctcaggctag gaagattcag agagaaggat taaagatgaa     23760
     gaataaagaa gatttaggat tagtctttgg tttttgctag tttaggatta cacttaccgg     23820
     ttaatgtgca catgcactct ttgacaccta gcacaatcat gcacttagac caacactgac     23880
     caacacatgt gtagatctca gccattatcc aagattccat ttcaatctta accatccaag     23940
     tccaaactgt tcaatctctt aatttcttta atcaattcgt aatttggtaa acttttgcca     24000
     attagtttaa caggtcacaa ttcaaaactg gcccaagact aaaacacgaa gttgagaaaa     24060
     tttactacta ttttccaata ccaccaaaat ttgcaaaatg gtatctaact acgtaaaact     24120
     aataactttt ccttgtactt attttaataa cagtcaaaat ataatttatt tcctttattt     24180
     caaacattta tttcctcttt atggttcaaa attattagga gtatcacaat atatttatgt     24240
     atttaatttc tctccttatg ttttgtcaaa cacaaaaaaa aaaatatctt gtataaactg     24300
     atacaaaccc gtttcttatt tctctctcgt tttctccaaa agacttatca agccgcacca     24360
     tcacaaagct tgagagaaaa cgaaagactc gttaatcaag aaaactctca gccaaaacct     24420
     tcaaagtcaa tttgattaaa ctaaacacat caatcaaatc ccctcgtttc tcaaaaccca     24480
     tatctccttt tcttctctca ccttgtttta gccgtaaagt aatcaccttt tcaacttctc     24540
     aaaagccctc tgtttctctc atctccctct ctctgacgat gaaagagtat tggacatctt     24600
     tggcttctct actcggcgtt ttagcctttt gccaaagcct aatgaattct gtattcccac     24660
     cagagctccg tttcgccatc tcgaaactct tcaacaaatt ctttaaactc ttctccacct     24720
     tctgttactt cgacataaca gagattgacg gcgtcaacac caacgagctt tacaatgccg     24780
     tccagcttta cctcagctcc tctgtctcca tcgcaggtaa ccgtctcagc ctcacacgcg     24840
     ccgtcaactc ctcctccgtc acattcggtc tctccaacaa cgactccatc gtcgacacgt     24900
     ttaactccgt caccgtcgtc tgggaacaca tcgttacaca gagacaaact caaaccttcg     24960
     cttggagacc aatgccggaa gagaaacgtg gcttcacgct ccggatcaag aagaaagaca     25020
     agaacttgat ccttgattct tacttggatt acatcatgga gaaagctaac gagattcgtc     25080
     ggttgaatca agatcggctt ctttacacga attcacgagg tgggtctctt gattctagag     25140
     gtcttccttg ggaatctgtt ccctttaagc atccgagtac tttcgatact ctcgctatgg     25200
     atccggttaa gaagcaacag atcatggagg atcttaaaga tttcgctgag tgtcaatctt     25260
     tttacgagag aactggtcgg gcttggaaaa gaggttactt gctctatgga cctcccggaa     25320
     cagggaagtc gagcatgatc gccgccatgg ctaactatct ccggtacgac atctacgatc     25380
     ttgagctcac ggaggtcaaa agcaattctg aactgaggaa gcttctgatg aagactagct     25440
     ccaagtcgat aattgttatc gaggatattg attgttctat caatttaacg aatcgtaaca     25500
     agaaacagag cacagggagc tataacgaac cggagatgtt aaccgggtcc ggtttaggtg     25560
     atgatttggg tgatgggaac actataacgc tttcaggttt gttgaatttc actgatggac     25620
     tttggtcttg ttgtggtagc gagaggattt ttgtgttcac gacgaatcac attgagaagc     25680
     ttgatcctgc attgcttaga agtggaagaa tggatatgca tatacacatg agttactgta     25740
     cgttttcttc ggtcaagatt ttattgagga attacttggg gtttgaggaa ggtgatctta     25800
     acgacgttgt tttgaaggag ttagcggaag tggttgatag ggctgagatt acaccggctg     25860
     acgtaagtga ggctttgatt aagaatcgga gggataaaga gagagctgtg agggagcttt     25920
     tggttgattt gagaagtaga gtggagagaa atgagaagaa tgggaaatcg agggttcaaa     25980
     atgtgagctt ggaagagcaa gagaatagag ctttcgacag tctttacgca gaagagaatg     26040
     gaggagaaga agaagagatt gaggataaca tttgcaaaag tagtgatgat tgttcttaat     26100
     taggttttct aacgtttcta tgttctacac aatgtgaaag ttgtgtgacc tttcttatgt     26160
     ttctcctttt ttgggtagtt aactttttga agtaagccaa agtgaagaag aagaaggaga     26220
     gaaaatagaa aagaggtaga gagttggtta aaataagcaa gtggtggtga ttaagatttt     26280
     tgtatgtggc gatcgggaaa tgcaaagaga ttcattggtt accattggca tatgatttgg     26340
     tgttactata aatttataat agtttcgtta cacttttgac atagaattcc atattatttt     26400
     ttaacaatag catccaattc tttttaaaaa gaaaaacttg tgtgttttta gagggtacgg     26460
     ttgtctttca tcttcaccaa cattggataa gatcaatgca ttccttgtca atttttaaag     26520
     tacaaaaaac aggacaaatt gtttagcctt aagaccaaac actgaagttg acatgttttg     26580
     tttgtttact ggattttctt agcattgtgg actttctaga ctcacccgtt tgaaattgtc     26640
     ataatatggt gtcgtcgcac tgtctcttat atatttctta ctttattcgc aatataaaca     26700
     acaaagtcta tgcttatgtc aattggtcaa tctgtccatc gactctatta attgagttat     26760
     gagtgtattg tgcatagatt aataaaaata atacagtgag tatgttatgg atagatgtgg     26820
     atctctctct ctagtcacat taccacaaag agaataaaga gttgaagttt ccgaaagaga     26880
     taaaacaaca aatgtataat gtcgtgaaat aataattgtg tagaagaaaa tatcaaaaag     26940
     gaaagatttt gatattaata cctttttatg gattcggtga gaaattaaag aaagatttga     27000
     ttaagaagtg agttggaagt gatgcatgta cattattagg cttttgtcgg aaaactataa     27060
     aaaagacttc ttaagcccat tttaatattc acttttttac tttctttctt ttttgcattg     27120
     caattttcca ttgtagttta agatctgacc ctactttgta tatgattcga attatccatt     27180
     gtttaagata aaactaatag aaatcaattc gattgtccgg tgagtaaacg gctcttcgct     27240
     aacagaaaaa cctaacttga atagcttgag tcaaaacaat ctaattttta aatagttccc     27300
     aaaattttat cttaaattac tcgtaattac actagcaatc caaagtttat ttgttttaat     27360
     aaaaactatt ttgggtcgtc aaaatggccc ataaagccta attaagaaga cccaatcaat     27420
     ttaaaagccc aaatcagtgt gacgtataat atacacgtca cacgtcaatt ctcagcgtcg     27480
     ttaaagtatg ttaacaactc cgacaagatt cgttgctcta agaatcccat tccgatcttc     27540
     caataagatt ccgatctcca ttgctccctc tcccaaagtt tttcctcgga aaccagttat     27600
     cagagttcca gcaagtctcc gatttgtagc gacgatgtcg acccctgccg ccgccgtcaa     27660
     cgccaccgtc acagtcaccg atgccggcag aggatcgatc actcacgtca tattcgacat     27720
     ggatggtctc cttctcggta acttccttgt cttctttgat ctcttgcttt tggttaattt     27780
     gtgtaactgt cactgttgtt attacaagtt tttttttttt ttgttcttgt tccatgagtt     27840
     ctctgtttgt tgattggaaa ataaactgac aaaagtatag tatgatagga gactgaaact     27900
     gttctaaatt tggaaacttt aagcatatgg tttcttattg aaagatctgt ctcgttgatc     27960
     ctgaactctc tcccagtgag catagcgtat gctaaacttg tctactgttt gcagacacgg     28020
     agaagtttta cacggaggtc caggaaaaga tacttgctag atacaataaa acatttgatt     28080
     ggtctttgaa agcaaagatg atggggagaa aagccataga agctgcaagg cttttcgttg     28140
     acgaaagtgg aatcagtgac tctctttctg ctgaagattt cattgtagaa agagagtcaa     28200
     tgttgcaaga cctcttcccc acaagtgacc taatgccagg tacacaatcc gcattgatta     28260
     ggccattctt tcttttcata tatatatata tatatgtctt taaattctgt ttgtttagtt     28320
     tcatttgaat cagcctctga tttattctct ttgagtcact aatcactgaa agagacaagc     28380
     tcttagctct tctacttttc gctgtatcca atattcttcc tctaatgcag gagctagccg     28440
     gcttcttaga catctccatg ggaaaggaat tccaatatgt atagccacag ggtatctctt     28500
     tctgtattag cacatgctct tcttatagat cactgagagt gcaaatggct ttttcagctt     28560
     ctttttataa atttatggtt tatggcatat gttatctgat ttagctactt tttaatgcag     28620
     tacacataca cgacattttg atcttaaaac acaaagacac cgtgagcttt tttcgcttat     28680
     gcatcacgta gtacgggggg atgacccaga ggtgaaggaa gggaagcccg cgccagacgg     28740
     ctttcttgct gcatccagga gatttgaggt acagatggtc actaaaactg tacttatcaa     28800
     actaaagcac cagctattag catgtgtttc cacctttgag aagtttgtaa accaatgttt     28860
     tccctcttct ttgcggattt cataggacgg tcctgtagat ccacgcaagg ttctcgtgtt     28920
     tgaagatgcg ccttctggag tccaggcagc taaaaacgcc ggaatgtaag tggatttcgt     28980
     gtaacatttt ccaagttctc ttagctgatg agctattagt ggttcagttc tgactggtgt     29040
     gtgtgcagga atgtaataat ggtaccggat tcaaggttag ataagtccta ctgcaatgtt     29100
     gcagaccaag ttctggcctc tctgctagat ttcaaaccag aggaatgggg cttaccttcc     29160
     ttccaggatt cacacaacta aaacaacaaa gctttcaggg caacgttatc ctcaagctaa     29220
     cgatacttga ctcgttaact ttgattcttt aagcctctta cgctatacga gaaagattat     29280
     tgcaaattat agattcttat tggggtaatt taaaacaata tatttatgtt cgtgatttgt     29340
     tttcttgatt catgaatttg taattgttat ccagaccgtt aagtgtgact ttggtgagaa     29400
     tgatattaga atgattgttg tgagtgtggg ttacattcga aggtcatagg cttagatttt     29460
     gcgggatgtc gttaacagaa cttgaggtca actttatagt cggtagccaa gttcataagc     29520
     aagtctttgc tactattatt gtagaaaccg acatgattgg tacatgacat tgaatgttaa     29580
     aatcaaaacc aatcacatat ctctattctc taccaaacca aattgcaact tatctcttgt     29640
     aagaaacttc aatgattgca acgggcgaaa atattgtctc acttttttat tttatttgtg     29700
     tcgtccgcaa ttaacttact cacataatcg gaatccaagt tagcactaat acaaagtatg     29760
     tctttatgta gcaatgttgc atcgttttca aagaagtgtt attcattgct tactttcgta     29820
     atgatgattt tttcccactc gtttgtcgtt actatttact atcaatgatt tataaatcat     29880
     cgttaatgaa aatttagatc tattttagta atagatttgt ttggtttagt acaagggatt     29940
     gtgaaaaaga taaatttgat gattaaagag gacgcaaagt ttggcgagtc tttactctat     30000
     atagagatag ggtctaagca ttcacatgca cttatgaacc gtccaacatc aacgttaata     30060
     acgtgtgatt cgtatcaaag tttacatata tttggcaaac tttaatttat tatcttgaaa     30120
     actatatgtt tcatttttgc cgttttgagt aaagaatcgt acacccatca attttcagat     30180
     atatatgagc caatccataa ttaatctgat tgattagaga gaacgttata aacatcttta     30240
     agatcaacag tatattattg gttgaccaaa aaaaaattat tttgatggtg aaagtcacat     30300
     aaatcaagta taagttcttg tcaaatttaa agtaatctct acgaataata atattggata     30360
     catgaatcat aatttgtgat ggtataatat atggtacctt tcccgtgcaa aagaaattga     30420
     gtcattgaag tgttaagcaa tagtttgaag tttttatatt gaatattaca aagtcaaaag     30480
     cccttaatta catcatacac atcaagtcat gaaatacata taatatcaca catcaacttg     30540
     atcattcata aagtcttacg ttccatcttc tctacaggac aagagtctcc caagatatat     30600
     atacccacta atacccaaat ccatagacac aatctccctc tatatatcca tttctccaaa     30660
     cgaaaacaaa aaaaacatta agccaagaac cgcatatacg aaccaagaac acatcatcgt     30720
     tagttctaat tatgaagaag gatacatgca aggaaggatc atcaatctcg agaaactcat     30780
     cggtgggata ctatgatgaa cggatgccag agggtgttcc gttcgagtgg gagatgcagc     30840
     cagggactcc cattaatact caaccacggg aggttgttcc tccattaagt cctcctccag     30900
     ctatgctcag cctcggcctc cccaagccat ccatctccat cgaagagcca aagaactttg     30960
     tgtttccaac gaagctgaag ctgcggaatt ggaaacatct tcattgcaag agatattttt     31020
     ctagattgac taacaaaatg gttttgtctt caatttgttt gtaccctgat aaacgctaca     31080
     tgtggaaaaa atgaatcaaa cgtatggaaa tgggccgggg tcgggcaaga ttttttttat     31140
     aataataaca attttttaaa aaagttgagg acttataggc ctattgacaa agattttcta     31200
     gtaaaatttt ctatcatagg ttttaccatc taaacagcta gcgtttgctt ttatgttgtt     31260
     ctaaatctgt taacagtgtt tttaaaaagt aaaaaaaaaa tagtttatca gttaaacaaa     31320
     gtgaaccaat ttcaagttag ctgcgaatac tacttagtag tactacgatt attgttaata     31380
     tcagaaataa ttgtttatca aataaagaat gaaagttgtt aaaatctctg atcgtgtatt     31440
     ttttgtcaac gaaatgttcg tattaactga aacagaaatg tcaagttata cgtcgtcttc     31500
     attaactctg tctctgacca atatgtgtcg aaataatcat gttctgattt gtttgtcaga     31560
     aaatcagcgg atcggaacct ctgtccgggg gagaggctgc ttggtttatt tgatactttt     31620
     atcatttcct taatcatacc cccttcattt tctgaaacta ttttcttaca tttcttttgt     31680
     ttcataattg actgcaactc tccaagtatt agtatcaaat gtaaactttc ataaaattaa     31740
     ttttattaat cgctccagta cacaaaaacc tacttttaac gtgaaacaaa catcttactt     31800
     agttaccact acaatcatct aactaaccct atttactagt atttgttttt gttttattct     31860
     acaagatttt gaaagtttct agacatgacc aaaccggatt ctaacaaaac cgactaaact     31920
     aaactcttaa ctcttaagtg aactaaaccg actaaactaa agtcttggac cattccccta     31980
     agtgcaacac aaatcggcca cgatctaagc gaacgatgag atattaaatg acgaaaagat     32040
     ggacctaacg accaacgcct cctccgaatc aatagttaat gcttacccaa ctcttttcct     32100
     tattttacca tctctctctg tttgcattgt ttatatataa tatgatcgga gccaaaaggt     32160
     agagaactat cacttcggct aattgtgatg aagagtgttt taaatcatta gtttttgagg     32220
     ttttcagatt cgtttcatac attgaactca ctggttcttt gtcaaaagaa actatcataa     32280
     aaaagattca gaaatagcgt ttccttcaac agcttctcaa atggtaagtg gattattctc     32340
     tatcaaactt gtaattacaa aaaaaaactt ttaacaacgt ttaataactt tcaaaaactt     32400
     cacaaattaa tgttttaatt ttttaaaaaa cttctcaaat gtaagggtga ggcatagata     32460
     gtttatactt gtaatcataa tttagttttt aacaattcta agttctaact gttagagatt     32520
     gtacactcta attctgattt atcgtaattt tgataaatcc tgaattctaa ctgtaaaacc     32580
     ctaatatagc ggattttaga cgtgagaaat ggtgattata aattgagtta ggtttcaaca     32640
     agaaattaga tgcttagttt tgacttatat attcaattat ttttgttgtg tataggcaga     32700
     agaagaaatg agaaagcacc ttgtgctggc caaacctttt tcgttggaag atgaaaaaga     32760
     ttctgaacac actgcttcga atgtcatccg caagatcctc agcctcttta agaccgtacg     32820
     cccaggatct gatctcacca attttcaggt gacttttgtt gaaataaatc tactgttgtg     32880
     ttagaacgac tatttgcgtg ttttgttttt cctaaccaaa catattgatt tgagtttttt     32940
     tttttaaaag acagaaaaaa caaacattaa tttcttttgt tattttattt tatttgtgaa     33000
     gaacaaaaga tgaagttcgt cttaggattt atgatatcaa gtgttcttaa tattttttag     33060
     tatgtaaaat tatcagtgaa ttgtgaatat tttgcatgaa atagaaactg atacgataca     33120
     tataattaag aagaatctta ctatatatga tttattagta aaaattccaa cagtttataa     33180
     agttatgcta gcatgttgca taggtttcaa aattcatgtt aactacccat aagatatcag     33240
     ttacatgtat tatagtattg atgttttgta ttaatgctaa aaatatttgg ctcttgtgtt     33300
     tgttagtagc ttagtattaa ttagtagtgt tatctccgta ggtaggtaca ctatactatg     33360
     catgaaagtg aactgtgaac cctccaacta ttacttctct agatagagta ttaaataact     33420
     cgaaaaaacc ttttttcatt ttatacaaac acccatttat ttatattttt gaaatctatg     33480
     agaggtatta actacgtact gtttaagtag taaaattaat cataccatgt gcaactaagt     33540
     tttttgggta aattatacac cacttgtaac ttatacagat ggtataatca aactctataa     33600
     aacagttgaa catttatatt tcgtacaaat caagtcattt tccaattaat ttatttagat     33660
     tatgatgttt agcttaatta tttttcttcg atcgtaaagc tgccacctca gctgaaccta     33720
     ccaagatcac aactccaatg ttacggcgag atggtctaca gcttcgtcgg tcaggatctg     33780
     cttggggaat gcagccgccg tgatcttccc attgaacggc tcaaatcagt ggtgacgtgg     33840
     aacatctcca cactccgtcc ggtggtcttt ggcatgtctc cgtacaactc cgttctcggc     33900
     gagactcacc acgtatcgaa cggtcacatc aacgtcatcg ccgaacaagt ataatcattt     33960
     gtaatataat cattatttag tcattacaac tataaacgaa acatagactg atatatatac     34020
     atcgttaact cttaggtagt gcatcatcct ccggtttccg ctcttcatgc gactcacgaa     34080
     caagaaaata tcgacgtgac atggtgtcaa tatttcactc ctaaatttcg tggtatgttt     34140
     ttttttatca ttttagtttt gtagttaaat tgttctgcta catcccaaat tatctcaaaa     34200
     ccaagtcttt ttgttgttgt tgtcaaacct caaaaccaag tctagttttg agtaatccgt     34260
     ccaagaacga acaccaattc gaatatgcat ccggtttaca ctttcaaacc gaagcatctc     34320
     gtctttgttc aaagttcaaa catatctaat ttctgcatgt actcatttaa tggtccataa     34380
     ggtactcacg tggacgttga ggtaaagggt aaaagggtaa tgaagcttct gaatcatata     34440
     gagacttatg agatggacca accgagacta ataatgagat tcttaccggc gccgggagct     34500
     tactgggccg gaaaagtgaa aataaagtgt ccggagactg atctcgaagc tgagttacat     34560
     ttgatctccg attcattcat tgaaagattc agaggcaaca acaacagatc aataaaagga     34620
     aagatctttg aatcttcctc tggtaatcag ctctacaaca tttttggcca ttgggacagg     34680
     taaaaaacat agtcgttatt acagctctta aaaaccatca ttagctttga atgatgtgat     34740
     acgcctccca taaatatgtt tcagaacggt aatggcgaaa aatataaaga ctggtgagct     34800
     cgaggtcatt tacaatgcca aggagaatat cacaggactc aaacctccaa cagtcaagaa     34860
     cctggaggag gtaacggaga gcgagtcgac aatggtgtgg agtgaagtaa gtgaaggaat     34920
     actgaagaaa gattgggaaa gagcaagaga agctaagata gttgtggagg agaagcagag     34980
     agcgtcttta aaacagagag aggcttctgg tgagtcatgg gttcccaaac atttcttagt     35040
     ggtcaaagac ggtaaagact gggattgttc accgctacag cctacggttc ctccggcgcc     35100
     actcgtcatc acataggagc aaggacgaat cattcaccgg tttcaagatt ccaaaactct     35160
     atgttgataa ttataggttt tgaaattata aataaataga aaaataggtt gatacttgat     35220
     aatgacatat ccgtcaataa gtattaaaga tgaatgatgt tttttgtcaa ttcatttgag     35280
     gttgaatgtg tgagtgatac gtcaggcttt tgagaaaaag agttcttaaa tactatatgt     35340
     ctatatgaga tttttcacct atgtaataac agaaaatatt ttgtttttcc tctacaaaat     35400
     tatttataat ccattaaatt tgaaaatgaa gattcaatct acttctctgt tattcgatgg     35460
     tgaatttgca tgtattaaaa taatctgtgt taaaataata aatcaatttc atctccataa     35520
     taatttaata atagttaagc attagggcaa ccttatttaa aagcattaag cgagccttaa     35580
     atgacgaaaa catggatcta acgagtaacg actaacgccc ctccgatcga atcaatagtt     35640
     aatgctaacc caactctcta ttttgatatc ctatctatct ttctagctag ctatatagat     35700
     ggagcaaaaa gattgatact actagtaatt gtcactatat gtactactta gtacgtaagt     35760
     catagctcct tggctctttt cttaaaaata atttcttttc caaaagtaac aacctcaaat     35820
     ggtaattact tagtgtgagt cattgacttt ttggtaaaga agtgaatcat acacgtagat     35880
     taaatttaca gatctaatat ttttggttgt gtataggcag aagaagagaa aatgagaagg     35940
     caacttgtgc tggccaaacc tttttctctg gaagatgaga aagattctga gctcacagct     36000
     tcaagtgtca tccgcaagat cctcagtctc attaagaccg tacgtccagg atctgatctc     36060
     accaattttc aggtgtaatt tcttaaaatc cttgtctaat ttttgttata tattacagaa     36120
     cggacaacca ttgtgtatat tttttctata caatcattga atttttttgg tgaagaaaag     36180
     ttttttttta aggataattg ccctcttttt tttttagtgt tttctttaca tatcaaataa     36240
     tactgtgcat gaaatacaaa aagataaaat ctatatggat caaacagttt agtaattcct     36300
     aactatgtta tatatatttt ccgtacaaat cacgtcattg tccataaatt cataatatgt     36360
     attctgttat taactattct ttaacaaaaa aaagagttat taattattat aactattgaa     36420
     tgtaaagctg ccacctcagc tgatcctacc aagatcacga ctccaatgtt atggggagat     36480
     gatctacagc ttcggcggtc aggatctact gggcgaatgc agccgccgta acattcccat     36540
     cgaacggctc aaatcggtgg tgacgtggaa catctccaca ctccgtcccg tggtcgttgg     36600
     catgtctccg tacaacccca ttctcggcga gactcatcac gtctccaacg gctacatcaa     36660
     cgtcctcacc gaacaagtaa aataatttca ttttataaaa agaaacaaaa aaaaatttat     36720
     aggaaaagct caactgaaat tcacaatcta tgtagatatt ttattaatac acatgagttt     36780
     ttttttttaa aaaaaacaat acgaaaatat aaaatttagc tcagtttaca catttttttt     36840
     aactcatgaa agtattaagt attcactagt gttgtgggtt gtagatagtg atccgtcaaa     36900
     caatttaggt attatataca attttcaggt aatgcatcat cctccggtgt ccgcacttca     36960
     tgcgactcac gaacaagaaa atatcgacgt cacatggtgt caatatttca ctcccaaatt     37020
     tcgtggtatg tctttttttt tttcatttta atgtagcagt caaattgttt ttgctacatc     37080
     caaatgatct caaaagtcaa aactgaagtc taatttttga ataattcgtc caataacgaa     37140
     cagaaccatc cattactttg accatgcgtc cggtttactc taaaaccgaa ccatctcgtc     37200
     ttgtttccaa catctaattt gtcctcattt aatggctcat aaggtgcgta cgtggatgtt     37260
     gaggtaaatg gtaaaaggat aatgaagctt ctgcatcata aagagactta tgagatggac     37320
     caaccgagac taattatgaa attcttaccg gcgccgggag ctcattgggc cggaaaagtc     37380
     aagataaagt gtcctgagac tgatctcgaa gctgagttac atttgatctc cgactcattc     37440
     attgaaagat tcagaggcaa caacaacaga tcaatcaaag gaaagatctt tgaatcttcc     37500
     tctggtaatc agctctacaa catctttggc cattgggaca ggtaaagaaa cttggaacca     37560
     taacgtcatt acagctcttg aaaacatgaa aagctttgaa tgatgtcatt aacatatcca     37620
     tgatgtttca gaacggtaat ggcaaaaaat ctgaagactg gtgggctcga ggttatctac     37680
     aatgccaatg agaatatcac aggactcaaa cctccaactg tcaagaatct gcaggaggta     37740
     atggagagcg agtcgacaat agtgtggagt gaagtaagtg aaggaatact gaagaaagat     37800
     tgggaaagag caagagaagc taagatactt gtggaggaga agcagagaga ggctctgaaa     37860
     cagagagagg cttctggtga gtcatgggtt cccaaacatt tctcagtagt caaagacggt     37920
     aaagactggc actgctcacc gctacagccc acggttcctc gggctccact cgtcatcaca     37980
     gagaaataaa ccactttcaa gatttcaaca ctctttgttg atgatagctt aagttattac     38040
     aattccatgt aacataaacc aattaataac gaccaaacca acagggaaat cacaaaaatg     38100
     aaactcttat aaccaaaaat ttctgctcta attgcatata accaggcttt tagtttcatc     38160
     aagaaacatc aaaatccaag aataatttca gtttcttcag aaaatttaca gtatctaaaa     38220
     tatccatctc tgagacatat ttggaacaca attaggtcca agaatgtgtg tgtttggttc     38280
     aagaatcctc tctcagacag ctgtgtttgt gtagtttggg aagaggttga ccaatgtgtc     38340
     gagagtatca ggatggaact ttcttgcaaa tagatagcaa ggccgtttaa tcccgttcca     38400
     tgtacaaggc caatgcagct catctccatg cttcaaaagc acaagtaaaa atattaaagt     38460
     gagagaaaaa gaatagaggc tgcaagggag agtcacaaga gcataccttc cccacactgg     38520
     tgacatgtac actcatgtcc tcggactgca caagcgagaa aagagaaaag tataataaga     38580
     tgtagattgt gacatttttc gaaaagactg cgttttgaaa catactgtga catttttcat     38640
     aaattctaat gaaatctcgt ttcctccgta tgtctttgga tgccaccttc gttcagacca     38700
     atcaacaaac gtcactgacc aatttgagat ccccatggga tcaatcatct gaaagaagag     38760
     ccgacaaata aacacttttc agcatcaaga ggcttaaaag attgtaaaag atggggtgtg     38820
     aagaaataga ctcacattga agaatgttgg caagtaatgt tcatcggcaa tgcagttctt     38880
     gtcggcctct attccaggct gaaatttata gaaacttaat gtcagaatca gaactcaaaa     38940
     ggaagagaac ttaaaactga tccgagataa aaagatatga aaaccaaaaa tgttcagctg     39000
     caggataaac ttactccaca atactcgcgg aattttgagt agtaaagacc atcggccatc     39060
     actataatcg cgtgttgtcg cttcattgtg aaccactggc aagaagaaca gagaacaatt     39120
     acacaacaaa aggtgccaag aactcaagtt tgttttattt tatggcagta gcagcatact     39180
     gattaaaaga tgctcttaga gattaaagct tgtctttacc tgagcaccct ttctaaaatc     39240
     ttccttggcg atttctggta acatgtgttc catatgtcta ccggttccat gtggacccgg     39300
     atccacaaaa cttgagaaac agagagatag ttgagcttgg gtcagtgagt attactggag     39360
     aagtcaaatt tttgtttttg ttttgagaga gtaatgtacc tctcaatgaa gctaacgttg     39420
     gagtacaaca aatatctata agtgtagtca aaagtatgca acggaataca actgcacaca     39480
     aaataatgat gtgatttggt tagtgcagaa aaccttaagt aggacattta agcaacattt     39540
     aaatcattag tcattacctc tctgaaacaa gaacaaagtg ttggttgtca ggatcttcaa     39600
     gagcgctaac cagtaaccgc ttctcagcat caaccataga aatccttccc caagtaacct     39660
     catcactgtg aatctctcga tcagaaaagt gacggctgat gtgaactggt cgttcctttg     39720
     acgggtggat atatatcgag aatttccctt catgaccctt cacaaaatca aaaaccctca     39780
     ataaatcaat taaatgtata gctaaaactt gtacatcgca tcaatgtgtg tcttaccttg     39840
     aaaaattcat cccagagctt ctcaaatggc aaagtaccgg gagtcaagaa caagaaagcg     39900
     attttggagt tattggttat gaagggaggc gttcttagta tgtctctaac cactgctcga     39960
     gctgctatct cctcatcagt gaatttcctg acatgaacag gtagccactt agagagagca     40020
     tcctcacagc ctctggtgct atagaggccg tgacacgagg agctcttgcc atgttttgga     40080
     tacatgtgag tacagattag aagcatgctg gtcactgaga ctgtcaaaac aacccataag     40140
     ggcttcttca gagatgtgtg gtgacgtggc ccttgcaaaa tcttctgcgt ctcacccatt     40200
     gaaaccaatc taaccacctc ccctcttctc ctttctaatt gataggcata caaaaattga     40260
     atcttttttc acctactcct tttagattgg cattgcctga tgaagaacaa agactctctc     40320
     cgagattaga gattccggaa aacacggaga gattaagtaa tgtttcaaac taatcttaag     40380
     aagaaaactg cttcagacag aagcaataag caaaatgcac gttgttcccg tgatacgggc     40440
     agtgcaggac attcctcaga aaacactctt tagcacacgg acaagcttaa caagtctaat     40500
     aagtctcgtg atttattctc cgaccaaaca aaaatcaaaa gctacaaatc ccagattcaa     40560
     ccctccagca acaaaaagac actgtaatga ctaacgagca ttctcagtca aaaagagtca     40620
     aataaaagtt tacctcgagc tgaatcgaaa cggtagagaa tgcagaaaga cagaatcttt     40680
     gtccgaaccc agatctcaaa aaagtataat ttgatcctcc ttgtctttaa gatctagggc     40740
     aaagaaaaaa aaaaaaaaaa aaaacccaga agagtgattc agcgaatgtg aggtcaaaag     40800
     agagagacgc gagagggaaa gttttccttt ttttgcttta agagaaaaaa aaaagcttta     40860
     atcttttaaa agaacaagtg gaagaagatt ccgatcgttt tggtttcttt tatatctgag     40920
     tgtactacta ctgcctctga attaaaaaaa ttgaagaaga gactttttgg tgaaaccaac     40980
     aagtcttcct tctccagtga ttgaattcga aaacaagaga gtacttaatt aattccagca     41040
     gtctattttc tccaataatt tcttgttagt attaaactag tgatataaaa gttcccaaag     41100
     aatctaaatt ttgttttgga ttggagttgg cttcacgacc tttttttttt ttttaagttt     41160
     tagtattcat tttatatgaa tggaatgggg caatggaaag aaaaatagtc caagtgggtc     41220
     tcaaaaataa acgaatttag ctctgtcaat cgcacttgtc tcttcatgtc attcgccggt     41280
     ttgctccttc cacgacggcg gacgatctgc ttttcgacat tactgtcttt taattttctt     41340
     ttagttgcct atttttcgtt gttgttgtcc attacgccat tattactttt actaaacaaa     41400
     taatattcaa aaatataaca actaaaaagg ccaattgttt ttaatgaccc ctaaatttga     41460
     gaaattagga aactggccat ttgaactttg aagcgcctag aaataatgag ctgcctggga     41520
     ggcagagcta cattacacag tgcggctggg catctttttc tgaggttaat gggccaagtg     41580
     gtccggcccg tataggccct taaccaaaaa aaagaagaaa gaaagaatcg tacatggaag     41640
     tttgaggtgt ctcttagcat catgagccat agtgtacaaa tgcatcaaaa gattagacta     41700
     aaaaagagtt gtacgaatag tgtgatataa gcagaatatt cgtctttgaa acatcttatc     41760
     attgcccaat ttggatatga ttcggctagt gaaatatggg tttatgtttc atcgaatagt     41820
     agacatttat cttatgaaaa gtgcattagc ataaacgaat atatggcttc cttaagaatt     41880
     cgttgtattt gtatctgact aatggagatt tctttgtgca agtagagtat tgtttctttt     41940
     ttgtgtgtgc gggcatgtac ttgtaaatga cttgtggaaa tttcattatt caagtacaaa     42000
     tacaaagaaa tttccattga ttaagatgtt ggatagtagt agctagttct tttttccctt     42060
     cgaaaaaatt aaattaaatg gaagatagat acatagcatc tgctcggata ttagtatgtt     42120
     gaagcctcaa aagggcctaa tccaaacatc gcaattcata gtaatttaga gtatgaccaa     42180
     agtcaaccaa tataactatc taaagttatt tcagtttttc taattttcac atctataaag     42240
     taggaaaatg atttggatta gtataaaact agcaaaaaag aaaatttaaa ttgtagagtt     42300
     tgtacctata agtgtagacc attaaatttt gttctgcatc tgatcaaatc tatacaagat     42360
     caatattaat cctatacgaa ctataaatca tgagaaaatc ctcccggaaa aagtaatcca     42420
     aaagaaagat tatgaaaata ggcacactga gcagtaatca aaatctgttt tatcagatga     42480
     gaaattgttc taatataatg gatcaagatt aaactccaca cgtctcaggt tttagtcgac     42540
     accatttttc tttctgattt tggacaagag caaatcagca aaatgtgagt gagtttctat     42600
     ggttttgtca caaaactttt gtgtgtgggc tcgttggata cacaaacaaa gtcaaaggtt     42660
     agaaatttat tgagttttgg gtatttccgg ttttagttat gagtcacata ttctttcaca     42720
     aaattcagac ccacgttttt agcaattgaa ttcaactttt tgagttttcg tctgttttac     42780
     tttctcaata taaattttta actttgatac tatatataaa tttttaatat aatatgtaaa     42840
     cttgttgtac atgtttcagt tatacttagt gttttaacaa ataaaataca ctcagtcaat     42900
     caaaaatcaa ctgagtttct aatgttaaag gagtatttat ttttgtaatt cagttaacac     42960
     ttctaatcat tttcatgaaa agctttaaac atatgctttt agttttcaac aaacatatta     43020
     caaaagctat taagttaatc ttcaaagtta ttaagctaat aacttataaa cgatatttta     43080
     cacataataa tgttagttgt agttagacta accatgactt aatcacccaa agagaaaaca     43140
     attctagaag actagaagga acatagaaaa ttaaaaaatg atatttaaag aaagaaagta     43200
     ataaaaattt ggtaaaccga taatgaataa aaagtcaaac tccataaact tcgcggaaaa     43260
     agaaaagcac cgtaatggtg gaaatatttt tgccattacc ggaaaaaaat ccaaacattt     43320
     taaaaatccc actgacttag ccaaagatgg tcactttttc tctctccccc ttgtctctct     43380
     gagcaccaga atctagggtt tcttcacagt gaatcttttt tttttttttt gcttcctcct     43440
     caataatcgc cttctcgtaa gtcaatcact ctccctctcg tcacttctgc tccctatgtt     43500
     aaaaagttca ttcatttctg cttttctagg gttttttttt gggatttcaa agtctagatt     43560
     tttcttctct gttctactta cactctgttt cttctctctt tatctctctg cctctctttt     43620
     gggtttctct gtttttttct tttaatggag gaccatttac atggtcatgt atttctatct     43680
     gcgtggagat atttcgtagg ctttaaagtt ttgtgcttgt ttgtttatat gttctttact     43740
     ttaaagttct actctgttag tactctgtct gcggaattag attactggta gggatgtaaa     43800
     aaaccttgag gaaaatggta gagattctga ttagaagcta tatatcattt gcttattcca     43860
     tagtggattg atttagcttg tttaaattcc agttcttttt gtgatagtcc ctttcttatt     43920
     tcattggtga taaatttgtc tttaggtact tgtgtgaaag ctcccttctt tgtggagaaa     43980
     tggcaactga gaatcctatt aggatatctg gaagcaatga aagatggtct aattctagga     44040
     aggtttctgt tcctaatcga agtggcagtg cgccaccgaa catggagggg tcttttctag     44100
     ctgtggataa tctattgtca cgacagggcg gctcagttta caataacttg atgctaccgc     44160
     gttacgggtt tgaggagccc gtgaccactc atccttcttc taaacatagc cttaaccgca     44220
     taccttctcc accgatttat taccctactg agtatcagtt catagacaat cgtgtaggta     44280
     gatttagaag taaccaggga ttgaataaag ttaattctcc cattcatttg tcccaaggca     44340
     aactttctac tcataaggaa gtttctgagg atgaaagctc ccaacagtta tctgttaata     44400
     gtgtttcaga taggacagat ggattggaca ttcgtctttc acctggttct caaagtttgg     44460
     ccgatttcag gcaggttagg ctttgctttc tttcccctct ctggttgtga gtagtgaaat     44520
     gtcattgttt agccctataa gaattgattt tttttttttt tttggtggca ggatgatact     44580
     tcttctgggc agacccctca acatagtcgg tctaactctt caaatggtga agtgaacaca     44640
     gcagatgaga gtggtaactt ctcagagttg tcagatgatg tcgtggttaa agataatgct     44700
     gcttcaacgg caagagcttc cattggcaat gagaagagtc ctgatgaatc gactatcatc     44760
     tccaaaatga agagtactaa catatccgga cctggaacgg ctaaataccc tcgagaacca     44820
     aggtatggac agccagaaag gcagccgcat caacagcaaa ataatgcaac ttggattcaa     44880
     ggtggcagca atatgggttc tcatggtgta aacgatgcag ttatcggggc cggacagttt     44940
     cattatggac aaccttacaa gttctcgggt gatggtcagc ccgtacttca gtcttccggt     45000
     tttacaccgc ctctgcttta cactgctacc caaacggctt atatgacttc accagctcat     45060
     gtctataaca tgcagtctcc tgctgtttat tctcctcagt atggttatgg accatacacc     45120
     aacatgatcc ctcagtttat gcctggatac ccttcccatg gttctgttcc tgttgttgtc     45180
     agtccagatt tcattcctca gttatctggg ccaagtgcag gaagtgtggt ccatggaggt     45240
     gaaatgcagt atgcggagaa gctctatgtt ccaccaggac aaccttcttt tccagatcct     45300
     atgtatatgc agtactgtca acagtcattt gggcagatgg aaccactggc tcctaggaac     45360
     cacaccaatg ctcccgagtc tcagaaagat gatccaaagt tccttcgaca aattagaggg     45420
     ccaagtaact ctaatatggc aagaccggga atgggtgtta attactatgg aatccagcca     45480
     aatatgggca ttatggtgca gtatctgcct acacatctcg gccctcctct ttcaccaggt     45540
     catgttcctt atgtcgaggc atatcctgga tggcagccac aagggagctt agaaggtgcc     45600
     aatggccctc gattgtgcaa ttttcttgaa gagctgaaat ctgggaaagg taggaggttt     45660
     gatctatctg acatcacagg acacattgtt gaattcaggc aagtttttat cttttctttc     45720
     agaagtctcg tctcgtctta ggtttcttcc caattatatg ataacaaact tgagtaaaat     45780
     cttgtttcct ttcagtgcgg atcaacatgg gagccgattt attcagcaaa agcttgagaa     45840
     ttgtaaacca gaagaaaaag cagctgtctt tagggaaatt cttcctcatg cttgcaaact     45900
     catgacagat gtgtttggaa attatgtcat tcagaaggtc tgttcctact tgatcctgtt     45960
     tcttaccgtg tcttgtccat cacagtctat cccttttatt gattatttgt gttgtctgtt     46020
     tcagtttttt gaatatggaa actcaacaca gagaaaggaa ctcgctgatc aactcatggg     46080
     acaaatagta ccacttagtc tgcagatgta tggttgtcgc gtgatacaaa aggtacaaag     46140
     gtcaatacat tttgtttgga cttgaacttt taaaacaatt gactcatgag tgaaacgttg     46200
     ttgtgtaggc tcttgatgtc atagaacctg atcagagagt tcgtttagca cgtgaactag     46260
     acgggcaggt catgagatgt gttcgggacc aaaatggaaa ccatgtgatc cagaaatgca     46320
     tcgagaacat cccggcagac aaagttggtt tcatgttata tgcattccgt ggtcaagttt     46380
     cctcgctctc tatgcatcct tatggctgcc gtgtcataca ggtactgaga agttagtgct     46440
     ttttttttgg caacacatag aacttaatca aaccattgtt ttttccttct caatttcttg     46500
     gtttctttca ttgttactca atgcggcctc acattttcct ttcctttctg tagaggcttt     46560
     tggagcgttg ttcacatgac catcaatgta ggttcattac cgaggagata ctggaatcag     46620
     tctgcgtcct ttccaaggac caatatggta attatgtcac acaggtatgt catgccattt     46680
     aaaacttaca aatcatttac aactgaagtc aaaataaacg gactaaccag taataaccga     46740
     tgttggtatt tggcagcatg tcttggagaa agggacatct gaagaaaggg agaggattgg     46800
     gagaaaactc tcagggcaca tcgtgcaact tagcctccac aaatttgcgt caaatgtaat     46860
     agagaagtgt ctggagtatg gtggtcgagt tgagcgggat ctcatcatca aagagattgc     46920
     agggcctgac gagagctata atagtctatt ggtgagacct tatggaccaa acctgataca     46980
     ttttctgctt gaactgatta gattggatat taactgtaat ccacctttaa cagatgatga     47040
     tgaaggacca gtatggaaac tatgtggtgc agaagatatt cgagacatgt acggctgatc     47100
     agcgtttaac attgttcagc cgagtgagaa tgcatgcatc tgcattgaag aaatacacat     47160
     atgggaaaca tattgttagt cgtttggaac agccctctat tgaaggtatg aaattcccca     47220
     atgtaagtca agttcaaaag tgaggtgaat aatcacaatc tttaggaaca aaagggcttt     47280
     gctgttatac catataagct gaaacagggc gaagtacaca atcaaatata ttttctatgc     47340
     taaaaaatgg tcggtgaatc gctcaagaat gacatgtcac atgtgcatat agaaatgtgt     47400
     ggtagcacaa gactgaatag aataagatgg gattggtagc acaagactga atagaataag     47460
     atgaggattg gtatatggat caggaagagt tacacattgt gtttgttgtt tctgcagaaa     47520
     accaagaatt gaggagatga gtggctcttc tgatttcaag acagtgggct gactcagatt     47580
     cactcaatac aattcgcttt ttcatgaaag ctggatattc attgggaagg tcttagatga     47640
     ttgtgaagga catcgatatt gttgtttact tggaatttta tcatagccgt tgtgatgatt     47700
     gtgtggcatg ttctgtaaat attcataact gtatcagtag tttacttcag atctgtaact     47760
     ggtttgtgga atttcacatg gtattcgaaa ctttctagat actagagaat attattattg     47820
     aagccaaaca ttacatgcta atcctgaaat agcctcctct tcctcaaatt tcatgagcta     47880
     cagattctta tcacatttca acactgtttt gagactttct ttcattcatc tgacatgagg     47940
     agccaaagta taggatcgaa agagaaactt gtcattactc acgaaatata attgaaagca     48000
     gtgtagcata tcacacttga caatggaaga aacaccccac acaaaaatgg aaagctcaaa     48060
     ccaacacctc caaaatacta tttcaatctt aaccaaagag atcgaatccg aagtctcctt     48120
     cttcctcttc tgattcttct ttcttcttct catcttcctt aggggcagct gcagcttcac     48180
     ccgcaccacc tccacttgag gcagctcctc cagcagagaa tcctccacca ccaccaccac     48240
     caacaattac ctacgccaca agaaattgat tccaattgat aaaaattaca atgcaaaaca     48300
     ggaattatac acaaatattg atttgtacta gtttccggag ccatgtaaac taaagtcacc     48360
     tactaaaaca gagaaggcaa ccaaaaacaa attgagtgat ttagctatta caaagctgta     48420
     acctttaggt atcattgtta acctataaaa caagctacat tgacgcaaaa tcacatttga     48480
     tgcaatgata agagaactat agtgagccat gacacttgta tcactgatca acgaccataa     48540
     ttactgtgaa tgaatcattc atctgaaaat gcaagctctg attctcacac agtattgcca     48600
     atttcaaaga tgcacgatct caaactgtaa gcttgttcga gcaagagaga cttatacctg     48660
     gaatacggcg gaggtagggg agacaagaga aaacgaagac tgaacgccac cggaggaatc     48720
     agcggagaga gatacctgaa cgagcttacg ctggagctcg taggtagaag aagctgaaga     48780
     ttcaagttct ccttcgtgtt gcttcgcgct ccacgcgccg cctccattct tgcatacgaa     48840
     tgtgaatact cccatcttct tcaatgtctg ctaaaatcga tggcgatagt gagagatttc     48900
     tggaaaaagt gacgatcgag agtggttttg tttttatata cgatgatgaa cgaaagctca     48960
     aaaagaagtt aagaacccta gttttttgga ggtctctgag taaaagactg ttttacccat     49020
     agtggactta taggtcttaa atgggccact tttgagagta atgaatatat ataggcctag     49080
     agtgaatagc aacaacccac caaggttctt tcacttcttt gaaaaaccaa aaaagcaaag     49140
     atcaacaaaa tttatcagat tctacgagag tcatttccta acacatgaga tgatgagatt     49200
     attagagtat cacaactctc aactatgttt ttccataaac tatgcatcgc accattcacc     49260
     acatgatatt gtaactctta agtctaagcc atgaaatcaa cattgaagta aaagaactca     49320
     catagtaaat tggttttcta ttggtttata ttttaacaaa attatactgt actcatgtca     49380
     tctttatgtc accaaatcac aaactaattt tctactttta aaacaaaaca tctaccaatt     49440
     ccaccacata tcctaaaaac tgactcaaat ctctcaaaat ctaaaatttc ctaaattcca     49500
     caaaatcatc cataatcttt aatcctcctt agttatgata tcaaaaaacc attttatttt     49560
     aagtatctaa tttccttgcc ataaatttta ttctctagtt tagctaaact taattggaag     49620
     taaagtttat tgttgctgat atataataaa atattttcat gtttaaaaat ctaaatatag     49680
     ttgaatggac tctttaacaa gaaagtaaat attggcgtct ataaggtcaa gagatgtggc     49740
     gtaatgacta cttttgagca aatcagtgga caaattaaga ctttccaatc tttcattggt     49800
     caagtctaaa tataaatgat tggatttcta agtttcattt cctgttttta ggctcactcg     49860
     tggacttttt ttaatttctt tcctttgcca tatttataaa ataaaagaga gagaaagaat     49920
     tttcaataat tttcaacaag caaagttcat gatggggaat aagcgaaatc tcggatttgt     49980
     gatcttcttc tgggctctgg tggttgcagt agtagccacg gccatcgagc atcgtcgcaa     50040
     tgagaggact aaaggcgtca atggtcttga caagatcatc atccgcgacc gtcgtggccg     50100
     atctgctgag gtactcactc ttacggtttg gtttagatct attgattgtg tcatttacat     50160
     caaaaaactt ggcttcaaaa catcttttgg atattgcatg atgcagattt tgtttctttg     50220
     tttattcagg tttacttgta tggaggtcaa gtcagttctt ggaaaaatga gaatggagag     50280
     gagttacttg ttatgagtag caaggtaact tcagtcagat tcactctatc tccttttagg     50340
     atcatatgat tgctacaaat attgttctct gattggctaa aaatattgtt ctctgattgg     50400
     ctgtatctgc gataatgttt ttttttttgt tttgcttttg tatgtgcaat agttgactaa     50460
     gtaaattatg caaagatgaa tctttacatc ttcttttttt ttgttttgaa tctttacttc     50520
     attagaggct tgtaaatgaa tagataagta tagcttaata atctgctttg ttctaaagta     50580
     gtagtaattt tatgtgtgtg tatgagttcc aaagcagagt gatctaaaac atgtgttacg     50640
     tattgtgcag gctatattcc agcctccaac accgattcgt ggaggaattc cagtattgtt     50700
     tccgcaagta tgtgtttata gaaaaaaaaa cttttctttg ttgttgaagg gtatagtttt     50760
     gttaatgaaa tgttttttat ggaagtgcag tacagtaaca ccggtccact tccctcacat     50820
     ggatttgtaa gacagaggtt ctgggaggtt gagactaaac cacctccttt gccatcactt     50880
     tctactgctc atgttgacct gatcgtaaga tcatccaatg aggatttgaa gatctggccg     50940
     cataagtaag attcttgaaa catctctctc tctctctcat tttcaacatt ttttcagata     51000
     tttgattagg aatattttac ataaaatatg gagactgttt tttaatctat gtatccattt     51060
     caggtttgag tatagactga gagtagcatt gggacatgat ggagatttga cgttaacatc     51120
     tcgtgttaag aatactgata caaaaccatt taacttcaca tttgctcttc acccctactt     51180
     cgctgtttcc aatatcaggt aatccaagga gtcataactt cacgttgata tctttttttt     51240
     tggttgtgtt ggtgtaagtg tcattgaatc agctggttgt tgtattcagt gaaatccatg     51300
     tcgaaggatt acacaacttg gattaccttg accaacaaaa gaacagaaca cgtttcactg     51360
     atcatgagaa ggttataact ttcaatgctc aagtaagcct ctttccattt gccaattcaa     51420
     atttcaaccc ttttattatt ttagtccatc actaaaaaaa aacacacctt gcaaaaaaag     51480
     cttgacaggt tgtacctaag cactccagat caactaagaa tcgtggacca taagaaaaag     51540
     aagactattg ttgtacacaa ggagggacaa gttgatgccg gtaattacaa atttagattt     51600
     gtaaacatac atagacatag acacagtcac acagaaacag attgttttag tagtactaat     51660
     gatggatcac ttgtaattac aatgtgcagt ggtgtggaat ccatgggata agaaagtatc     51720
     cgatttggga gttgaagact ataagcgttt tgtaacggtg gaaagcgcgg ctgtcgcgaa     51780
     accgatcaca gtgaaccccg gcaaagaatg gaaaggaata ctccatgttt ctgtggttcc     51840
     atcaaatcgg aaagcttgaa ccctataaaa gtcttgcatt catcatcctc atcctttaaa     51900
     aaaaaaaact taaaactgtc tttattaaag tatacttaat gttcccgaga gacatcacat     51960
     ggtgaacaca aagttagttg ggttccaaac tggactcttg accagtttta ttgttttgta     52020
     actttagcat tcatgaataa aaaaagtgcg ttaattacaa taattgttaa atgtaattaa     52080
     ataaaagtgc gttaactaca ataattggat attggttatt tgcaaaattc atgttcttaa     52140
     atcatcagtc taaacaaaaa aattagatta gccgaagatt tcttcttcta cccttgatga     52200
     tactatttgg gatgggcttg cttagatgtg ccgaatccaa ttctcgtttt tgggtctatc     52260
     tatatttggg ctgggcttta taagaggcga agcccatgtc gaacaatcaa ttttttttta     52320
     attttatatt tcttttggga gtctgttctg tcgtattgat taataaagta aaaaatctta     52380
     gccacaaaat taaatcatct ccaagacgta tcaatatcat catcaatcca ccaatgaaaa     52440
     gttctctctt tttttttccc actcttactc tgttctcgct acagaatctc ctgggaaaaa     52500
     aaaaaaagaa acttgatcca cccgaattcc ccaaatcttc acaatttctg gaaactctct     52560
     cgatcgtgaa gcagaaaagt gaggttccaa atgggttctg tttcgggtca aacccgaatt     52620
     acaacgatga acctctcgct ctcaacagca gagaagaacc ctaatttccg ctcgtcgctt     52680
     ctcaattcta aggtaattgt tatcacttcg tcgagcttca ccaaaaaaat gactcctttt     52740
     gcttgatttc ttcttctcct ctttcgcttg tgtttagaac gcaatttcag atactttagg     52800
     ggtctcttcc aaatgcagta cattcctcag gggtcaattt caaagaatac atttttcttg     52860
     gctacaacac actcgacctt tgagaaaacg aacaggtact tgatttgcaa accagaccaa     52920
     tctctttaga actttagttg tgatttagat tcttgttatg tttggtttag tatttggtca     52980
     cgtgagctgc gtcatgccgt taacggaaga gaatgtggag agagtgttag acgaagtacg     53040
     accatctcta atggccgacg gaggaaacgt ggcgttgcac gaaatcgacg gacttgtggt     53100
     ggttttaaag ctacaaggag cttgtggttc gtgtcctagc tcatcaatga cgttgaagat     53160
     gggaatcgag agtcgtcttc gagacaagat tccagagatc atgtccgttg agcagtttct     53220
     tgaatccgag acaggaggtt tagagctgaa cgatgagaac attgagaagg tttggttttt     53280
     taaaggttta gttatttttg gtttattagc cccttggttt tgaaattgat ctgaatggtc     53340
     cttttttggt ttgttgtcaa tttaggttct ctctgagtta aggccgtacc tatccggtac     53400
     tggaggtggg gggcttgagt tagttgagat tgatggttac gtggtcaagg ttcgactcac     53460
     tggaccagct gctggagtca tgactgttcg tgtcgcgttg actcaaaaac tgagggaaac     53520
     aattccttct ataggtgcag tccagcttct agagtgacat taaccttttt attttgtaac     53580
     ttatatacaa ggcctatttt tgattcaata tattttattt ccaattatat aattagtaca     53640
     actaatacaa taaccatttc tgttgaagaa aaaggaaaag aaaaaaaaag tatcctatgt     53700
     atgaaggaca ttttctctag tgatccttgt ttttaggtaa cagttataaa atattcatga     53760
     cttgactaca caaagataat cgaacttaaa gagttatttc cttaaaccaa ttattctcta     53820
     attaaatatg catttatagc gagttcttgg tgagcaagga tactagaatc tctataataa     53880
     gtcggacata agaagatatg aggaaacaca gacataacat agttaagagt ttcaacaatg     53940
     tcaaagctta taatcaaccg aatattcaaa ccctctgtct gcaaaaattt cctcgtacgt     54000
     aagcttctct tgctttttct ttttaacttt aattttgttc ttgttgtctc tgaatacttg     54060
     aacataacta tggcagagac acgcaaacgt tcgtctgttc tcatctgcaa ctcacacgag     54120
     tactaaagtg aatcagccct tctcgtctaa accagccttc ccgtttctgt tgattgacta     54180
     catcctaaac aacccaaact cttcctccga tggtcgcgta acaacaaacg tttacggtaa     54240
     tgaaaaggaa gtcttgatta aggacaagga tcttaaggag gaggtctgtg atgcgatgac     54300
     tgtcgggttt tctcgtgatg ggttgcgagt cgagctttgt ggcaaccacg gcgatgtatg     54360
     ttctcccacc atcttttaca agcctactga ccccgaaata gaagacttga ccgttgatct     54420
     acctcctcta ccgacgggtt cacaaatcca aagcctggtc atgtcctctt tacctaaacg     54480
     agacaaaaat tgggtagttg ttgtcaagtt attgggatct cagttgagta tgtgcaggcc     54540
     ttttggcagc cgtaaatgga tcaacatcca aaccaagcct cagaatataa acccttcatc     54600
     gagcatcatg ttttccaaga aagagaaaaa gttctacgtt ccaactcccg gaggcaacat     54660
     cttgtgctat ttggatcctc actcagagga cgacgaccta attgatttcg tggaattgga     54720
     gtttgacgat cttccaaaat cggtgtttca agagttggcc gacgtgagta catgttctag     54780
     gacagaccac cttgtggagt cacccaccgg ccaacttttc ctagtcaagt ggtatactat     54840
     ctaattaaag ctatatatag cttttgtctt cataacatat ataccaaaat ctctaatcct     54900
     ttgcttgagt atcatattgg cgcgctttat catgtctttg caggtatgga gaggatttag     54960
     aggacattga caacaccaca ctgtataatg taacaaaaaa gttcatggtg tttaaagagg     55020
     gagagaaacc gagttgtgtc tacactaaga agatgatcta tacagaagac attggagatc     55080
     tttgcatttt tgttggacat agtgaggctt tctgcgtccc ggctagctcg tcccctggcc     55140
     tcaagcctaa ctgcatctat tttgtgggct ataactttgg tgtttatgat ctcaccacca     55200
     aaacttgcac tatgttcctc acaaaagatg ataatccatt aaggaaattg gaattccctt     55260
     actggcctcc tccggcttcc tttccagtac tagctcctaa ttaattatct ctcttgcacg     55320
     tgtttatgtt tcgctaatgt tatcgctgtc tttgctttcc catgatttca tttaaatcca     55380
     atgttctctt ttaatctatg ttcaatgaaa tttatattag tgccttaaaa gaaggcgaat     55440
     ctatcctacc aaaaaaaaaa gaaggcgaat ctaaacgaat tcggttaatt catcatattt     55500
     ctcaattaat atacgtaaga cacactttgg cacaaaactt atataattat ttatttcctg     55560
     aaacaagtta tcctctaaat atgtatattt aatgtcctaa ggtgtagtac cctcggtatt     55620
     cactagacag agacggggaa gacgaaagag tcgcacgtca aatcaaaatc acaacacata     55680
     ttttgagtgt tgttacatta ttttgtggtg gatcactatg tggagtcacc ctccggtgaa     55740
     caattcctcg tcaagtggta tatatactat agacattgct tttgaataaa caattataca     55800
     aactattagg ttaattactc aacattttaa tttgatttaa tggctcctca ccaaacacaa     55860
     gaagagaggt gaaacatgtt atcttatttg ttcttccatg catttgtttt taggtacggc     55920
     cacaacttaa tgcgcaatca caacaaagtg gaaacactcg tgcacatggc atcacagttt     55980
     atggtgttta gagcggagga atcatgggag gaaaagtatg tgtattacac agaagatatt     56040
     ggagatcttt gcatctttct tggacatagt gaggctttct gtatccaggc cagttcgggc     56100
     tcaagcctaa ctgcatctat tttgtgggct ataactttgg tatttatgat ctcaccacca     56160
     aaccttgcac tactttctac acagaagagg atgttccatt aaggaacttg gaattccctt     56220
     actggccacc tccagtttct ctctactcat aaaatttaaa atattttttc attagtattt     56280
     atggtgtttt ttttcttttc tttctatgct actatataaa ccctttctac tctactttca     56340
     atggaaattt gtgtggtgtt tttttttttt tttttttcta gacaacttct ctttgttaag     56400
     agtcttaaag acgatatata attagtcatt ccattataaa tgaaatgggt tattgtttat     56460
     ttccttagaa aaagagtcca tctccaaaaa gattcttcta ttaattgtga acttggtgcc     56520
     caaggccatc tctctttatt actctgaaga ttgaagacca gtcacaaaca tagtttaggg     56580
     ttttcgacca tgtctcagct cataaaccga cttttgaagc catctgtctg caaaaatgtc     56640
     atcgtaagtt tcttatttgt tatgtaataa ctagctaggg tatcattttg ggtcttactt     56700
     attgtatgat tacttgtata tggcatgcag agatctcaca gcaagcaggt tcggatgttc     56760
     tcctctaagc cgacataccc gtacttgttg attgaccacc tccttaagac gacggaacac     56820
     tgttccaatg atcaagtata ctacgatgat aaatattacg aaaagaatct cgtgattaag     56880
     gaccagggac tcgcagagga ggtccgagag gtgatgaccg ttggattttc acataaagat     56940
     gattggagag ttcacttgga gaaatctgag gatagttcca caagtctcat gatggtgagt     57000
     aacacatcgt ttgtcccagt gaaacatcag ctccctcctc tgtctagtaa ttgtcgaatc     57060
     cagaatgtgg caatatcaaa ctctgttgac ataaagaagg aagacttggt tgtggctgtc     57120
     aagttctttg gatctgatgt gagtctgtgc aagcccttca gcgactctag ctctgaatgg     57180
     atcaacatca atacctctgg ctctgtacac cctttctcga gtctaacgta ttcgaagaag     57240
     aataaaaaat ttctcagtgt tagtccttct gggacgtatc tttggtactt ggatcttcac     57300
     ttcgatgagg atgatgtcga gccctactca tcatatttat attttaggga ggaccctctc     57360
     ctgaggttgt ataagatgga tttggaagat tacatctggc gtttcagaac agaccacctg     57420
     gcggagttac cctccggtga acatttcctc gtcaagtggt acgtatttgt ttattaatta     57480
     taagcgcaag tttgctactt ctatgttgaa acacatagat atcttctttt gcaggttctt     57540
     taaggacgtg atgatgaacg tggggaaaat cacccagaaa acggatgggt ttaaggtgtt     57600
     tagagtggat acaatttgcg gtcacttgac taacacgcaa gacattggag atctttgtat     57660
     ctttcttgga catggtgaag catactgtgt cccggcaagc tcgtctcctg gactcagacc     57720
     taactccatc tattatgtgg gctgtaactt tggtgttcac gatattgcaa ccgacactac     57780
     cactaacttc tacacacaca gtaatgttcc tttaaggtcc actgagttcc cttactggcc     57840
     tcttcctctc tcttaggagt gacttttgat atcgtcggat gtctctaata ttgggtggct     57900
     cttgtggtct ccaatattat gttattcttt tgggtttggt tcatgtacta gttaatgttt     57960
     ttggttcgta gatctccgac tatttgaaaa taaaacatga gagaaacccg ttttatcttt     58020
     cttaatcaca actcagacta cttattttga aaacctaaat taactcattt gcagggtaaa     58080
     aagtaaaggc aatcaaaagt gctgaaagat aaaaatggct aagaaatcat cagtgagtag     58140
     agttgtctag tagaaagaat gaaagaataa cactctgaat atatataatc aaactaaacc     58200
     aaaaaaaaaa ggtaaccaag agaaagagag attattatct gagatgttgt aactctagag     58260
     gagcatatga tgatggttgt tttgttgcgg accagctgat cctggcggag gtgggagggc     58320
     aaggaaagcg tctccaaaag gattagaagg agaaggaccg gctgagaact gatgatgatg     58380
     atgattttga tgataatcat gaggatgagt gtaattgtag ggactctgat gcatcatcgt     58440
     catctgttgt tgctgttgtt gttgcattgc catttgaaca ttagtgggag gagcaatgtt     58500
     gttggacatt gcaaaaggat cttgttgcat ttggaatggg tttggcggtg ctgctgttgt     58560
     gtctatgcca ccatgtccat agcccgcatt ggttagctgg atctgtctcc tagctgaatc     58620
     atcctcgtac agactgtcaa gcaatagatt gtcaaatcct cctgcctata aatacaacaa     58680
     gagagaacaa gcccacgtga gttttgagag tagaaacaga gagtttcata ttcaaatata     58740
     tgtggtgtta gagttaatta caagtttggt gttaggcgca gggcgaggat tattgttgtt     58800
     gttgttgttc tgaggagtga ccagtgccaa ttcccagccg gatccaccgg tttctattaa     58860
     acttaaaatg tttgatggtc ctggagcttc atgacctgca gagaccaata acagcaaaaa     58920
     tttaccatta gtgttagaaa atctctagtt ttggtcaaga atcaaatttt tgttacctgg     58980
     tggatatatt gcaagagcca atgcatttcg gtcctctatc tctgcggctt tagggttgat     59040
     ctcatttagt ccctgtgaag gagaagaaaa ggttgagact ttggccaaaa gagatatttg     59100
     tacacataag atgacgtgta gaagaagatt caccagcaga tcatcagtgt ctatcaggaa     59160
     agaaggttta gcatcttcct cttctatttt ttcttggtct tcttcctctt cttcgataag     59220
     cggctggtct ccttcgctgt tttccttttg attatcggct tctgcaggtt cttcaggctg     59280
     gacagagtgt tctgcttctt cttcttcttg ttcttcttcc tctttttcct gatactcctg     59340
     tgaaaaacac aacaaaatgt caatcataat tcataagaag actgatattg atgaacagga     59400
     caacatcaac caaatatgat gagagtaaaa ctttgtacca gctttttctg tacagaacca     59460
     ctttgaggcg cttctttaat gtagtcttcc attgttgcta ggaaagaagg aggaggctga     59520
     aacaagtttt taaaattaag tcttttgagg tgatcaatct cacattcatt tatcacaagt     59580
     taagaaggaa cctgtcttaa ggttgggaac tgaaagtttc tcgctagctc tagacctttg     59640
     cagtattcat aaaagtcagc caaattttca gcctgtgcag tggaagaaca tcaataaaca     59700
     agtttagtga agatggggat ttagtctata gctttagagc ttttacctgt tggccagctc     59760
     gtttatatat atttagagct ttaactgcat catgtcttga catctcaaag aactgaatca     59820
     agagcataga tatatacttt agcaacactc aatagaagca aattgatact aaaacaagag     59880
     aaggagattt ttataaaaac catgtctaca agattaatga ttccatcatt aatggcacag     59940
     tagattttga agctttcttt aagcaccaat gcaagagcat actggattag gtagttgcta     60000
     tatgctgatc cttcaggctg caaaactgaa aacatattaa gaaaccgttc gacgtaacaa     60060
     caaaacaaaa attttggata tataactttt acctgacaac caataagcct ataaagcagc     60120
     tgttgcaaag caggtaactg ctctagcaat tcttcatcgg agagcatcct tgttctatac     60180
     gtttgagaag cattgaaatc tacgttctgt aataatgatt tatgatgata aaattagatt     60240
     cttgtgtttg tttaaaaggt gagaacgaat ttgagaacaa acctttgaag atgcacctga     60300
     accttttggt aaacgttctg cttctatgtc atacttcaaa acccgatagc attcaagccg     60360
     ctcctcgagg aaaagcgcgt atgtcctaat ccacgcagag caatcccaag ctgcaacaaa     60420
     caagtcaata caagaaaatg ttttaaaaca attttcatta acacataaaa agctatgtaa     60480
     caaaggatat ataataggct atttaccaag aggacttgta tcgtctttga agtttgatat     60540
     tcgaagtata tgtcctctat gtgagtaatt gagaagctct tctctaaatg ttggatcacc     60600
     ttctcttagt gttctatgaa tgactattaa caccttgatc gcaacctgcg tgttggaaac     60660
     acaatctaag caaccccaaa aacagagttt tgtaaattga aaaaaaaaag aatcttttaa     60720
     gttacataga actcacaacc caattgcgag tttttgacaa tcttttggct aatgcgtgaa     60780
     tgcagtaagc aacatctgct cgtggttgca ctaccgatgt cgccgagaat attcctggat     60840
     agaatgataa aaactctcat aaagatcgta tccaaattca agtgtttggg ggaataagtt     60900
     aagaaactta ctacgaatgt gacgttcttt gggagcagat tctacgtgat ttgtggcctt     60960
     tacgatcgca acatccaaat cctatatatc tcgatttcat atacatttta ttagtcattt     61020
     acagattttt tttgttacca aaaaatttga aagtttcaga atgtaatcct gaccttgaat     61080
     tcgctgttga ccttggcgat acttacggta gtggaatctt tgattgctcc gacagcttta     61140
     cggaagctgt taaacgttgc catctagcga taaatcggaa tctggataaa tttcttgata     61200
     attccggcga tcaccggaat tgtgaaatga tttggttagg acggagagat ggagaaaaga     61260
     gaagataagg atgaagaaga cgaagaccaa gtttttgata tgctctgttg ttagtcgcct     61320
     taacaacaaa cagaacacca ataacagact tttcaacaat gctactctct atctctctct     61380
     tgcctcacca ttacgtgcgt aacggaatct tgattattat ttttaaatag atttttgtaa     61440
     tttatcagag taaatttata tcgaaatttg tacatctcat ttactaattt cgtattattc     61500
     ctcctataat cggatgccag ttattaaact tttcttttat tttggtatag aatcatcatt     61560
     tgcctcaatt atcgatttat acatagctaa tgtcaaaatg aaatccagta atttttgtaa     61620
     gatatgcaat gcaatctttg tccaaaaaaa aaaaaaaaaa agaaaggtaa tgcaatctca     61680
     aattttccat tactcaatct gatttaaaaa aaaaaaaaaa ctattttacc tgattaaaca     61740
     tattttgaat tttacatatg tagtgtcatt ttaaataaag gaatttatta ttatttatac     61800
     gtttacaaaa ttgagcgcaa tgtcaaagct acgccatatg gacctaatgt gtcggactcg     61860
     gacggtagtt catacggtgg ttgccttgtt ttgttccaaa tgctcattta tttatcttag     61920
     tgaatgtcat taacaagtta acagtttgtt tacgaatgtc cacataatgc tcaagagtac     61980
     gaatatgata caaatttacc aaacattgca tttatcatgc atgcatgttc tcttttgtac     62040
     ttatgtttaa aattcatcac ttgtgtactt agtttcgttt tcgatcccct cctctttttt     62100
     ttacaatgat actttcatct aatgtttgtt ttagtttcca tatatttatg agtttctcta     62160
     ccaatggact atgtatttgg ctctattaga aatcgcggac caaaaaacta gagctgaaga     62220
     atcataacag ttttattatc aggagaataa gatacgatgg gggcggtgta gtgagaatca     62280
     tgctgcagta gtggtgacat acttgatgag catcttgaca atatccttgg agacctttga     62340
     actagattcc ttaaggttcg taatcctgac atctgtctca tcatctaaac gttttgcatc     62400
     tgcttcttga tccgtctgaa acaaaaggta aagaatatga gtacaaatca agatatctca     62460
     ctagccggtt ttgtttcggt gttgcttacc ccagaaactt gagtttgata ctcttcttct     62520
     aatcgggatc tgtattcttc catctccttc tcagcctcat ctttcgcttg cttcattctt     62580
     gctagttttg ctgatcatcg atccgtccat acaaaaagaa aagaaaagcg ctgaaaagga     62640
     ttcaaaacca aaatcttact attagagcca acaagccata aaggagaaag agactatacc     62700
     ggtcctcgca gctgaaacaa tccgtccggc ttcttgttca gcagttaaaa gcatctgaat     62760
     cccaccttgg cctcttaaag aatccatggc ttatgttctc ttcaaagaca atgaaaagtt     62820
     gtgtttattc ttctgcaaat tttggtgcca gaagtggaat ttgtaaatat aagcctattt     62880
     ggttatggtt tggattagac ggagagtgtt tttctccttg gttcatggag ttagtttttg     62940
     actcattatt tctttcttca aatttagatg cttttaaaaa gacaatgtgc gatctccggg     63000
     tgagtgtgga aggaaaaaat aaaatatatc tcaaacatac tatttataga aaatcccaac     63060
     cgattacaaa gcagctgatc ggtgtgtatt tacaagtaat gtgtgatttt tttttttgaa     63120
     aaatcgtgaa ttaaaaggaa tcccaacgtg tgaggtgtga ctctaaagtc tgaataaagt     63180
     tgacgatcca taattttctt atgtttgccg tcgattgtga gaattgagaa gcatatgtgg     63240
     tttctcttct aagagttaaa aataccgtga aataaaagct atattaattc atatgtttta     63300
     tcatatatct tcgaatatca gcattagacc ttattagcca gctcaagtac gtcattttca     63360
     ctgatataaa tgcaaattaa taaccagatc gtgcccaaaa cgaataaatt attccatgca     63420
     tgcagttgca tcattatttt ttggtatagt ataaagttgc atcattatac ttcgcattaa     63480
     ttttccacca cgcattccct cctaaataaa aagaattaaa attgtcacat ccatctatat     63540
     caacataagc aagaggttcg agttggaaga taaaggagat ttttttttct tttccatatt     63600
     tcatctattt ggaatggtgc tgtcaaaata tctatcaaga taatttacaa aatatgatgg     63660
     tgaacaatag gatgtggttg ttttcggtta tccttatagc gtcttgtctt cttagattca     63720
     aagcggtgat aatagtcgcg gccggagcgg tggccataat tgcgtttgat gcggcgatag     63780
     tttggttaaa ggtctcgttg atgtttgaat gccatacttt gatgttattc tttcctttta     63840
     gtttgttatt ttatgttctt gtacaaaaaa gttattgaat tgccaaagaa atcttttcta     63900
     tatctataag ttcaatatcg aacttcagaa tataaaaaag aaacaattga tatcaataac     63960
     attcaaaata attgaaatta ataaacagtg attctaattt agccatttac aagcaaactt     64020
     aaaagataaa ggtgatctag atatatttta aatagaaaat ggaatcatat aatgaatttt     64080
     ttgaaagttt caccatagat aagttgttga aaacacatgg tgagtttttt actcatcaat     64140
     gtcgtatata tgacttaaaa aatactttct tatatccaaa tataaagaaa aagcaattag     64200
     gtatgtaacg atgaagcaag attaaattga aattaaattg caacaaataa aatttgatag     64260
     aaaaaaaaaa tagtttttac caaaacgaaa aagcaagatt aaaatatgtg gaaaaaacgt     64320
     cgaatcagga gaatatatga gatgactctc agacatcata acacatacat acgtagtaat     64380
     atattaacaa ctgcgtcgaa tcgtaagact tggtcacttc agtacatgac taagcatcat     64440
     tcgggaccag ccaaaaaaca tgtatgcttc aaaaccagac cccaccacat tataagctca     64500
     tctcagtcat caccacaacc aacgcaaaga attcttcttc ttcttcttct tgacttggcg     64560
     ttttttcttc taataatttt aattttaatt ttattttcaa catattcaag taattaatag     64620
     gatcgacttg ttggaaattg tttaagttct acttgttgaa tattgtcaat ttatttggat     64680
     catgttattt aagttctact tgttccaaaa agatatgaaa gctaattgga acagaaattt     64740
     gtctagtttc ttaaaaaaaa ttggaaaata ttattttaac gtatattttt tcagatatat     64800
     ttcaaaacat aataaagaaa tattttgatg atataaattt atttaggaga tgtatacagt     64860
     cttaagtttt tcttacatga atttgagata aatcttttct tcttgaactg attaaagagg     64920
     gtatcaatgt cttattgaat ctcaatccag cggacataga tcaaaagtcc aaagcaacaa     64980
     catgtgaacg cgttttgata taaatacaat cattatccat taacacgaac ttcctttttt     65040
     acatcatttt taacttcatt gtaggggcga cgtgttgaag tcttgaatag gggtggacat     65100
     tttttggttt atttttagag agtttggatt tggtttcatt ttcccaaact agagtttaat     65160
     agagttctga ccgaagttat ttatttggtg cagatcagtt tattagatca ttcatcaatt     65220
     tcttattcat tatttcatat ttctaatttt ttttatgaaa attatcgatg gaattggttt     65280
     cccaaaattt tgtattaact cgtattttca taattttctc tttaacaggt tatacaaata     65340
     gtagttgtca actttacgta aattacatca aattttaagt aataaatttt aaaattctag     65400
     atgttgttaa caatgacaaa caaatttatt tagtgacagc atttttattc agttagtgta     65460
     tacacttttg tttttgtcaa agactataaa cttaaaacat ttaaatatag ataggagtag     65520
     ttgaatcatc tttgtaagtt tgactattac aaaactgagt cttaaaagac attttatatt     65580
     aaaagatacc tcagataagc aaactctttt acacgaaaat agacacttgt tcctttcacc     65640
     atttattatc cctcccttac cgtgagcaag ctaacgagcc gagaaaacta cgcacgtacc     65700
     aaattaatac ttcaagtaac tactaccatt taccaacata attcggtaaa aaaactaaac     65760
     aaaaatccaa aatttgggag tgatcaaact ttattaagag agttactaac tagggtcaca     65820
     cacacataca tacatagagc ttcacaccaa acaattctcg ctgaaaccaa taaacttggt     65880
     cttatgtctt ctttcattta atgtatatct ctctcatctt cttcctctct aaccactttc     65940
     ctcccttaat ttctatccct atatttattt tcctttcatt ttcctctcca actaattaca     66000
     cacacttgaa gctgaaaaaa atgcagccgt ccggtgatcc ggcgccggaa aaggagaaag     66060
     agatgacgca gccaaaagtg tcactgctta agctcttctc cttcgcagat ttctatgatt     66120
     gtgttctaat gactcttgga tccgtaggag cgtgcattca tggcgcctcg gttccaatct     66180
     ttttcatctt ctttggcaaa ctcatcaata ttatcggtct tgcttatctt ttcccaaaac     66240
     aagcctctca cagagtcgcc aaggtttttc aatattttag tttattcatt ttttccttat     66300
     gatatagtat tgatatagct cgaaatatca aatttataaa agaaaatttg agattcttcg     66360
     ccagcttact cggaggttga agtgaatttt tacctgatat ttagaaaatt tactatattg     66420
     aaattaatta catatttatg ctaattatcc gttgttctat attttttcaa catgtttgct     66480
     cggcttaaat tttatttatt ttggtgcagt actcgttgga ttttgtatac ttgagtgtgg     66540
     ctatactatt ttcatcatgg ttaggtaaat aaaaatacat taaaatcaag taatctctct     66600
     gagatatata attcttttct aattagaaaa caaatttaaa aaatggaaac agaggttgca     66660
     tgttggatgc atacgggaga gaggcaagcg gcgaagatga ggagagctta tctcaggtca     66720
     atgttaagcc aagacataag cttattcgac accgaagctt ctacaggaga agtcatctcc     66780
     gccatcacct ccgacatcct cgtcgtccaa gatgctctct ccgagaaggt acatctctta     66840
     acccaaacaa accggtatac tgatttcttt ttcttttttt tggttaagat tttgtggtag     66900
     ctcaattact agatttgtta cgaaaccaga tactttttgt ggtacccatt cgtaaataaa     66960
     tgcattaggc tttttttttt tttaactatc tatatatata cacaaataat tatttgtttt     67020
     tgtgcaaata cctactaaaa tctgttaatt aatgcatggc ctcggttgat caaatctata     67080
     gacatttttt tttcaaccct ataaatgata tttaggtcgt tacatttaaa aatctcttac     67140
     atgggtcgtt ttttatgcac atggcttgat taacccgttc agttttaatg tgaataacac     67200
     taatggctta atccaataat gttaaagatg attttctttt tcttttcaac attttttttt     67260
     ttttgcatta tcatttttca aatttaataa agagattttt ggcatgcatc gatctcttct     67320
     cattactttc ttttctaact atattctaga tctctagtta tattcgtcat ttttctgaga     67380
     cactaataaa gtgtagacaa gtgtagatgc ctttattttc tttttatctt cggtccttga     67440
     tgcaaaaata ataaatgcat tgtctttaat tcggttatag ctgcattgca ttttgcattt     67500
     ataaggcggt cgagtttgat acgatttaat tcatatttta atttttgacc tatatttggt     67560
     tctttaattt acagatagct agccacaaaa cagttaatcg cctaaattca aaatttaaaa     67620
     tgtgatcacg caaatccggt tggtttatga taatttgtct ggattactgg taaattttgt     67680
     cgcaggtagg gaatttcttg cactacataa gccggttcat agccggtttt gcaattggat     67740
     tcactagtgt atggcaaata agtcttgtca ctctatccat agtcccctta atcgctctag     67800
     ctggcggcat ctatgcgttc gtcgccatcg gacttattgc tcgtgtccgg aaatcataca     67860
     tcaaggctgg tgagattgca gaagaggttg gttacttctt ggacaaggaa acttataagt     67920
     gtatagtttt cagttatttt tcatattagt gtctagtgct ggtgtgtatc atatatctat     67980
     gtgattattc aggtgatcgg gaatgtgagg accgtacaag cattcaccgg tgaagaaagg     68040
     gcggtgagat tataccgaga agcgctggag aatacgtata agtacgggag aaaagctggt     68100
     ttaaccaaag gattaggtct tggatcgatg cactgtgtct tgtttctatc ttgggccttg     68160
     ctcgtatggt tcacaagtgt tgtggtccac aaggatatcg ccgatggtgg caaatcattc     68220
     actaccatgc tcaacgttgt catcgccggc ctgtaaatat aaatctccct aacttgttcg     68280
     cttgctctcc acgtttcctt tgttttctct ttttgtggga ttatgaagtg tactctgttt     68340
     ttgggttttg tgtaggtctc ttggacaagc ggcgcccgat atttctgcgt ttgtacgggc     68400
     aaaagccgct gcttatccaa ttttcaagat gattgaacgg aacacggtga caaaaacaag     68460
     cgcaaaatct ggccgtaaac tagggaaagt agacgggcac attcaattca aagacgcgac     68520
     tttcagttac ccatctcgcc ctgatgtggt gatcttcgac aggttaaacc tagctatccc     68580
     tgccgggaaa attgtggcac ttgttggagg aagcggatca gggaagagca cggtcatatc     68640
     tttgatagag cggttctacg agcctatttc tggagcagtg ttgctagacg ggaacaatat     68700
     cagtgagctg gatattaagt ggttaagagg acagattggt ttggttaacc aagaaccagc     68760
     tctgtttgca acaacgattc gtgagaacat tctgtatggc aaagacgacg caactgctga     68820
     ggagatcacc cgtgccgcaa agctctcgga agccatttct ttcatcaaca acctccctga     68880
     aggatttgag actcaggtct gtcaatagga taccttcgaa tacaaaaaac aactgtagac     68940
     cctagattcc actttcgcct tagggtaaaa gaaacatcaa tgtcaaaccc taaaactctg     69000
     ttttttcact tataggttgg cgagagaggg attcaactat ctggcggaca gaaacaaagg     69060
     attgctatat caagagcaat tgtgaagaat ccatcgatac tcttactcga cgaagcaaca     69120
     agtgctttag acgcagagtc ggagaagagc gtgcaagaag cgctggatcg agtgatggtt     69180
     gggagaacaa cggtggtggt ggctcacaga ctctcaacgg taagaaatgc tgacatcata     69240
     gcagttgtac acgaaggtaa aatagttgag tttggaaacc acgagaatct catatctaat     69300
     cccgacggag cctactcttc tcttcttcgt ctccaagaga ctgcctcatt gcagcgtaac     69360
     ccttccttga atcgcacgct aagcagacca cataggtact atcgcttagc accatcctct     69420
     gtctctcaac attttcattc gaactaggta tagaaaccaa acccttaatt ctcatagctg     69480
     ttcttcgttc ttttttcttt tcacatctgc agtataaaat actcgcggga actatcaaga     69540
     acaagatcca gcttctgttc agagagggaa tcggtaactc gaccggatgg ggctgatcca     69600
     tccaaaaaag tgaaagtaac ggtgggacgt ctttactcta tgatccgtcc ggactggatg     69660
     tatggcgtgt gtggcacgat atgtgccttt atcgctggat ctcaaatgcc ccttttcgcg     69720
     cttggcgtct cgcaagcctt agtttcctat tacagtggtt gggatgagac tcaaaaagag     69780
     atcaagaaga tcgctatcct cttctgctgc gcgtccgtta tcactctaat tgtctacacc     69840
     attgagcata tctgctttgg cactatgggc gagcgtctca ctctccgtgt ccgcgaaaat     69900
     atgttcagag gttcgtctca aactctcaat gcaagcttta aataaatgat aaatttaaaa     69960
     ttcttcagaa attagagatc ccaattttta ttatcatgtg atacttattc tgtttttggt     70020
     ttaatagcaa tcttgaagaa tgaaatcggg tggtttgatg aggtggacaa cacaagctca     70080
     atgttggcat cgcggcttga gagcgatgca actttgctta aaaccatagt ggtcgatagg     70140
     tcaacgattc tactgcagaa cttaggtcta gttgtgacct cttttatcat agcatttata     70200
     ctcaactggc gtctcactct tgtcgtcttg gccacatacc cattggttat aagcggacat     70260
     atcagcgagg taattaacgc accgttttgc cacttttaaa aattttcctt tatgtttatg     70320
     tttacgtttg tgtttttgtt gtatttgtag aaacttttca tgcaaggata tggaggagac     70380
     ttgaacaaag catacttaaa ggccaacatg ttggccggtg agtctgttag caacatccgc     70440
     acggtcgctg ccttctgtgc tgaggaaaag attctagaac tttattcaag agagctttta     70500
     gaaccttcca aaagttcttt caggcgtgga caaattgcag gacttttcta cggtgtctct     70560
     cagttcttca ttttctcttc ctatggcctc gccctctggt atgtctctat gtatatagaa     70620
     gattgtaaat taataggcct agggttcaga ccaataaaga ataggcatag ggattcaccg     70680
     gttttaaata ttgaattgtc aattgtttga tttgataggt acggatcaac tttgatggac     70740
     aaaggattag cgggcttcaa atcagtgatg aaaacattca tggttttgat tgtgacggcg     70800
     ttagcgatgg gtgagacatt ggctctagct ccggatctgc tgaaaggaaa ccagatggtt     70860
     gcgtccgtgt ttgagatctt ggaccggaaa actcagatcg ttggagaaac cagcgaggag     70920
     ctgaacaatg tggaaggcac gattgagctc aaaggcgtcc actttagcta cccttcgaga     70980
     ccagatgttg taattttccg ggactttgat ctgatagttc gtgccggaaa gagcatggcg     71040
     ctcgttggac agagtggatc tgggaaaagt tctgttattt cactcattct ccggttctat     71100
     gacccgactg ctggaaaagt catgatagag ggtgagtgca cttgacttag acctatgaac     71160
     acaaaattct tgcgtttcaa gaaataacta aggtttcttg gatcaaaaga cagtagttgt     71220
     ttagttgaaa taaatttgtt tttttccctc ttacccaaat tgcaggaaaa gacatcaaga     71280
     aactagattt gaaagcattg aggaaacaca ttggtcttgt tcaacaagaa ccagcacttt     71340
     tcgccacaac aatctacgag aacattttgt atggaaacga aggagcatct caatctgaag     71400
     tcgtcgaatc agctatgctc gcaaatgctc acagcttcat tacctctctc ccagaaggtt     71460
     actctaccaa agtcggtgaa cgtggagttc aaatgtcagg cgggcagaga cagaggatcg     71520
     ctatcgctag agccattctc aagaatccag caattctatt acttgacgaa gccacaagcg     71580
     ctttggacgt tgaatctgag cgtgtggtag gtttctttac cattagactt tgtaaaattt     71640
     aatcacaatg gactaatgag tatacaacga atgaatattg ttaggtacaa caagcattgg     71700
     atcggttaat ggctaaccgg acgactgtgg tagttgctca caggctatcg acgatcaaga     71760
     acgctgacac gataagtgta ttacacggag gtaagatcgt agagcaaggc agccaccgta     71820
     agctcgttct aaacaagagt ggtccatatt ttaaacttat cagtcttcag cagcagcaac     71880
     aaccttaaat taagtactat actttattta ttgaaaaact ctttttattt ttatttttgt     71940
     ggaaaatatt gatcatatac tcatttgatg tgattatctt aatcttcttg atttaccgtt     72000
     ggtaaaaaaa aagttacgaa atccaaaata ggaaaatgtt ctgaaacgtt ggctatgtat     72060
     tttcacccaa atttggattt agttattttt gagcactgtc tttatcgtca gcacgtttca     72120
     ctgcgacatt ctccaaagga aatgatcaac aaaaggacaa cttgattggt ttcaggaatc     72180
     tccagagttc atcatgtcct actaaatgac aaaacccttt acaaaaaggg agccatcacc     72240
     acaaataatt aaataaaacc aagtcaaatt aaaactgtat taactatttc accaacacca     72300
     agttgaagtt ttctaattac tatttttttt ttttgtcaaa catcatcttt aatatgttat     72360
     aaatcgtttg cataattttg ttataatttg tttgtattat ttggttataa aatctcccac     72420
     ctttttggtt atttcacaca tcttttactt atacaaaaat ctttcctgat tttaattaaa     72480
     taaagctaaa acactttagt aatacaagta aaattaaaaa caaaacaaaa aaattcggga     72540
     aaagtatttg gtgtgataaa ttccctctcc agcttctcgg tgacacagat attttgcttc     72600
     caaataaaac gagtccggtc actggcgctc actgacttcg tcttcctcca tctccgatcc     72660
     attggtttaa caagcgcgtg agggccagat agaccgagaa tcatgggaaa cggaaactca     72720
     acggagacga aagagtcgcg ccgatcaaag atgcgtaaga agattcaaaa ctttcgcagc     72780
     cgccgccgtc ttagtcgtcc aggatccgga agcgtctctg gattggctag tcagagatct     72840
     gtgagcgcag atgatttcgc cggcattgct cttctcactc ttatcggcgt acggctttac     72900
     ttctctcctg attgtatatt gtcctagtca acttcgtatt tcgattacga tagtcatgtg     72960
     tcttttggca tctttctctt aggcggagat gaagttcaag gacaagtggc tcgcctgtgt     73020
     ttccttcggg gaacaaactt tccgttcgga aatttcagat tcgtatgtta ccaacgattt     73080
     ttcaaactct tgcttgtaac tttttggaat cttatactta acaatgtctt gtttctgttg     73140
     aattttgcag cacagagaag ccgatttgga actcggtaag aaaactctcg attactattt     73200
     ctttgtagcg ccttttgtga atagttgggt attgtatcgg ttttgtgtgt ttctgtatat     73260
     aggaaaagaa gcttctcctg gagaaaaatg gaccaagtct ggctagaatc tctgtatttg     73320
     aggtgtgaag tattcagagt ttttttacgt tctgctttct agatttgggg tttagttatt     73380
     gatctgttga gatgattttc cttttcttga tgcagaccaa tagactcttg aagaacaata     73440
     tcgttggtta ttgtgagctt gatctacttg atttcgtagt acaggtcagt aactaaagtt     73500
     tgttttttca tatgaaagct gtttaagttg tttatccgtt attcctctag ctcgactaat     73560
     aagtatcagc tagttttttc tatcacttat cttccattgt ttgaggagat tcagccacag     73620
     tttagctgat aatagtaggt gcatggatta gatatcttga atgattaatc gacgagaaac     73680
     ttgtttgttt acatgtttat tttacttctc ttttgtataa tgtgatatag gaacctgact     73740
     ctacttgcaa gtcatttgac ctgttagacc cggcctcatc taacgttgtt ggcagcatgt     73800
     ttgtttcatg ctccgttgag gtatgcagta tgttaaacgt taaaacagtg gctaaacaac     73860
     gcggtggtaa tggtttctga tttgtggttg ctcatatttg caggatcctg ttgaaaccga     73920
     gacatgtttc gcgaagcgta ttttgtccat agtggtatgc tttacttaat tttccactgt     73980
     ttgttcagtt cttgtgatgc tttgtgattt taacctcatt tgcatggtac aatttttgtt     74040
     ttctttaatt ttctaatgat tgatgataaa gacgttttta atcagattta caagctactt     74100
     tctcttttcg atggcttctt tagcagtttt ttctcttgaa ctttatggca tcctgcagcc     74160
     gttatgattg attgttggag tctttcatct aaatgcagga ttatgacgaa gatggaaaac     74220
     tctcattctc agagttctct gatctgatga atgcttttgg gaatgtagtg gctgctaaca     74280
     aggtttgacc ttcagcagct ttgtcacctc tttctgcttt tcgtgcttgt gtatatgtat     74340
     ttgtttccta tagtgtagta gcaattagtc tgagaaatgt caaataccaa aagttgtctc     74400
     ctaggcattt ttttataaga tactgctaga ttgctgtttt tttgttctga aggcactctt     74460
     gatgttttca cttaattgat taccagaaag aggagttgtt caaagccgct gacctgaatg     74520
     gggatggtgt tgttacaatt gatgagttgg ctgcacttct tgccgttcaa caggaacagt     74580
     aataacattc tatacagtgc caatgttgag aacttctgta tatacacaaa tatttgtaca     74640
     tccttgaatc ccagtaattt gcatgcattg attgcaggga gccaattata aatagttgtc     74700
     cggtttgcgg tgaggctctt caacttgaca agctcaatgc aatgatccat atgactctct     74760
     gttttgacga aggaactggt aatcaaatga ccggagggtt cttgactgat aggcaggctt     74820
     catatgggtt agatttcttg tttttaaaag atttgaatat gacattctat gtagcttata     74880
     tgttctttgc ttgataggca ttcaactttt taacaatttt cagatggatg ttcaaactaa     74940
     gtgaatggac tcatctatca acttatgatg ttggtttgaa tactggttca agtgcttcac     75000
     atattgtggt atctttcctt tcgactactt ttgtttatgt catgataaac atctaatttg     75060
     gaggcctatt atcaagttgt ttgattttct atattcattc aaagtagtga atcctggctt     75120
     gagcgatgcc tgatatttgt tgcattcctc ctatcaattt ttgtggattt cgtttgagta     75180
     tctcctaatg gtgagaaaat gcactaaaag tatacttact tcgatatttg ctttaggtga     75240
     ttgataggaa gactaagagg ctcgtggaag agttgattga ttcaaagatt gttatgtcta     75300
     tgagagctat ttaccagtca aaaataggac tccggcttat ggaccaaggt aacaaactgg     75360
     gtccttaacc tctaatatgc acctggccat agtgcctttg tgatgaagtg ctacacattc     75420
     ttgccattgt atcaaagcaa acaagtcttc attatggatt gatatccttg atgcaggagc     75480
     aaaagagatt ttgcagaacc tttctgagaa acaggggaaa aaaatgaact cagttgaatc     75540
     tgcccaaaat attcccagct ttctcgagtt tttcaaggtg tagattattt ttttattagt     75600
     tattatgtgt caaatggctg ctgagtttaa gccggacaca acttggcttg tggcttggtg     75660
     atattgatat aatatcttag aaaaacttct gtgattatta actgaaatcc gatctcgata     75720
     ttactattgg gaattgaaat actatgagaa atcttccgat agagataagg aaacactcct     75780
     ctcttatact ttctagagat aacaatgggt agattggagt tgcttcacta gatctccttg     75840
     atttttataa aggatcgccc tccttttgta agtttagatg aactgaaaat tgaattatgt     75900
     acttgttgca ggatcaaata aacatggccg aagtcaagta tcctctggac cattttaagg     75960
     tacgcaaagg caactcatgg tatgatttca accacgagat tacaatagaa gtgttagtag     76020
     ttataaaata aatatgtaag tgacactgag gtaaatctaa gctaaacttt ttgccggttt     76080
     tatcaaagat gggaaaaacc ctttataatt tggtttaact ataaagcttg tgtacttttc     76140
     atggatttga aaggtggtca ttttacttgc agacgttcaa tgaattcttc gtacgggagt     76200
     taaagcctgg tgcaagacca attgcgtgca tggatcagga tgatgttgct gtatctgctg     76260
     ctgattgtcg attaatggca tttcaatcgg ttgatgatag cacacggttc tggatcaagg     76320
     taaagcggcc tctagagtat tcacaataca ctaggcaagg catatgaaaa gttgaataac     76380
     tcttaacaca attgatgctg ctgataacct gcaacactgt acaactgtta ctcgctattc     76440
     taaaattttc agactgtttt caatattgtt agggccgtaa gttttcaatc aaaggcctcc     76500
     ttggaaatga tgtgcagtcg gatgctttcc ttgatggatc tttggtgata ttccgattgg     76560
     cgccacaggt acaagaggac tccatgcttc ttgtcgtttg atcaaaagct aaaaattaac     76620
     acttgtttcg ctctcttttt gcatttattg atctattaca ggactatcat cgttttcatt     76680
     ctcctgtctc tggtgtcatt gaaaagtttg tcaatgtttc tggaagctta tatacggtat     76740
     tgcatctgcc ttttcacgtt gaagagcatt cttctcttcc gttattttct tattggagtt     76800
     acttttgtat ccttggttct caggttaatc cgattgctgt caatagcaag tactgtaatg     76860
     tgttcactga gaataaacgg accatcgtaa ttatatcaac agcagagttt ggaaaggtat     76920
     gtcatcttgt ataagtcata aacatctttt ttctcggtct gctgatgaaa atatttctca     76980
     gttgcctctt gtgcttgatg ctttgaactc aaattgaagc agtattttat aaacgaaggt     77040
     gtacaatgaa atctgatctt atcgcagaac ttgatctcag cttaatatat gtaacaggtc     77100
     gcatttgttg cgattggagc aacaatggtt ggtagtatca gctttgttag gcaagaggga     77160
     gaccatgtga agaaagggga cgaggtaatc aattctgaac cttttttcta attgaaagat     77220
     atgtcattct ttcttatgca attctaaact agcattctcc tttttccagc ttggttactt     77280
     ttcatttggt ggaagcacag ttatatgcgt ctttgaaaag gttagctttt aactttgttt     77340
     ttcttacagt accctagaaa tgaattgtct tgatttgaaa atcttgtgac aaaatatctt     77400
     acatttttgt aatactgtcc ctggatgagt tattgcattt acatcaacct tacctttcac     77460
     gtgacatgta ttacaggact cgattaagat tgatgaggat ctcttagcta acagtgctag     77520
     gtccttggag acattagtta ctgttggaat gcaacttggt gtctcctttc caaagctgga     77580
     aaactgtgta cttgagccct gaactgcttc aaactatgtg agttagtacg aaacgacaga     77640
     tgattttcta tggtttggtt tgatttgatt tagttttcac ttttcatcaa gaaagaactc     77700
     aattcctctc tgtttaatac acaatgactt tgctctgtat atataaacac cagtatgtcc     77760
     cgggcagtga tacttgttaa tgtttacggt atttcgcttt ttttgttgag tgtttttcct     77820
     aggtgacaat tttacatgca aataaggtta aacacatgtc tgtctctatt ccggtcttaa     77880
     tgaagagact ttgtctgtat aactctctct ctctctttct ttttcacctc tttccctcac     77940
     cctctctggc tctctcattc tctgttgagt tgaacttact aaaagcacaa atggtttggg     78000
     caaatgctaa gatgaggcta gctttgtctc ttgttacggt tttcttcggc atctctcttg     78060
     ctaatcttga agtcggattt tactccaata catgccctca agccgagtca atcgttaaga     78120
     gggttgtctc aggggctgct ctttccgacc ctaacctccc agccatactt ctacggctcc     78180
     atttccatga ttgctttgtt gaggtacaat gcactttcct ccccttcgtg ctttctacta     78240
     ttgcttgcta ttcttagaga tttaaccaca cgttcaggga tgtgatggct cgatcctcgt     78300
     gaacaacgga gcaatctctg aaaagaatgc atttggacat gaaggcgtta gaggatttga     78360
     gatagtagaa gccgtcaaag ccgagcttga agctgcatgc cccggtgttg tctcctgctc     78420
     agacattgtt gccttggctg cacgtgatgc catatctttg gtaaaaaata aaatagagaa     78480
     agaaaaaaac ctttccatct ttatctatct tcttctccgt tgtgagcaat tcatgataca     78540
     ggcgaatgga ccggcgtatg aggtgccaac tgggcggaga gatggtcggg tttcgaacat     78600
     gtcattggct aaggacatgc cggaggtgag tgactcgatt gagatactaa aggctaagtt     78660
     catgcagaaa ggactcaacg ccaaagacct cgtgcttctc agtggtatgt atctcttctt     78720
     cttcttcgtc ttctctctca ttcatgtttg tttggtggtt tcgaatctct caaagttttt     78780
     ggttcgaagt tcaagttata tgattttcaa ttcccggatc catgatacgt ttcgcatgtt     78840
     tcgtccgttt cctctcttct tcgtgtgtta gtgtcacgtg cgttaggaaa ttctggtaga     78900
     ccaatacaag aaaacattat tggaattttt tccagctaag ccagcagtgt ttctttgtgc     78960
     agaaaaataa tttcgtgaaa tttaaaattt taaacttgtg agaattttct tctaacgata     79020
     acaaattatc caatatttac ctatacgttg cgaaacttaa agaatcgttc gtaataaaaa     79080
     aaaatcaggc tttttgggtc aactttaggc atttatacaa atgttttgat gttctgtcat     79140
     cttaaccact aaatctggta tagcacagaa atgttgattc accccgaaaa tgggcctgtt     79200
     acacgatcgg caattaatct gataaaacgt cataaatatc taacggcccc attctataga     79260
     gtattgattt ttttttattt ttattttcat caaaaaccaa tactgatctc gatacgatcg     79320
     tgaaattatc aactttcacg tgtgactaaa caaagacgaa accatcaaca tgctgagtct     79380
     aagccagtag tgatcatgca ttttgaacct ggtccggctc agtttgcgtc atttttttat     79440
     ttagtttaca tttcaagttt caatatgaga aaactttgac aaaaaaaatt gtcactagtt     79500
     ttaagaattt aagagatcta aacctgagtg gtctactttc cgtatcagct gctcacacta     79560
     tcggaacaac ggcctgcttc ttcatgtcca aacggctcta tgatttctta cctggtggcc     79620
     aacctgaccc gactatcaat ccaacattcc tacccgaatt aaccactcag tgcccacaaa     79680
     atggtgacat aaacgtccgt ttaccaattg accggttcag cgaacggcta ttcgacaagc     79740
     agattctgca aaacataaag gatggttttg ctgtgcttca gaccgacgca ggtctttacg     79800
     aggatgtaac gaccagacag gtcgtggatt cctatcttgg gatgctaaat ccattctttg     79860
     ggccaacatt cgagtctgat ttcgttaagg cgatcgtaaa gatggggaag attggtgtga     79920
     agactggttt caaaggggag attcgacggg tttgctcggc cttcaattga gagagtatgt     79980
     aatgaaattg aaactgtata atttcttttg ctcaaacaat gttttgactc cataatatgt     80040
     gtaggcaaaa aagcctctca aactctgaat gaatactaaa aaacaaagag agtattaatg     80100
     catggaattg aaaaagtaca aattctagag aggatgcaaa acaattataa agagagttga     80160
     atgtacgatt ttccactaca tccttggcgt taatagtgta catgtatgaa ttctgaagtc     80220
     tcaacatgta gtttttacca aaagacaaaa taaagttgta ttcgttataa ttcttagctg     80280
     tctcgaatca actaatttct tcccccattc ccttatgaca aaaaaaaaac ctaggctatt     80340
     aaaagaacga acaaaacaaa aagagaatca aagagcttaa gttctttcgg ctcttattct     80400
     tataatcgta gaccacttaa attccttgcg ttgggccttc tcacaaatcg tccctgttga     80460
     tgagagacaa ccacaatatt acaatgccaa tctttcacct aaatcgtagc tcaaataaaa     80520
     tgtatcagcg ttaccttcat tctacccttg ttgacagtat tatatatata agtttcaact     80580
     tttacatttt tcaagactat gagatttata ccttcatacg cgggcgttgg tcggcgttga     80640
     gcttgcgaac ttgatatcgg attttcttgg agaagagtct attcctccgc ttctctttat     80700
     accttaacac acttgcttct ctcataccac tttctccgaa caaatctatc tcacccaacc     80760
     ttacctgtcc ccaaacatca ttcatcttac gtcaaattca ctcactaaat tgtcaactaa     80820
     attcacttga taatctactt ctaacaaaac attgtaagtc agaaatgaca agaactacat     80880
     aagaaccatt ttcaattctt gtcaggttca gaaattcata atgaattgtt tgttgccaac     80940
     aattggtcat caaaacgttt ttatttcgat tcaaattatt aagataaggc taatataaat     81000
     gagaaaatag agaattgaag taacgtacat gaaaatcgac tccgtcagcg tccgaaccaa     81060
     gaatctcgtc ggagaacggt gactccttac ctgaccaagc ctctaaaacc ccatcgtagt     81120
     cgagcttcag caacggactc actctctgct ccagctttgg attcgagtcc gtaacttcag     81180
     agctctttga ttccgccgcc gccggagcca ctttcttttt cttcttcttc tttttctttt     81240
     tcttgtctcc ctccgccgtc acaatcgttt taatcttgct actatccacg acattggatt     81300
     gaccatcatc agctgctgcg gcggcggtgg tctgaattct cggcgaaatc tgatcaaact     81360
     ccacagtagg aaatttccac cagttctcgt cgttgttttg tcggagagaa cttctcaaac     81420
     caagccctaa acgaaacctt ccgttccaag cattcttcat aatttcctct aatcgaccga     81480
     ctctgtaaca attttctcta tctccgtcat tagattcaat attccccata aaactatcaa     81540
     ttccttcttc aatctcttca tctaaaatcg attccgcgtc gaaatcgtct aaaactccaa     81600
     acccattcac ctccaagtca tcaaaactga cttccttctg ctccaagaag tgttctgttt     81660
     tcgttggaat cgttggattg aacagaaact cgttctcctc gatggatacg tacggaagaa     81720
     gcaactgaga agcttcgtcg taatcactga gaggagattt attagtcccg aaaatctgag     81780
     tttttgcctt cttggaagag aagattttag ggtaagcggt ggagaggaga gccgcagctt     81840
     cgtcgtatgt ttggttggga cgtttccgtg gagttcgtgg ccttctcgtg gagattgaga     81900
     acggaggaga gtttgtctca gagattgtag atgacggtga aggagtgttg tttgacggcg     81960
     gcgatttcat catttccaac tcgaagctat aggcacaaga ggacattttc acctgtggac     82020
     gtttgattag aatccgagaa aaatcttgat gactgttgaa tttgaggtta aagttagtgt     82080
     gtgtttttta agaaaaggaa aaatataaag tcagaaagtt ttcgtatgaa gtctattgtt     82140
     aaaccctaaa ccctatgaca aaatcttgtt tactaaatat agcaaaaagg ttaaaactta     82200
     aatggggaaa aggtaagatt cagtatacta aaaaggaaac tcctacagaa aaaagaagag     82260
     aacatttaag attagagaga ggcagagagg tcatggaagt aagaattccc caaagagaga     82320
     gagagagagg gggcagtgat tggattggga gaagcacgag atggtgtaag aaagaaaaga     82380
     gaaaagatcc gttagggttt gtcaaacatt atatagtcaa ataagttgag tctctctgtt     82440
     tgattgatta gtgaaatatc atcactttgt tgatgcgaaa acagagaggt caaaaagtga     82500
     aaaagtgaga gggagtagcg gctctagggg gaagagagac ctaatgtagt tttcttctga     82560
     gattatgaat tttgaaagaa agcaaactca acgcagatca agttttgcaa tatgaaaaaa     82620
     aaattataat gtttgtgtaa atgttttttg ttatattaat gaaatttcac tatttctaac     82680
     atattaatac taatgtatac tgaatcatct tttcaagatg taaaaaaaca tataaattta     82740
     acaactgttt tgaataatat tgacaatcat ttttgtagaa tgctgagtgg aagattagta     82800
     tgtcattcat ttaattacac ttaaatatac atggataatt aattaggata agttttctta     82860
     tcaggcgttt tcgtgggaca agtacataat taggttaatt tcttatggga ttctactctc     82920
     tttttttaaa aaaaaaatct agacatttcc aaatgtcgat cgaaaacatt ataaccgacc     82980
     acctgtataa ctttccgtcg atgtcccccg tatgtacaaa acttaacagg tcaccttatc     83040
     cgtgtacgtg gccggatctc attgcgtttg ttagatttct gtgatgacgt ggtgttttcc     83100
     tttacactag gaaacttcaa tttggcattg gaatgtaaca tatggctaaa gtaactttat     83160
     ctgcttaaca tatttttcaa atatctaaaa ctatttctag accgaatttt agatatgtga     83220
     ctaagaagat ttcttgattt acatcaacca aaacaagagc accatgtgct gtttcttata     83280
     tggatataac agttcgaaat aagttatcgt cttcatacat ccctagaacc ccaacgactg     83340
     gactaaaacc ctcaacttct aaaataagac ttattgtaga ataataccaa attgtgaaaa     83400
     aaaaaacaaa tataaattat tgactatagt ttgaagtaag tcgtaatttt ttccgcaagg     83460
     taaattcatt caaagttaaa atgtggagag tgagagaaag agagtcgcgt ggctattggg     83520
     taatgagaaa cgattggacc catttggtat cattcggaag tgatatgtgg cagagggcaa     83580
     tcatacgttt tcgtcatagc gttagatttt cttacagttt cttagagatt atttcgattg     83640
     tttgtgtcaa acgagtttag tatgttactg ctattgaaca gtagtatttt ctcatgtatc     83700
     gatatgaata cgtttactct ttttcttttt ttcacacaat cagatgaata tagggatgaa     83760
     tatacgtagt tttgtctttg tcatatacta gattatattc ccaccagtca ttttcctatg     83820
     tatttaacaa gacaagacgt agaaaaatga gaattttagt acttgagtta acatatttaa     83880
     agattatatt cccatcagtc attgaacata tgtgtacata tatatacgag gagaatctat     83940
     aacttagtaa ggagggaaat atgagatttt atttctatag agaaaagaaa ggataaaacc     84000
     tctctctgcc aacactggcc accgtctcca aagtccatcc cagttaattt ttattttttg     84060
     gaatcttctt atgttattac tctttctttt cttatgacaa catgtcaaca tgtgacctgt     84120
     cgtcttctac tttcttttct tcagcttttc tccttttaag cagaatattc aatctatctt     84180
     caaattcata tctgagtttt gtactataaa agaaaagcag acattaaaaa agatttgaat     84240
     ataaaacaaa tgtattggag tggtaaagca catcttcatc aaacattttt aaggagcatc     84300
     aatctaattg gtcgatggaa atggaagtaa aggaatagaa gattgtttgt gttccatgat     84360
     gatgtatata tatgcctaat taatgttact gttagttacc tttggataac aaagatattt     84420
     aaagcggttt aatgcttatt aacggttgat ggatgttacc ttttcttttt gacatcacgg     84480
     tagatgttac ctttcatagg tgttgaatag acagattggg gacgttaatt agtaatgatg     84540
     taattagtta gagctaaata gtgctaataa atatatgtaa gaaattgttc ggaaagtaac     84600
     taaaaaaagt tcaattcatg caagtagaca cttcaaatgt gataaatgta taagtatgat     84660
     gttaagcatg tgacccttga gagtcgatta gggcactgta caagattgac ccaaatagtt     84720
     acaaactaca agtgaactct cttccattac atatctacgt gtattgaggg gaccattatc     84780
     gtacgtatac acgtatatat gttttgccct aaattcccaa ttttaattca gcatggggga     84840
     cggactcatt caatagcatc gtctttcact ttccttcttc ggtttaaaat ctcattttag     84900
     tttctgatcc aaaaaaaaat gtttgatcaa agatcaaaaa cttagataga aacaaactgt     84960
     ttttttttct taaatcaaga aagtctaaaa aactaagata caaaaaggga ctcgcagcgg     85020
     cagagagata agtatcttac gggccagcag ataatttcta tgttacgtcc ctttcatccc     85080
     cattgcatat tgcatatgaa gacaacggat attaactaaa atcttccaaa attacggtat     85140
     aatgaataat aatacacttc tgtctcatat agtattctat tatattgttc gaaaatgttc     85200
     ttatttacat atctatttat attgttaatt gattgcggct attactgtgg atattcatcg     85260
     taactatttt aatcaataca aatcatgcaa aatagtgaat gacttagaaa agttgaaacc     85320
     acatatgatt gagtttaggg ggaaaagtat aaaagaaagc atgactagta tgttactatg     85380
     tagtaagctt caaacatata tttaagaaaa tactatatat agatacatat gatataacat     85440
     aacattaaaa tatatggtga aacatttttt cttaatatcc taagcttcaa acatataccc     85500
     aagtagagaa gagttggagt attcattctt tggttaaaca tagacctaat acatagctca     85560
     tatggacaat ttttcgacaa aacaaaaatg atagcaaatg ggctaaaatg gtttcatatc     85620
     gaaaagccca aaccattaag ccaaaacgac gtcgtacgat atgacagcgg cgattcctat     85680
     aaccaccacc agaggttaaa aagtctctct ctttagctat cttttttgtg ttaccggttc     85740
     aaatggccgc cgtcgcagat tccgttgaga acaacggttc cataaacctc cctgagaatg     85800
     aaaaccttat accggcggga ttcagtgccg ccgcattgct tgacgaaaac tctggcgctt     85860
     tccctgaatt gaatcagccc gatagcttag ctgctgctga gactaccttc cccgatacga     85920
     acgattccgc ggaggagagg tggccaggtt ggcctggtga ttgcgtgttt cgtatgatcg     85980
     ttccggtgac taaagtcgga gctattattg gacgcaaagg tgactttata aagaagatgt     86040
     gtgaggagac tcgtgctcgt atcaaagtcc ttgatggtcc tgttaatact cccgatcgca     86100
     tcgttagtat ctctatctcc ttctacgtga tttactgtgt tcaaagctaa ttcgaatttg     86160
     gggattttta atttctattt ctagggtttc ttaatcataa gtaggaagat tcttgagttg     86220
     tgatcattaa agttgtgaac ttttatcccc tagttgtgca atttgattac tttatggttc     86280
     caattatagt ttgaagtgtt cactaagtta attacttgct caatgttatg ttttaggtgt     86340
     taatatctgg taaggaagaa ccagaggcct acatgtcacc ggcaatggac gcagtgttga     86400
     gggtgtttag acgtgtttca gggttgcctg ataatgatga tgatgatgtt caaaacgctg     86460
     gaagtgtctt ctcttcagtg cgtttattag ttgcttcaac gcaggcgatt aatttgattg     86520
     gaaaacaagg atctttgatt aagtctatag tagagaactc tggtgcatca gttcgtattt     86580
     tatcagaagg tattatctat catctgcagt tttctgtttt tacctaattg atctctttgt     86640
     ttgtgattgt taaagtttag tttttgctat ttcaattcat gtctgttttt ttttctaaaa     86700
     ttggtgtctt tgttgccagt ttcttatttc tctacttttt tctgccagag gaaacaccgt     86760
     tttatgctgc acaggatgag aggatagtgg atttgcaagg ggaagcttta aagattctta     86820
     aagcattaga agccattgtt ggacacctta ggagattttt agttgaccat actgttgtcc     86880
     ctctcttcga gaagcaagta agcttgcttg tttcaatcga gattattcct ttcccttttt     86940
     tttcttttct gaattattgt tatcttttct tatcttcagt atctagctag ggtctctcaa     87000
     actcgccagg aagaaccgtt agctgaaagc aagtcatctc tgcatactat ttcgtcaaat     87060
     ctaatggagc ctgatttctc cctcttagca cggagggaac ctttgtttct ggagcgcgat     87120
     tctcgggtgg actcacgtgt tcagccttcg ggagtttcta tctacagtca ggatcctgta     87180
     ctgtctgcca gacactcccc aggtcttgct cgggtttctt ctgcttttgt gacacaggta     87240
     gattccctta aatacaacat cagctcctga aaacgagttt agcgatatca tcttacttgt     87300
     tatgattagt cttccagcag tgattttgat cttaacacat ctaacttgtt tctctgaact     87360
     agtagtgacg tttctataat ggattctctt actaggtatc tcaaacgatg caaataccat     87420
     tctcctatgc agaggatatt attggtgtag aaggagctaa tatagcctat atccgtcgaa     87480
     gaagcggagc taccataacc attaaagaga gtccgcatcc tgatcaaatc acagtggaaa     87540
     tcaaaggcac aacttctcaa gtacaaactg ctgagcaact aattcaagta agaacacatt     87600
     cgatctgtat atatatatat atactttctg cgacgtggca ttgtataaac actaagatta     87660
     tgcttgcttt gcatcctacc ccgcctgctt catcataacc gtattctttt gtttacgtgt     87720
     gtgtaggagt tcatcatcaa tcacaaggaa ccagtttcgg tatcaggggg atatgccaga     87780
     atcgactctg gatatgtacc tgcatatcct cctcagctaa gtaaccgtca agagccgctc     87840
     ccgagcacct acatgggcac agagccggtg cagtacagac caacagcata ctctcagctg     87900
     gggggtcctt ctacctacac accgaccctg actgggcaaa cttatggttc ggaatataga     87960
     ccagcttctg atgttggtgg ctacagcagt tataatcttt gaattggttg ctgtgtttaa     88020
     gtttatttgc agattaattt ctctttagag aaaggctcat ttataatata atagagaggg     88080
     aaaaggaaca agttctagag agccaatgta gttgttggaa tgtgtaatgt aaatctaggt     88140
     gccctttttt tttttttttt tcatacctcg atatatgtca cactacgttt ctggtcaaat     88200
     aagaacatgt tttttctttc ttttttgtat gaatttgttt atcagaagtc agaatgattc     88260
     agttttaaga aatttttagt taacgtttta caacaataac ctgtaggagc tttttcttaa     88320
     ttgaataagt ttaagctttc tattttgatc tgatgatgct aatatgaaag cattctccga     88380
     agaaccaaac cacatgagac tttttgattt caatgtccat tcgtaactag taacggaaaa     88440
     gatcagacag aaaaaatgta ccaatcattc catatttgta gttttacatg atatagtaat     88500
     attctctagg tgtttaagtt gtatatttca tgatttttac acattttaaa acctgattaa     88560
     ggcctgtttt taacttttta tttcttcaaa ccgtaagaaa caatccttgc aagaaacaat     88620
     ccttgcttct tcttcttttt ttcgtcaaga aacaatcctt gctatatttt catttttaca     88680
     gcttcttgtt tttaagagag caaatataat aaataaggac ggctgaaaag aggtatatgt     88740
     atcacaaaat taaacaaaag agaatccacc tatcgacata gacgtggtat cctttcgata     88800
     tcgacagaat tatgttgaac gcagcaagtt ggccattaat caaatctttg acgcgtggaa     88860
     tcattctatt gtcaatgaaa acaaatatta aagaacaggt actacctata tacctaatag     88920
     attcctctaa cccgtcaaat gtcaatgtat cgaccgttac aattatgcac gtcttctaat     88980
     tgaaacattc tctactttgc caatgtctta tccccaaaac tacatataaa tatgcattta     89040
     cgggggctta gaatttcatc acaaaacttg caagtatcat tcacaggaga gggaagggag     89100
     agctcatcat acgaaatgag gtcaatcaca gctttgtttt tccttttctg tttccttgct     89160
     ccttctgctt tggcgcagct ccgaactggg ttctacagcc gctcatgccc ccgtgccgaa     89220
     tctatcgtgg ctagtgttgt tgccaaccgt ttcagaagtg acaagtccat tactgcagca     89280
     tttcttcgta tgcagtttca tgattgcttt gtcagggtcc gtaagcttct cctgtgtgta     89340
     catgtgtata tatattaaca taagctagct aatatttaga caacacattg atcaagcaat     89400
     gttttgaatg gttgtgtagg gttgtgatgc ttccctcttg atcgacccaa gacctggaag     89460
     gccatcagag aaaagcactg gaccaaatgc aagcgtgaga ggctacgaga tcattgatga     89520
     ggctaagaga cagctcgagg ctgcatgtcc ccgaactgtc tcatgcgcag acattgtaac     89580
     tcttgccaca agagactcgg tcgcattagc tggtggtcca aggttctcag taccaacagg     89640
     aagacgtgat ggattaaggt caaaccccaa tgatgtgaac ttacccggac caacaattcc     89700
     ggttagcgca tctatccaat tgtttgcagc tcaaggtatg aataccaacg atatggttac     89760
     acttattggt ggtggccaca gcgtcggtgt tgcacattgc agtctcttcc aggacaggct     89820
     ttccgaccgt gcaatggaac cctcattgaa gtctagcttg aggaggaaat gcagttcccc     89880
     taacgaccca acaacgtttt tggaccaaaa gacttcattt actgtggata acgcaatcta     89940
     tggagagatc cgaagacaaa gaggaattct aagaattgat caaaacttgg gtcttgatag     90000
     atcaaccagt gggattgtgt ctggttatgc atcaagcaat acactcttca gaaagagatt     90060
     tgccgaagca ttggtgaaaa tgggtaccat taaggttctt accggacgtt ctggagagat     90120
     caggagaaac tgcagagtct tcaacaactg aggacgttga ttcttgcaca cattctttac     90180
     aattattcac ggagagatcc aaagactgag cggaatccta cgttttttct tttctttgct     90240
     ttttttctta caaatcaaat cggaaagtgt gtttgttccg gtatcatgtt ttatttttcc     90300
     ctaaaaattg attcgcgtgt ttcattttca tgaactatat attgttctaa tttgatatta     90360
     acttcttttt ttggctctgt ggtgttctaa tttcttgttt tttttatgtg cttactccct     90420
     tcttaaccta tgacgttttg gataacaatg tttaatgaat aatggctctg ttaacagttt     90480
     ctaaaactca ttcgacaaga acttcgcctt ttcaaggttt ttctaccagc aatatatgag     90540
     ggtttctttt cagtttcatg tatgtgagaa ctataggttt tgatgtatgt tttcaactgt     90600
     atcatctacg aaaatattct gaagaaaatg ctttgggttc acatggaact tacttgttgg     90660
     gagacagagc ggtaagtgat ttttgcaagc aaagcctggt ttctggctgt tctatgaaga     90720
     agataatttc cgtttaagga tctcattctc ttttctcagt ttcattagct tctgtttcaa     90780
     tgtctcgacc tgtcgatttg aagttgtatc cctctgcttt tcagctattg acgttctact     90840
     aataagcact gcaaataata aaaagggatc ttcaattagt tttgcaatat atagacttaa     90900
     gaagttatgt ggactcttag tcttgctgat aaaacctgaa accaaaccaa tctatgactt     90960
     tttagtgaag aggaaaaaat tcttacattc cttctgcaga ctctgaagtt tgttactgat     91020
     atcatttttc tctgcttgtt ccattagaag gcagtccttt agatcctgaa tctcgagttc     91080
     atctatcaaa tgattatatc aggaagccat gtgaatgccg taaagaaaat acaaacttaa     91140
     gtacaattgg aggtcaggtg ggtgagagtc ttacacttgc actccacttc cgtaactact     91200
     cgatccagtt tcttcgacat tgcttgaata tgcgatttgt tagctgtcaa gtcttgtcga     91260
     agtctatcaa ttaccatatc gtttgttgct ttttcaacca aaaggcttct gtacataaat     91320
     ggttggggta tttaaccaaa agttcagata cattgacact tgaaataata gtcgtaaaat     91380
     gagcttttac ctgattttat actctagctc ttcaactttt gttacatgct tctgcctaag     91440
     tgattccaaa gcattcctat gttcctgcca cagcttacaa atatctcaaa acagatacat     91500
     aactaggaac gatccaagca tcatcttcag tttcaaagca caaggaaact ctacaaagaa     91560
     ttgacaagta ctaaaaactc ttcaatctaa aagctcacat gttctttgct tttgttttca     91620
     tcattcactc tcttcaattc ttctttcaag ctgtgacact tagttcgatg ctcaagctgt     91680
     atatatctcc aaccatataa aaggtttaca ggtattaggc acaagaaaca gagaaccttg     91740
     ttatattgtg ttgctttgct cacaaaaaga aagtctagat tctagtggaa acggacctga     91800
     tcagcaaaat tgttgagaga ttcggtgtaa agcttcttca gcctttcatt ctctgcaaat     91860
     tcccaaattc gagttaatca gatggctcaa aaaccactta aaagactagc aaagctaaac     91920
     taaacaccaa tcaacaaacc ttctttgaga tttttgttac taatctcaag aacctctctc     91980
     ctgcttgatt caacattgct ctttgatctg taaacattga tctcattcaa cccgatttta     92040
     aaatcctgag agaaacaaaa atgaactatg aatgttccga ttattctagc gatctaatcc     92100
     ttcaattaag cagtactaat ccttcaaaaa cttatgagta atcaattcga aatctgtacg     92160
     gatttgcagt accagtagcc tagaaatttc tgaataccag atcatctctg aaactaccgg     92220
     tgagagaaat acaacatgag ctgatcaaaa tttccagatt tctcaattca ttcggttcga     92280
     ttagagaagg agagcgaatc gatttgattt cagatgacga gataatcgta atcgaattag     92340
     atttaggttt ctcctatcga aaaacgaaac cagaatagtg gaagcagcaa gcgaagaaga     92400
     agaagaagag ataggaagag agaatcacct cgtagatttg atcgaaactg gagagaagca     92460
     aattcatctg ctcgtcgctt gttgccgcca tgattttgag tttttgagtt tcgaattcgt     92520
     aaaggcgagg gagattgaag aaaaaaggaa aaaaagctag gggtttaaaa ttcgaaggat     92580
     gttttggtaa atatgccgag cattctgggc cgtcgatgtc acctacacgc taatcgctaa     92640
     tccaatggtc atgttatcta attaaaaaga tatgtaaaaa aataaaatct tattaaaaag     92700
     ggataacatg aaaattgtta tacaatttat tattttgttt tgagaaatat taatatttgt     92760
     ttttttatta ataaaattat tactttactt aaaaaaatat atatctttct tgcttttttt     92820
     acatattttt tcctttcttt ctggaaattt tgtttttccg attcatgtta tgagatattt     92880
     ttttacattg accggtgtat tgtattttgt actttaattt tttattttat gtaatcactc     92940
     tcttattatt ctattgtgta cattttttaa aagtcattta actatttgtt cattgttttc     93000
     ttaagttaat ttctaattgt gatagttctt ttaagtaata tctatgatca caagattata     93060
     tcatgtactc aacatattgg tttttcaatg gaaattctat ttttttttgc taaaaaaata     93120
     aaagaacttt ttgtaatatt ttaattatta aactaattat atctaaactt tttgtatcgt     93180
     cgaacaaaaa tcatattata ttcttcttta ttatattcaa agtatacatt tttttcatcg     93240
     tatattagat atctacatat tgaagattag aagtaaaaaa tataacatat aaatccaaaa     93300
     tttaagatat gaattaaatg aaatttatta agtggacctc tgttaccata acttttgact     93360
     gaaacataaa aatctgttga actaaatttt tagaatttta ttttattttt attttttgtg     93420
     agagttgcac tttaaatgga aatcaatggg ataaacgata taataaatga ttctcaactt     93480
     acacatccca aataagtaaa aacaataaag tgataaacta attttgaaat aacagccaaa     93540
     tactaccaaa acaaatagag gttttccaaa taaaaatata gaaaattaca aatttgaaga     93600
     ttttttttat agtaatagat attaaaatta gatatcagtc cacaaaaata ttcatttcct     93660
     tatatgtata aattagtttc tttcttttaa aaatttccac tttagtcttt tttatttaat     93720
     ataaaaacca atttaccctt ttattaaggt atactaataa ataataatct aatataaata     93780
     gatagatatg caaagtattt aaaacacacg ctcccttgta ctatgaatca cagtgatttt     93840
     cccatccaaa taaactcaag ttcgataaat caccagtcta aaatggtttc atcaatgttc     93900
     gttacttcta acaacaaaaa ccatgctaat ttatatccat cttctttttt tactagttcc     93960
     catgtttcaa aagtttcttc atcttcattg agaaccaaca tggtttctcc tttcagtatg     94020
     cctttcatag ctcaaactag tggttttgtt aactattctc aagtttttat cactcaaacc     94080
     atcgcaaaaa ggtatcatgc tcttattccg acaagcaata tggtcattgt ccaaaatgat     94140
     aatgatcgtg tcaaccgttt catgacttct tatccaccaa ttttgaaatc tacagttaac     94200
     cccccaaatg attttgataa acagtatgaa accttcacac ctaaacccat cgatttcttt     94260
     tgttcgcaac aagactatgc atgtcgtcag catttggata tattttcatc ctccccaaaa     94320
     cactatcatg agcaatatgt tcataaaaat ggtcggtcgg tgaaatatat ctgtaaacca     94380
     acagaggtcc ttgaagaaat tcatgacgaa atcgattatg aaaaagacgg tggttggata     94440
     tatagcctgc cgtttgagaa agacagttca tttatatgtc taaagtgcaa tagtttgttt     94500
     gatacttcac aaatgttggt tgtacataca gagttaattc attctaagaa tgagactaag     94560
     aaaaggctta aattacatca tcaagaattc catggtaaat ctcataagat caacaaagat     94620
     caaactggag gacaaagttg cagaagaaag ttgaggcaat agagacgatc aagtgattat     94680
     gaaactccca gcatcatgta tttggtgaag aagcatctct ttaagatttg actttatttc     94740
     tttcatgttc agttttatta gtactttgta aaacaacttt ttgtgtattt cattatcttc     94800
     attgataatt taaaactgtt taagtcacca aagctatgta caaccatgga gaaaactata     94860
     tttctgttag tgtataactt ttattcgacc ataaagaaat aagtcggatt gggaaatcac     94920
     ctagaatttt actttttggt tagaaatctg taaatttatc ataaatttgt agaattcatg     94980
     gttaagataa gtgattaaat tataggaaaa aaaaaacaga gtaccaaaaa gaagagcctt     95040
     tcagaaaagc tgacggcgat tagggttttc gtgaaagatg atgacctaga agtaaattac     95100
     aattttgact ttttatttta agttttcaaa gtaacaattg ggtgtttaca ataaaacgag     95160
     tagacttgta aaatttttta atattattat tatagcgtaa atacataaat gccattataa     95220
     ctgtagtctc gatgtcagac gataattcca taaatctaac atctttttgt catctgaatt     95280
     atatttctaa tactatgatg aaatacaatc ttaaacacac agaagacaaa aactttgtga     95340
     agtctaaacc cctatcgaaa ggaagcaaac aaactatagt tggcgaaaag attacaaaga     95400
     tgaaagaaga atcccacaaa acaaaacaga ccaaaaccga agatcccatc acaaaggaaa     95460
     cataccaagc ccgtcaaaga accttattgc aaagagatta tttgctcgta catatcgaag     95520
     atctactgcc gaaacaagtt tttgcagttt ctgtcataaa tgattattta gtttgtatcc     95580
     aagcccaagg ccttgagccc atgagtgatg ttggcctgct ggggaagcac cagttttatc     95640
     ttagaactta tcattatttc gtttgataag agaatttttt ttttatcttt tatgtgaagt     95700
     ttatctattt ctttcatcta tttttctctt tttaaccttt tcaattatct cttttaaaaa     95760
     atacttttga atatatatat tttcattttc attttttatt tggttttgat atcagtttct     95820
     attttgtaaa aaaaacaaac aattagaaat ttttactttc gaaataggtt ccttaacatt     95880
     gttgtcaaga gtttaatcat agtttataga tggtaatggt atccaaaata agatatctat     95940
     ctataaacaa atgaattgtt gaggacaaat ttgtgggtag gtaggtatgt cttacaagca     96000
     aaatatactt gaaaatttgc aagtagcaga taaacaacgg gtactcaaat taattaaaca     96060
     ttattgactt agagaacaga taaaaagttt agctataaat aagcttagat tacgcgattt     96120
     gttatataag ctctctctcc tatcagatta aatttttaat ttttaaatgc tcgtaaatat     96180
     taaaaagtta aggtcaactt ccatagctgt tgagaaaaat catgtcacaa attattttaa     96240
     tagaaatctt ctcgaggagg aaacacattg cggtataaaa taaatcatca taattgaata     96300
     agaacaaata gcgaaattta cataaattaa gtagcagaaa caaatttgtt gtttccgata     96360
     aatacaacta taaaaaaaaa ttctttattt ctttttaatt aattttctag aaaatacata     96420
     aaaaataaaa ctatatatta aaattgatta taaatatatt attttttgtg atttatattt     96480
     tctataatat taaatcaata atatttaatt atttattttg aagtttagaa tataataata     96540
     ataactaata aatagtatat aaaacctaaa aaattaatat ttcagaaata atttttttcc     96600
     taaaaaatta aataaaaatg aacaaaaaaa tacaaatttt ttatggggaa aaaaatttaa     96660
     tggtagctcg gcttggagct ttcccatgtg ctcataaata atttgccgtg cgacagattc     96720
     tgtgggcgtt tattacacct aaacccatta ttatacaaaa aatcaaaatt taaaaaaacg     96780
     agaaataact ttgacaaaaa aaaaacgaga aataaaataa gaaagttaaa atcagagaat     96840
     aagtatttat tgttaactat gtatttttct ggtgtaacta aggtttcgta gtactatgtt     96900
     tttcagcttt cgaggtagac agactattac ataattgatg atgtgatcaa ttgaaaatat     96960
     ttgtgatgga agaaaggaaa aaagcaactt gttataaaga tgtggaactc aaactattag     97020
     ataaggttat gaaactacca tatttctctg ttgaaaagaa ctattggtcc cagaaaatga     97080
     ggtcatatac tgagacttta tatggtttca ttccaaattt caaaatttga cgtaattcag     97140
     gaagacataa atgaaagaga agaggatttg tttctttcta ccaaaagata agaaggttat     97200
     cttcaactga aaaacataaa ttctgtcata gtaacgtacg tgttatatag acggcgtatg     97260
     gagatgtcca tgtatttgct ttttagatag tccgtatacg tgtttgtgtg tggacatgta     97320
     ggtgagtaat tgtcaagcaa aaagtgttca ccaattgata ttagattaaa catatatata     97380
     tcttaaaatc ggccaaatat ccgccaaaac cttcttcata tcctaagaaa acaaacgttt     97440
     ctctctttac gtttcgtaca gaaatctaga attctaatat catgcaacat aagcttatca     97500
     aaactcaaaa aaaaaaaagt taaatcaatc aaaattatag acttcttctg gttagtaaat     97560
     tctcaattaa aaaaaaaaaa ttagacggtg caacgaaaac cacattagat atattattta     97620
     tttcttaaat gtaaataagc ttatttaaca aacaaaagaa aatcgggtgg cgacttccga     97680
     gattcgcggg gtactcaaat gaaatgaaca aaactacaaa gtcaaccatt tgagaaaagt     97740
     tgacttttca atttgatgac gtggcataca gctttacggg gccgtacctt cgcttccctt     97800
     ctcggacata tcttttatct tattttaaaa atatatttct cgtacatata aatataacca     97860
     caataattta atttttgtta taacctcgac aaaatagatg acaagtctct aacaaatatc     97920
     gttctcacaa atcctttaac tttatgtttt gtgtctagta ctcttatata gttgttagtt     97980
     atttaatttc aaaggtggat tatataagta tagtggcaga gtcactttag agatagtggg     98040
     gtcaagtgac ctgtgacccc tataacatct ataaaaaatt tgtttgtatg taatttgttg     98100
     ttggggtaaa ttctccgagt tgattcctgt gtcatgagtt caatactaat atgtgactct     98160
     ttttaattta atcattccat ttttcgactt aatccatttg tttacttgac acatggtaat     98220
     tattatttcg tctaaatgta tataaccatt aacgtttttt ttaatatttt tcttatacta     98280
     caatggtttt gttcaagcgc caaaaagtta acaacttaaa acatcaaagc aaccaatcaa     98340
     attgaatatt aggttagtat atttcaatta atatagtttt ttttttggta tgagagagga     98400
     gacaaatttc aattaaagta gttcgccact gaaataatta tactacataa aatatgttac     98460
     aaaatattaa aatactgtga aattataata tcttttaata aacattaatc acatataatc     98520
     ctaatataca tacagtattc taaaaacact ttttaaatat tatataaccg tatatataaa     98580
     ttgatacagc tttaggttca actctttgta aaacctcaac atttcattct aatgaaatac     98640
     acattcttat caaaaatata taataatata gatatataga gccagagtaa actgataatg     98700
     agatacttaa tacaaccaaa caaaaatcta gagagagata gagaatttca agttttcaac     98760
     gcaaagccct ctcttatcat ccgtacatat cttccatttc gatcttcaac tccctctatt     98820
     caatttcttt ataattatat ataaatagta tatggtgtct actcagttat ataacacatc     98880
     ttcttcataa cctctctctt tcctcatcgc tctctctatc tctctttctt tgtgggttct     98940
     agtttgtgtg tatatatact atatgcacat acacatagga agatatgatg ggttacgagc     99000
     agatgaatca gatgacaatg acgacaacag cgatgatgaa gaattacaat aagaagggac     99060
     taatcaatac tccacagaag aaaatgacga ggagaagtgt gtcggctatt gatggtggtg     99120
     cagctgcgac ggctaaagaa ggagatcgcc gtcagaatat caagactctt gatcttagcg     99180
     gcatgtcctt ggcttctctc tctgcctctt ctatcaactt agcttcaatc tccaaactcg     99240
     atctctccaa caacaatatt caggttttca acaaatatat agaaatgaaa cacttgttca     99300
     tttatcttat ggaaatagca attttttctc attaattttt ttaagatttt aaacctcaac     99360
     aacaacctat aaacccatat gtttttttct ttgtaattac aaaatatcca aaagtacttg     99420
     aattctagaa agcgattgtt ttcacagtac ctttgaaaac atggtctttc ctatttatcg     99480
     aaaaaaacat ggtctttcca taattaactt ataaatatat tttacatgat aatatattaa     99540
     tttaacaatt taaaatacgt gacaataata tatatagcta gctagctctt aagttgaggc     99600
     aaaacaaatt acgtgagttt catcgagact cgagtttttt ttttgggttt tcagagactt     99660
     gagaggttaa caaggatatt ataaccattt gattcggcct attcataata aagttgtggc     99720
     cttgtgggct ctaattaaat catgagagat cgttgctcac taaaaataaa gaaattataa     99780
     agattgtagc gaagatgaag caaggaaact tcctcttgca tatacaagat ttaattatgt     99840
     atatcgtaac tagacaaaaa aagaggttac ggataaaaca aattttgcca gaagtactta     99900
     ccagaaaatt tataaccatc actatttacg atatatatac gtatgacatc tatatatcat     99960
     gaaataaatg cagacaacac tttgcacaaa tttctttcgg tcaactcgaa cctcataaag    100020
     catattcgtt tctatttact caatgtctgg gtggataagc aattgagcca caagtgttcg    100080
     tttttttacg ttacatagtt gttaatttgt tatatacata aaacatcaac gaatagcatt    100140
     aactatccat atatacgtgt tgttcgtaat agttacatac ctctttggaa tctgtcctcg    100200
     tccactagca aaattgtcaa aaacaaaaag gaaaaaaccc ttatcaaaag ataaattttt    100260
     ggattcgatt gatgacatat tgtatataga acggtaaaga tttttaaaaa cgattaaact    100320
     ctgaatctct taaactttat atacgtgtgt gtgtagtgtg tagtgtgtag gtagtgtgta    100380
     ccacttaaaa ctttaaaaat tgtatcactc atttatttat ttttctgatg gcagaaaatt    100440
     ccggaatctc tagtagcgag aatgttaaat ttgtgggcat tggatttgca atccaatcag    100500
     ctaaaaactc ttccaaactc cattggatgt ctttccaaac ttaagtttct taatgtctcc    100560
     ggaaattatc tccaatctct ccccaaaact atagaagatt gcaggtaaga ccacttcctt    100620
     gcgtaagtat ctatattcca agtaatgtac caaaacgcga aacgcaaaaa caaaacgcag    100680
     atcgctggaa gagctgaacg ccaacttcaa cgagcttaca aggctcccag acgcgatagg    100740
     gtttgagcta acgaatctga cgaagctctc cgtcaactca aacaagcttg ttctcttgcc    100800
     aaactccgtt agctacttga cgtcgctgcg tgtgctcgac gcgcggctaa accgccttag    100860
     ttccctccct gaggatcttg agaacctcgt gaaccttcag gtcctcaacg ttagccagaa    100920
     cttccagcac ttgacgacgt taccttactc cgttgggttg ttgatatctc tcgtggagct    100980
     tgatgttagt tataacggaa ttacggtttt accagactcc ctcggctgtc ttcgccggat    101040
     tcagaagcta tccgtggagg gtaatcccct catttcccca ccatttgaag tggtatgtac    101100
     aattgttttt cagacaaaac ctattaattt gtttttttta gaaatgcatt caacaaaaaa    101160
     taatataata caaagtataa cttgtatcac aagcattatg atctacggaa ttagatcatg    101220
     acttgtatca caagcatggt acgcgaaact tttgagacat ataaactaaa atgtcttgtt    101280
     cttgctcatc cgttagtgac atagtttaaa tctgatgaca ggtggaacag gggttggaag    101340
     cattgaagca gtatatgagc gagaagatga ccgagtctta taagaaaact ccgaccaaga    101400
     aaaagtcttg gggcattggt aagctcgtaa agtacggcct gagctcttct ccggggagga    101460
     gtaccggccg tgaagacggg aaggaaggct tcatcaatgt atctgattac cgccaaatcg    101520
     acggaatcgc ctcaccgcga catgtgtccc tcttcaaccc gcgacgcctc ttgtctccac    101580
     tctccgcgta tttctctcct cctaggtatt agcttattta ggtgtgttgt ctgtcttttt    101640
     ttttttcatc ttctacatac gattccatac cgttttcact gttacatcca tgtagtgtta    101700
     aattgttaat gttcttttac gttgttttct gcatgcttgg tgtgaggata aaatttaatt    101760
     aaattgtgta tacgtttttt tttccctgtc tcatagaatt tttctatggc ttttctcatt    101820
     tcgttgtatt gtagttcaat tttgttgaac acatttgtaa actattacat agacacttaa    101880
     tattttacta tgtatataat gtaaaatcgc atttttgaaa gtactccacc atccttctca    101940
     gcctttgttt gggtagaaag ctaatatggg ccccaaatga gatgataggc ttgagtcctg    102000
     acattgatcc ggttaaaaga taatccgagg agagaacaaa ataacaaatc atcaaaatgt    102060
     ttgttacata ggcagagaaa tggttgtttt ggaagacttc gtagataggt tttttttttg    102120
     gtaggaactt catagatagg tttgatctcg tcaaaaagtg tgggctagct gataaaataa    102180
     catcacatta caaaaataca tagctcatgt tattttctca agagctcgtg tgctttatct    102240
     aatcttgttt caccaaatcc aatttactgt acagtttagt acgaattagt acgaataatt    102300
     tactataacg agtagccatc tattggctac cactaaaatc tgtgggggca ttccacaatt    102360
     agcaatcaaa aattgataac caatcttcta caattagtca tctattgcaa ccaatcactg    102420
     gatggatcaa aatgtattga tccgtaggtg agcttattac ataacacaga ggtctaagta    102480
     gtaagtatat aataactgaa acccaaagta gtttgagaaa tcaatgccag atatttaact    102540
     aaccaaacca caaaatagaa ttaacctttg tttgcagact cctccttctc gtctccttca    102600
     tcgttttcga tctgaggtaa tgtctgcaac caaagtgaac gaaaagggaa atgaattatc    102660
     agaacatcta tctccattct ccacggattt tcaaaacata tttttttggt tcagctagac    102720
     atttcatcga acaccttaca tacatttgta aagaaagaca acttacgaga tctggcttgt    102780
     atatattgtg aacgacggag gctccggcga gcagagaggc tacaactacg actgtcgacc    102840
     acgctagtga cggtgttccc gtcggcttct tcccgccaaa tttattgttc atctttttgt    102900
     ctcttcgatg ctttgttttt ttgttcttct ttttgctttg ggcaaatcag gaaattagta    102960
     acagtcttga tttcatttat agtctataga agttgataaa taatttaatt tacacttata    103020
     aaattgggta tgataaaaag tactcctgct tcaaaatcgt ccataattaa tggtaatcaa    103080
     tccaatttct actgcatttg tcataaataa tcatctttat tcttgatgta atcagtgttc    103140
     aaccaaaata ctgaacaaac actggtttca taagaagcag aaaaaatgta aaaacatttc    103200
     attcgagctc aagaaagaaa caaccattta ctcatttatt attgtatttt ctgttctttg    103260
     tacacactgc agatttttga gaagaaaatg atacagagct tgagagaggt ctaactataa    103320
     tctgtgtata tagggtttat atatatatct aagtcccctc ctttttcctt tgacaaggat    103380
     gagactttcc atcatatata tctcaagatt atggcgtata agtcagagaa cccattagag    103440
     ccaccagaaa acaacaatca ctagtagcaa gagggagaat cccatcgcct gcaacatcac    103500
     cagattttca atttttcatc attctctcca aaaacgtata cagtaatatg agatagagaa    103560
     aaagagttat tacagtgatt gcggaagcag caaggccggc tctttctcta ggatccttgc    103620
     ggtagtagtt cccgaaatat aaaagtgttg catagtacca taagaaaggg aacacaaaac    103680
     ccaagagaaa gctgcaaaac aagaagatag cttgtaaatc taaactgaat atagagaagc    103740
     tgcgttgact tcaactcaaa aaaaacttaa tactctctac tcacgagaac catccgattc    103800
     cacaaccaaa gcatggaaga ggcttgtcat acactccatt ttccacctcg tctacgtctt    103860
     ttacaagcgt atatcttcct ttcccacaca ccatagcatc tatcatacaa agccaatgtg    103920
     tattagctta tggaaaaggt gcaaaaatca aagtgcagga gttccacaca tgaacaaatc    103980
     ttttaaagag aaggcttgtg gagaatagtg gtagtagtac ctttaactgc agagtaatat    104040
     ttagcaactg gtctcacgag accggcatgc ttatcagcta cggatttaac cagctctgca    104100
     cttccatcac cacgctcttt aacagctgca aataacagat aagatttaat ccaaagagga    104160
     ctctacttgg acatcatgag aaggtacaga gttaacttaa tgttatctca tctcaagacc    104220
     atgccccctt gttcctaaaa caaaaattta tgatctttga ctgttggtga acaatcactt    104280
     ccagctagtc aacaacttag ttgtgagatt tagatgatcc tctattctag taacaagaac    104340
     taacaaagca catatctttt gaggactaat atgaatcgaa agagataaaa agggaggaag    104400
     atgattactt tctcccatac gttcttcagc agatgatgaa aatgctaagc tcttgcttat    104460
     aagtttgtgt cgtgacccac aagatcttca aattgcctgc aacaaaacat taacaatatg    104520
     aatgaatttc agaaaggaaa acatagaaaa cagagacgat ttcagctaaa accgtagcag    104580
     caatcaaacc aacaagaaat tgaaatcagc gtaacagaag catgaaaaag tctgaatcag    104640
     attatcttct ctatttggaa aaagaacata tatgagacaa taggacttca aattcatcgg    104700
     aagaatgaaa tccacacgaa ccggagactg ctccgggaag taaaaggaaa ccgatggaga    104760
     tgaataactt accagattat aatttctaga gcacaaattc gagaagagat ttgatttcaa    104820
     gggcagaggg aatataaata tcggatcaag aaatctggaa gcgagagagt cgtcgtgctt    104880
     cgtcttcttc ttgtgctgct tgtttcaact tcgtcagcgt gataaatgcg tagagagcgg    104940
     aagatgcaag aaaaatgaaa gtctattttt tcttttgcct aaagcaagtt tgtctctttt    105000
     ctagtactat tttgcttaat taaatacttt taatgtctta acaactatac gagtatttaa    105060
     ttcttccact aatcttttgt ccttttcatg atttatatta tgtaatcaat aatgatgttt    105120
     ttactcacat aattttgtag tgaaattagc tctaagaaat tacaattttt ctatttcttt    105180
     tttttttttg gaaaaatgaa tggacttttc ttaaacaaca ctttttcaaa atgaaataaa    105240
     cattattttg gtattatatt ttttatatat attttttttt gtaattcaga aagcttcgac    105300
     actgttagat ttagaccatt ctagatacgt taccagttac cacttaccag tagccacata    105360
     acagtactag ttcatatata gcataaatag ttaccagatt ttgatgtttt caaattaaat    105420
     atgcgactaa aactctaaaa tcattcaaag ttattattat ttatgagttt agttttcttc    105480
     ttttcctttc gtacaagtta gatatcatgt ataattaacc aactgtccat cataatctca    105540
     tatattctgg atcaaatcgt ccgtttaata tagttgaata tgtctctata attattttaa    105600
     aatgttactt gtgttattta agtaatacag aattatgtaa tagataaaaa attgtttgac    105660
     caaaaaaaaa aagagattaa aaacaatgtt aacttttcgt ccaagtagac accacatacc    105720
     aagttaccaa caacacttca catttgatca ttttagttga tctcttccat ccatgtggta    105780
     ttaatctaaa atatccaatg attatgacat cttattttat tttggcaacg atcgagtatt    105840
     accattaatt aaaatcaaca tgctattaaa taatccaaat aggcaaaaac ttcacaatca    105900
     aaagagaaga agaccattcg tcgaagaaaa ttactcacaa gagtataaaa ctatatatat    105960
     gatcagccta ttcttaatgt gaacattgag aagtggggag gttaaaatgc aatgattttg    106020
     atccaaagtt attgttgaca aagacaatta aagaaggaaa attcaaagga gagatgagtc    106080
     aaggacaagt caacgaccat ttcgtcttcg tcttcttctt tatactcatt agctacacga    106140
     cgtcgacggt tcgtcattct tcctctaagc tttatctttc tgatctctga ccttgtgtct    106200
     ctgtgcatgt gtgtttatct gctactgtgt tttgtcggtt tgatctccaa aaaccagaca    106260
     tgaacagagg aagcttatgc cctaatccca tctgtctccc tcctcttgag caatccatct    106320
     ccaaattctt gtaactctct ttctcttttt ctctgtgtgg attcttttta aatgtcaata    106380
     ttagggcatt atccataaat gtttctagtg attactctgt ttttattctt cagatttaga    106440
     tttatagttg gtgattactc tgttttattc tgcaaatcag agttcactgt tctctgtttc    106500
     taggatttgt tttcatacca caagtgattc tacagtcttt tactgtgtaa tcattgttag    106560
     gaattgaaat tgtttgaatg gagttttctg acattgaaaa ttggattaga acacagagtg    106620
     gaacgtttaa agatggagat cttcgagtga acaaagatgg aatccagacc gtgtctctgt    106680
     ccgaaccagg agctgtaagt ttgtttattc atgagatctc acttcctttc gtacattatg    106740
     taactccatg attgaatttg gatgtttttg gtttttgcag ccacctccta ttgagccatt    106800
     ggacaaccaa ttgagtttgg cagatttaga agtgatcaaa gtcattggca aaggaagtag    106860
     tggtaatgtc cagttggtca aacacaaact cactcaacag tttttcgctc ttaaggtcgt    106920
     tgattcagat tcttgttgtt acttcttttt ctagtgtttt cttctctctt ggttcacaaa    106980
     gatacatgat attattttca ggtcattcaa ttgaacacag aagaatcaac atgtcgggcg    107040
     atttctcagg agctgagaat aaacttgagc tcgcaatgtc catatcttgt ctcatgttat    107100
     caatctttct accacaacgg tcttgtttca atcatattgg aattcatgga tggtggatcc    107160
     cttgcagact tgttaaagaa agtcggaaaa gttcctgaaa acatgctatc tgccatctgc    107220
     aagcgagtac tctacgcgaa atctttaaac atctctaccg gttttctatt tttatcttct    107280
     ctaataaaac acataactaa gctcattctt ctctactaaa cgcaggttct tcgaggtctt    107340
     tgttatattc atcatgagag gcgaatcatt catcgggact taaagccttc aaacttgcta    107400
     atcaatcata gaggtgaagt caagatcaca gactttggtg tcagcaagat cttgacaagc    107460
     acaagtagtc ttgctaattc tttcgtgggc acataccctt atatgtctgt gagtctcctc    107520
     cattcacctc tcaacactca atatacatac aaactcaatt ttcagagtta caagtggttt    107580
     tatacgactt actggtgttg ttatcatgtt ttgcagccag agagaatcag cgggagtttg    107640
     tacagtaaca agagcgatat ttggagcttg ggactggttt tgctcgaatg tgcaacgggt    107700
     aaattcccgt atactcctcc agaacacaag aaaggatgga gtagcgtgta cgagcttgtg    107760
     gacgccattg ttgaaaaccc gcctccttgt gcaccttcca atctcttttc tccagagttt    107820
     tgctccttca tctcgcaatg gtgagacaga tttcgaccag ttgtcatgtc atttttgttg    107880
     ctataacgag taggcatttg aaatggtgct ttaacttgtg tagtgtacaa aaagatccaa    107940
     gggacagaaa atcagcaaag gagcttctgg tgcgttaatc atataagact ctgagtcttt    108000
     caccttgtac tgtcttggac tacttttaac gatctttttt ctggttccat cttggtgaat    108060
     aggaacacaa gttcgtaaag atgtttgaag attcggatac aaatctctcg gcttacttca    108120
     ccgacgcagg atctttgatt cccccacttg ctaactagaa ccgagtttga acaatctttt    108180
     aacctccaag ttattatttc atatccacta gaagagattt tatgaaagat aaatttacga    108240
     gatgttatga cttaagagac ttgtctacaa aatttgattt aatgtgtgta cttttcacat    108300
     cactattata aacacaacta tcatcagtta tgtttctctg ctagtggtgg atatacttat    108360
     atagtagttc atatcattat acacattttg ttttgtacat agtttaagta tctttctatt    108420
     ttcgtatgta aagttttgaa agtaattgca taaacaataa tactacatct taatgtatgt    108480
     tgtaaccata ttacaattag cccgggaaga aaaatacaag gggcttttta gaatgtagtc    108540
     aagacaaaag agcttaacac attaagcttc attatctcca tatggttata acttgttagt    108600
     taaaaaaata agcacaaatt aataatagta aatacttttt cttggagaga cccatattca    108660
     ttttaaaaat taagaaaaag gaccctctct gcctcagttc aagggtttgc tcttgagttt    108720
     cctccgaggc ttcaaatcaa ccaccaccac acttatgttg tctttgcttc ctctctgtat    108780
     cgccagcttt gacaaatact cagccgcgga catcgccgca ggatctttcc cttcctttct    108840
     ccgctcatcc gcgagcaacg atgcatcccc agccaccgcg tttttcttgt gccacaagag    108900
     aatccgcttc cttgccatct cacacgcttc ttcatccgtc attacatccc aaaccccgtc    108960
     actcgccaaa atcagacaat catcttcttt tactctcttc acagccgtca cttccggatc    109020
     aggaatgatg gatggtttca agtatctatc gcctgtcaca atgataaatg tttgtaagaa    109080
     gaaaggtttc ttctatttca agaaccattg agaagcttta tggagaaata taatgaaagc    109140
     ttaccaatgg atctcgacat ggcgagaaca ccgaaaacac gagctccatt ccactgaatc    109200
     actttccctc ctgcggcttc aatcctcgca gcttcatctt ctctatccgg ctacacacat    109260
     aacacaagca cacatcagaa atggtttcat aaacctctct aactcaacat cttgaaaact    109320
     aaaaacctat cacaagttca caaccaatcc aactatagat cttgagtcta tatatgctta    109380
     ctttatggtc aacggataat ggaagtgcag ttttgccgcg gcaaagaacg gctctagagt    109440
     caccgcagtt agcgacgaag atgtgagacg ggaaaacaac ggcaaccacc gacgttgacc    109500
     caaccgtctc cggcgcaact gactcaatct ccgagtcaac tctcaggaac gagttgaaaa    109560
     gagctttctt ccacttctcc agccacgtat caccatcgca gagcatcggt ttctccttag    109620
     ctatctcctc cgccaaagcc aaatgcatcc tctctctaca atagttcgct acctacacaa    109680
     caacaaccaa atcagattct gcaaactgta aacaacccta atcaaaagat ccaatctttt    109740
     acctgagaac cgccatggcc gtcgtaaaca ccgaagaaat gagcggcgga ttgaggatca    109800
     aaccgaccat ctaacatcga accagaggaa gattgaagga atcttggtat agtcgaaaca    109860
     gcatcttcca tctcaggtct tcttccacaa atcgaagtaa aaccatacaa aggcacactc    109920
     ttgaattcaa acaaactcct actctctgtt ctgctgatca tcttcttctc gctagtaata    109980
     tctgagccgt tgatctcatc tccggcggag atatcaacga cgactatatc agcagctgct    110040
     gattccttca tgtttaaatt aggagaattg atccgagaaa tcaaaacttt cctagattca    110100
     gaaccatgtg acccagaaac agagcatgat gaagtctccg gtaacgaaac cattagatct    110160
     ccgttctcgg aatcttgatt tgagtattgg ttattgcagt aacctttacc caatctgatc    110220
     ccggtgaaat ccatctgggt ttcggagaat ggcctgaaag gacctgcgat cgccggagat    110280
     acttcctcca ttaacggtaa agatttgatc tttttctctg gttgtgatct ataagatagc    110340
     tccaatggaa caaaaatgaa aattcgagag attttcacaa gagaaggact ttattagaag    110400
     aagctaggaa gacaagaaga aacacatgac tcctatgaaa aaggaaagca aaaacagaga    110460
     gacatatacc caaaaatatt tcccgggaaa atcacaaaca cagaaagaaa gaaatgaatt    110520
     gaatttcaat aagggtttcc tggattgtgg gtaattcgtt aggacctctt gaaaagattg    110580
     gtgtagtaat atctctctct cttcaattaa tttccaacta taaaactatt tctagattca    110640
     tctatataca cctaaaaaag ttgaaaagaa gagttctaat gtgccttgtt cacagataga    110700
     agagagaaag aaggaggaaa tgggtaggct aatgcaacaa ttgcttcgaa tctactattt    110760
     atgtatgtat acttatatac atatcacttt attttattac attattaaag tgatactttt    110820
     tttggcttat ttattttttg taataagggg agatgtttcg ttcttgaaat tttaaactat    110880
     ttaattcata aaaagacact tgcttcagac ttcctatatt caacattttt tttaaaaaaa    110940
     atgcttttat catttcttat ttttttaaca aacataaagt tttttggttt tttttttctt    111000
     tgggagaaat atatttcttt tttgtttgtc aaacaaaata aaatatgttt gcttttaact    111060
     ttagttaggt catcagttta atggatttta tattttcata aagatgactt tcattaaatg    111120
     acgtgtcgta gtccgagtta aatcttgtat tgttttgcaa ttattttatt tgtcatatag    111180
     ttttcaatct aaataaatag agtttgaatt acgaaaacat tattcgtaat tcctaatcat    111240
     tggactaaaa aacaccaaac ataatatacc atttagatat tcatagattt aaataaaaat    111300
     tttaaatttg tgtcattttc agaataagaa caatactttg tcctttagat aagaattcaa    111360
     tgttttatat tcgggaaaaa tgaaagacca ccggtaaaat atctaaataa ttgttattta    111420
     aggggtacgt ttcattattc atctaattat ttatcttgaa aaccattttt ggtcaaactc    111480
     aaaaccaaaa ccattatgaa gttatcgtct catttattta tgtgaccaaa aataataact    111540
     gaatcttagt tgttagaaaa attggtcttt gtagtttcat acaaaaaatc aagaaaagag    111600
     atttgtcgtg caattataaa aatacgttac aattatataa agctttttca aattccagta    111660
     tataattttc ttctcaattt atccttaagg gaaatgaaga gttggtcatg gaagtccatt    111720
     aaattcgacc aaatttttag ttttttttat tgaccagaaa agacagtaca aaacataaaa    111780
     ttattgttgt cgcagtatat atataaaata aaaagatgat tccgaaggta ttttgatgga    111840
     tagactcatg gacataatta tgcaacgacc caaagaacat gaaagaatcc gtccaatttt    111900
     ttaaaataaa ataaaaatgt gaataggtcc cacgtttagc agaaaacaaa aaccggtgga    111960
     tggtcgacac gtagacgaag aaaatgggaa ggagagaggg tgacgtgtac ggtttaagat    112020
     gtgttagttg ggtggcggga gagatttgat cgaaagaaaa aaaggttcat tgcactgaca    112080
     aagacaggtc ccccttttat attatttttc tttcgtccca ttaaattccg taaatatctt    112140
     gtctttaaac tctctttttt cctctcctca ttattattct attttctcta atatctcaat    112200
     aaatatttat tcgtcaacag atagataaaa aagaagtatt tattcatgtt ccatatgttt    112260
     gatgccactt gtgcggtttt ctttggacaa tgtgtaatga tatgttattc atatgggaga    112320
     tgtgtgaaag tgggctttgg atgatgggca agagacaaaa tacccaagac acctcaaata    112380
     caatgtacca atcatctacc gttttttttt tacaaattat tacaaaagta gaaaaaacat    112440
     tgatttttta ttgaaagcta tttcttttag ataaactgag aagaaagccg agacaaatat    112500
     gaacactagt aatttatttt gtttaatgtg tgattaattg aatttgttag ctttccttgc    112560
     gattgcgggc aaagtggata agagaagtag aagtaggttt gttctaactc gtaataaagt    112620
     cacagaacta attctaaaga acggtacata tatcatcatt cataagtact tgatgtctcc    112680
     cattttcggt gaaacacttt acttgaccag tctttttaat atgcaacaaa tcttgtatat    112740
     attcaacata aaaaaaatgc accatcattg gaattgttga cccaacaaaa aaaccctata    112800
     ggcattaaaa ggctcttaga gggccaattt tgttatcggg ccttcacttg gccagtagaa    112860
     attacaagca tgcaaacaac agttcgagac ttcgaggaag attcctatct ctctctactc    112920
     gtttcttgaa ccaagtcata caagcaagca agacagcttt attaaagttg actttacttt    112980
     aatctttatg agtcaacacc tcatctttat tagttagtta gctcagacaa gtaaaagaaa    113040
     gagcgagaaa tcatcgaaat ggatttcatc tcatctctta tcgttggctg tgctcaggtg    113100
     ttgtgtgaat ctatgaatat ggcggagaga agaggacata agactgatct tagacaagcc    113160
     atcactgatc ttgaaacagc catcggtgac ttgaaggcca tacgtgatga cctgacttta    113220
     cggatccaac aagacggtct agagggacga agctgctcaa atcgtgccag agagtggctt    113280
     agtgcggtgc aagtaacgga gactaaaaca gccctacttt tagtgaggtt taggcgtcgg    113340
     gaacagagga cgcgaatgag gaggagatac ctcagttgtt tcggttgtgc cgactacaaa    113400
     ctgtgcaaga aggtttctgc catattgaag agcattggtg agctgagaga acgctctgaa    113460
     gctatcaaaa cagatggcgg gtcaattcaa gtaacttgta gagagatacc catcaagtcc    113520
     gttgtcggaa ataccacgat gatggaacag gttttggaat ttctcagtga agaagaagaa    113580
     agaggaatca ttggtgttta tggacctggt ggggttggga agacaacgtt aatgcagagc    113640
     attaacaacg agctgatcac aaaaggacat cagtatgatg tactgatttg ggttcaaatg    113700
     tccagagaat tcggcgagtg tacaattcag caagccgttg gagcacggtt gggtttatct    113760
     tgggacgaga aggagaccgg cgaaaacaga gctttgaaga tatacagagc tttgagacag    113820
     aaacgtttct tgttgttgct agatgatgtc tgggaagaga tagacttgga gaaaactgga    113880
     gttcctcgac ctgacaggga aaacaaatgc aaggtgatgt tcacgacacg gtctatagca    113940
     ttatgcaaca atatgggtgc ggaatacaag ttgagagtgg agtttctgga gaagaaacac    114000
     gcgtgggagc tgttctgtag taaggtatgg agaaaagatc ttttagagtc atcatcaatt    114060
     cgccggctcg cggagattat agtgagtaaa tgtggaggat tgccactagc gttgatcact    114120
     ttaggaggag ccatggctca tagagagaca gaagaagagt ggatccatgc tagtgaagtt    114180
     ctgactagat ttccagcaga gatgaagggt atgaactatg tatttgccct tttgaaattc    114240
     agctacgaca acctcgagag tgatctgctt cggtcttgtt tcttgtactg cgctttattc    114300
     ccagaagaac attctataga gatcgagcag cttgttgagt actgggtcgg cgaagggttt    114360
     ctcaccagct cccatggcgt taacaccatt tacaagggat attttctcat tggggatctg    114420
     aaagcggcat gtttgttgga aaccggagat gagaaaacac aggtgaagat gcataatgtg    114480
     gtcagaagct ttgcattgtg gatggcatct gaacagggga cttataagga gctgatccta    114540
     gttgagccta gcatgggaca tactgaagct cctaaagcag aaaactggcg acaagcgttg    114600
     gtgatctcat tgttagataa cagaatccag accttgcctg aaaaactcat atgcccgaaa    114660
     ctgacaacac tgatgctcca acagaacagc tctttgaaga agattccaac agggtttttc    114720
     atgcatatgc ctgttctcag agtcttggac ttgtcgttca caagtatcac tgagattccg    114780
     ttgtctatca agtatttggt ggagttgtat catctgtcta tgtcaggaac aaagataagt    114840
     gtattgccac aggagcttgg gaatcttaga aaactgaagc atctggacct acaaagaact    114900
     cagtttcttc agacgatccc acgagatgcc atatgttggc tgagcaagct cgaggttctg    114960
     aacttgtact acagttacgc cggttgggaa ctgcagagct ttggagaaga tgaagcagaa    115020
     gaactcggat tcgctgactt ggaatacttg gaaaacctaa ccacactcgg tatcactgtt    115080
     ctctcattgg agaccctaaa aactctcttc gagttcggtg ctttgcataa acatatacag    115140
     catctccacg ttgaagagtg caatgaactc ctctacttca atctcccatc actcactaac    115200
     catggcagga acctgagaag acttagcatt aaaagttgcc atgacttgga gtacctggtc    115260
     acacccgcag attttgaaaa tgattggctt ccgagtctag aggttctgac gttacacagc    115320
     cttcacaact taaccagagt gtggggaaat tctgtaagcc aagattgtct gcggaatatc    115380
     cgttgcataa acatttcaca ctgcaacaag ctgaagaatg tctcatgggt tcagaaactc    115440
     ccaaagctag aggtgattga actgttcgac tgcagagaga tagaggaatt gataagcgaa    115500
     cacgagagtc catccgtcga agatccaaca ttgttcccaa gcctgaagac cttgagaact    115560
     agggatctgc cagaactaaa cagcatcctc ccatctcgat tttcattcca aaaagttgaa    115620
     acattagtca tcacaaattg ccccagagtt aagaaactgc cgtttcagga gaggaggacc    115680
     cagatgaact tgccaacagt ttattgtgag gagaaatggt ggaaagcact ggaaaaagat    115740
     caaccaaacg aagagctttg ttatttaccg cgctttgttc caaattgata taagagctaa    115800
     gagcactctg tacaaatatg tccattcata agtagcagga agccaggaag gttgttccag    115860
     tgaagtcatc aactttccac tagaccacaa aactagagat tatgtaatca taaaaaccaa    115920
     actatccgcg atcaaataga tctcacgact atgaggacga agactcaccg agtatcgtcg    115980
     atatagaaac tccaagctcc agttccgatc agtgaagacg aacaagttta tcagatctct    116040
     gcaacaattc tgggaatcgt cacctcagat tagacctcca gtaagaagtg agaaagcatg    116100
     gacgacgact gtgaagaatt gagctaatga gctgaaccgg atccggtgaa attgcagaac    116160
     cggatcggag aagaagaatt ttgcatttgt gcatctttat ttttaattgt tacgtttgag    116220
     ccccaataat catagatatt gtagtgaaga ccaaatttca tggtggatca atcaaattgt    116280
     attttcaaat tttcgtagtg taataacgga aaaaggaata aaaaggtcac tgagtaaaat    116340
     taatgtatca gtggggatgg tgttcgtccg agacttgaag attatcgatg cctttaacta    116400
     ctgattcgta gtgtcttctt gtggatttcc cagcctcccc aggagagttt ctcgggatca    116460
     cgccgcggct gacgtcacct gtacggcttc tctgcaacaa ctcctcgctg cctggaaaat    116520
     tgtcccggct gccacttact gcagttactc tcctcgatga tcctgctgat tgtgcaaaca    116580
     acgaggagct cgggatctgc atccaaaaga aattgaacaa agttttgata cttttagcca    116640
     ctaaatcaca tatgacccaa actcatgttt gcaggtgaga gagatagcaa atgcagagag    116700
     attcatacca tggagtctct agcacttgag gatgtcggtt ggttcgaaat attccctgag    116760
     ttatcaagag cccctgaaac tctccgtcga gatgattcca tatgtggtcg cccttcttcc    116820
     tccccttgga ttcaacaatg aacaacaaac aatgtgaata ataacttctt tgcagagaaa    116880
     taagaattac gttgtaagtg atcagggaaa tttacctgtg tatctatcga tgttggaaat    116940
     gcccggaggc aatgcggcac tagttcccac agcaggattc tgaagcagga gagactccat    117000
     cagaaaatgt caaaccaaaa aagatagttt aaccaagaac tcaagtttta cttacgaggg    117060
     cacgagatgg gggagcggtt agttgtgatt gttgatattt caagattgtc cagtcaaaca    117120
     cgtaatcaaa ctgaaaccct gcaacaggga aatgaaatct tgttagaaaa tatattaggc    117180
     ttaaaaattg agagggaagg aaatatcaaa ccttcacgga taaagagatc tcgaaatatt    117240
     cttttcagat aagcgtaatc tggtttatca tcaaaccgaa gcgaccgaca gtagtggaaa    117300
     taggatgcaa attcggatgg gtaaccacga cataaagcct gcaggtgtaa ggcgatcata    117360
     tacgaatcag aatgagggaa acaaaaatct gagtaaaaat gtagcatact tgtgaaatga    117420
     acttacctca atggatgtag aaactttctt ttcactaatc ctttcatact tttgcttttt    117480
     ggttccagct ttcagtcctt gccatggaag actaaaacag agatattcca cacatcaatc    117540
     aaactgaaga agttagggaa ataaagtgaa gagagtgtga ggcatgtagc ataaactcac    117600
     cttcctttga ggaaatacat aaggatgtaa ccaagagact caagatcatc ccttcgactt    117660
     tgttcttcag gttcgcaatg ccagaaaaca aataacagct gatgagtatc aaaccttata    117720
     actcaaacac ataaggagag tgactggaac aaattaacat gaagcaggtc ttgtcgagct    117780
     taccaattcc caagtgagtg ttcatactag catatctcgc agttcctgtc aggtttttat    117840
     tttccctgca aatgagaatc atgggaaaaa ttagcgtttc cagtcatcac ataacaacgg    117900
     aatcatgctc aagggaagaa cattcaagag ctgatacaat gatcgcctca cctgtaggga    117960
     atgtgctgat gtgttgtact atccctatac ttcttagcaa gaccaaagtc aatgatgtat    118020
     accttagaga aggattaaac ttggtcaata caatgatgtc tccaaaagta aaataagacc    118080
     aaaaggatat agttaagaca ataagatgat aaacctggtt cgcacgcctt ccaaggccca    118140
     tgaggaagtt gtctggctta agatctcggt gaaggaaaga ctttgaatga aaaaactcaa    118200
     cacggttgat cttatcacaa aaaccaaagg aagaaagaag tcaatatttc ctgaaacata    118260
     gaggagcaaa tgaaagaaag gcgtcacatg aagaagtata ccatttgatc agcaagcatg    118320
     aggacagact tcaatgaaag tttcctgcta caaaaattga agagatcttc aagacttggt    118380
     ccgagtagat ccatcaccaa aacattatag tccccttcaa caccaaacca tttgacattt    118440
     ggaacaccag ctaccaaagt taaggcaaaa gaaaggtcat aagtaacaca aactttacat    118500
     tatcagaaat caatatctca ttcagaagat aagaatcatt acttccccct tgtagaatcc    118560
     tgtataactt cgattcatag agcagctgtg gatgttttgt cttcacattt tcctgggaaa    118620
     acaaaaacaa agagaatcaa aatctcagct tttcaacata ctgaacttga tcaaactaaa    118680
     catattgtga taatgttact tataaatcca taaacttttt gatcatcaaa ttattaaaat    118740
     gggatgactg aagaactcac aagcttaata gccagttctt cattcgtatg aatattagta    118800
     cctggaaaat cacaggttaa caacaatgtt agagataatg tgacgaattc gataatccat    118860
     aaaattaaaa actagaaagt gagagagaga cgaaccgaga tagatctctc caaacgaacc    118920
     actaccgatc tttcggccga gacgaaactt gttccccaca cgaggttcca taaataacca    118980
     cgaaacccct tgtacaatct taacaaccca gacgcagatt caaatagagc gaaagggacc    119040
     ccaaaaacaa tcctgactag aatcagccgc accagcaatc cagaaaaaca acccagagat    119100
     cacgaacaat gagattacgg atttttcgcc gactaaatca aaacccagta atcatcttct    119160
     tcgtgctctc gatctggtga aaaaactcca tatgaacaga atgtcgtttt ctgggatgct    119220
     tctctctctc tctctcctct caagaattga atacgaagat aaaaaaaaaa aaaaaaaaaa    119280
     agagcttcga tggacagaaa acgatgagga tgtctttctc aaagtttgcg tctttttttt    119340
     tttcctcttt ccttgcagtt gcgggtaatg taaaaaaatt atttacctct gaatgattcc    119400
     ggttttgttg ctgtgtgcta tgttcggttt ggtttctatg cttcggttca accaaacaat    119460
     ctaatgatta tggcaagcag aatagtaaaa tagaaaaaat gtgtaaaaca tctatagaac    119520
     acatatgtat atacatgctg agcatcttta aatccacaaa aatactacta tttgagccga    119580
     atctaccaac taaactaaac ctggttttaa aattatccgg tttatttgag agtttcaaca    119640
     acaagcgcgc ttagaccatc attattcata gtttataagg ttagttctta gataaagtag    119700
     gtcttaaatt taatgttata attcaattaa ttgttaaaaa tgactcttat ataagagcca    119760
     aatctaatgt ttcttaggtt aattcttaga taaattaggt attaaatata atgttttaat    119820
     tcaattaatc ttaattctta gataaattaa gtattaaatc taattgtttg tcatatttgt    119880
     ttaaaatttt atgttatgta tgtttcaaat tttttgagtt gtaataatta ttaagttttt    119940
     taaaattata atgtttctac tttttttcca attttttttt taagaactca agttaagagt    120000
     ccaccattgc atattgccaa aatttcaatc tcttaactaa attcttaact tcaaaatttt    120060
     caaaatcaat tataaaaata ttcataagaa ctattaagat tatgctaaga aactactatt    120120
     aatgatactc ttatgatggc tatatgatat aaaaagattg accacttacc aggtgtgttt    120180
     gctacgcgtg acttgaaagc tctacaaaat gtttctctta agtgggagtc gtggaggtac    120240
     aaaaagcttt tcacctttgc ttttaatagg atgaatgaaa tgatttacag ttatctgatt    120300
     aggttgaatt tgtctcatgg ttttctggtt aaaaaaaaat gctacgcgtg aggcttcttt    120360
     attgtgtttc tggtcagacg tataaaaggt tgaaacttca aattgaaaat gtcgtgatga    120420
     gctaatctag attagagtac gtttaattcg tttgaactcg ggatgagctt aaaccaaact    120480
     aaagatcttt gtgccttttg ggatatgact ttttgttgtg gactgttttt ttgtttttgt    120540
     tgtggactgt tttttgtttt taattagtat gtacagtgta tgtgaacaaa agaagtaatc    120600
     agtgtattgg gcttggaagg ctcattcttg ggatgggcct tagtactaac agattcagaa    120660
     atcttctatt tgatcccatt aaagttcact aacctgtact gtatttggtg aagaatcaaa    120720
     tatatataag tgtatatata tatatataag tatatagata attaatataa ttacatgcaa    120780
     aattttaatt atatagataa ttaaagttta tatattagtt atatatattt ataattgatt    120840
     gaattcataa ataaacttta attatctata tataagtcag ttctcattat ccatatatat    120900
     atgtatgtaa agttttgcat gttatttaat tcaataaact taattttgct ttttaaaaca    120960
     ttaaacatca atttttagag aaagaaaagt atatataaaa agagaaaaaa ctaaaatggc    121020
     atttgttata attttggtgt gaaaaggagg gagagaaaaa aacaaaaaaa caaagaggat    121080
     ttaagggtta cgagtcgcct ccccaaaacc cttgtcccta gtctcttctg cttcttcttc    121140
     ttcaaaatct ctctcttcac caaatcctca gaagatgagc aacgacaagg atagcttcaa    121200
     cgtctccgat cttactgctg gtaaaatact cctactcacg attactctta tctctttctc    121260
     cgcctcttaa gccagagctg ctttaaccct aatttcctct gttatctgac tggtgttcct    121320
     tttgtttact gtttttttgc agctcttaag gacgaggatc gagctggcct tgtcaatgct    121380
     ctaaaggtga gtttttttcc ccttctgtaa actgtcccgt gagcatttgc tattgaaaga    121440
     tatggaggat gttgagttac tttcctctga ttgtttagat actataagcc gtgtcttggt    121500
     gtttagtgtt ttggtttcaa tgtcattctt ctagtacaat gatagtttat gagttgttaa    121560
     tacattgtta ttaattcaca gaacaagctg cagaatctgg ctggtcagcg ttctgatgtg    121620
     ctcgagaatc tgactcccaa tgtgagaaag cgcgttgatg ccttgaggga tatacaggtt    121680
     agcgaaattt ctttcacatt ttaccaaact atgtgtgcta tatatcgttt aatggggttt    121740
     gttttgtttt gtgtgagttt tctccctgct tatctgaatt taaagtttca aaagtaaggt    121800
     gttgcgtttt gattactgat gacttctttc cacgcagagc caacatgatg aactagaggc    121860
     aaaattccgt gaggagagag ctattcttga agccaagtat caaacgctgt atcagccttt    121920
     gtatgtcaag gtaattgtta atgagaaagt tttacaaacc attttactaa actcaatgta    121980
     gatctgtgta tactcttttt gcttatgttt acttatctgc agcagtgtta gttttctatg    122040
     tgcatcttaa tgaattctac ttggtatctt gtaatggcac agcgttatga gattgtgaat    122100
     ggcactactg aagttgaact ggctccagag gatgatacca aggtggacca aggagaggag    122160
     aaaactgcag aaggtaactt catgagcact atgtcttctt tgtttgttgt taatcttttt    122220
     ggaaagacaa aaacaattta acatttttct ctgtttttca ttgcagagaa aggagttcca    122280
     agtttctggc tgacagctct gaaaaataac gatgttattt ccgaggaggt agcctatatg    122340
     cagttttggt gttcgtttta taaacactcc aatcataacc atggaatatg agcataactt    122400
     attgtcattt atgtcaggtc acagagcgtg atgaaggggc tctcaaatat cttaaagata    122460
     ttaagtggtg caagattgaa gagcctaaag gattcaaact tgagtttttc tttgacacga    122520
     atccgtattt taagaacact gtcttgacaa agtcttatca tatgattgat gaagatgagc    122580
     cactgcttga gaaggctatg gggtaactac ttatactctc ttgcaattgt tgtatacttt    122640
     taagtatatt ctgcttatta gctgattgca ttgagctgct tatttttttt cttcgcttat    122700
     attgcaaatg gattcttatt ctttcaccat tcattttcag gacagaaatt gattggtatc    122760
     ctggaaagtg tctaactcag aagattctca agaagaagcc taagaaaggt tcaaagaata    122820
     ctaaaccaat caccaaactc gaagattgtg aaagcttctt caacttcttt agtcctccag    122880
     aagttccgga tgaagatgaa gatatcgacg aggaaagagt aagataacga ttgttagaaa    122940
     aacctgtcat catttagtta atgtatttag taactctttc tcgttctttg atgcaggctg    123000
     aggatcttca aaacctgatg gaacaagatt atgacatcgg gttcgtcttt ttctaaacac    123060
     actttctctg ttgattttat gggtttgctt ttgagtcatg ggactacttt atcactgcaa    123120
     tcaaggtggt taccctttca ttattatctg atcacaagta ctttttactt tctgcagatc    123180
     tactattcgg gaaaagatta ttcctcgtgc tgtctcatgg tttactggtg aggctatgga    123240
     agcagaggat tttgaaatag atgacgatga ggaagatgac attgatgagg atgaagatga    123300
     ggaagacgaa gaggatgagg aggacgatga tgatgaggat gaagaagaaa gcaagaccaa    123360
     aaagaaggta taaagtgccc caagtatagt tgtttctttt tttttttttt ttcttcatgc    123420
     cacgttagtt ttttactaat cctttgaaat cgcttaatat ttttttttgc agccatcaat    123480
     cggcaacaag gtatgtaacc tttcagaact aaagtttatt tgattttgga actccaacat    123540
     tcaaataacc aaacacaaga agtttcaggc tgagcattgt gatgaaaata gaaattaata    123600
     tcggaaatgt aggctctaga ggcccatgaa tcatacagat tgctgaaagt aactgagcaa    123660
     tcctaaaaag tatgaatcag taaataggta gttacgtaga agactctgag aaggatacat    123720
     gaatgacaca gcagagacta aacaagctct ttaatcatgg catgggcagt acgagataga    123780
     accattctca tgaattcatt ttattactat agtagcaaac tagcaatcag tgtctatgtt    123840
     tgtgataaat gtgagaatca tctgcttaat ttttttttcc tcttggactg cagaagggag    123900
     ggagatctca gatagttggt gaaggtaaac aagatgagag gccacccgaa tgcaagcaac    123960
     agtaatcttt tactacgctc taccagacat aaaaggattg cgtgaaaata taattcaggt    124020
     cattctctgt tcatcaagaa tgaggattga gaaaaggttt tgggattttt aaaagtgaaa    124080
     ttcatcttgt aggagtttcg ttcgtttttc tattggtgtg tttattttct ctaaagcact    124140
     ttaataatat accttggtat ttaatttatg aatcaagcat catcatccct agtctctgca    124200
     ttcactactt catcccctac ctaaactttg tcgacgaaag agattttaat aaccatttag    124260
     atagtaatgg gtagtgggaa tgatcattat tcttttgttc accgtccttt gattttcaat    124320
     ggtaaccatt ttgttgtgta agactacaaa agatgaataa ttggactatg accatattat    124380
     attagtcaag tctaaatcgg tcgaaatcag ttcaccttta agatgagtaa tttgactaaa    124440
     tgcctccgct tgttcaacac taattataat ttaaattatt gtagaaggaa aacacaaaga    124500
     aagtgaggtt ccgaacatcc acaatttgga ctaatcacat actacttaag aagtttaatg    124560
     catcattaga gctaaatgag gggaaaaaaa agctagctaa ataaacttga gacacttgtt    124620
     tgtgtttggt gttatgaaaa acaaactcaa aagtcgcaac actgtttggt aaattggaga    124680
     catgcgaaga ggggaccgct tcgttaccat tcagagtatt tgacgtaata tattccgttt    124740
     taagaaacct atctagtttc caagaaattt actaataaag gtgcttgaga aagaccgttg    124800
     ttgatgatac gtttttttat ttgctaatga aacgattcgg tcgttgtttc ttgaaattcc    124860
     actgttatta gactcttgac tctgttttgt ttcccgccga tctcgtgatg atggccacca    124920
     ccaccaccac caccaccgct agattctctg attcatacga gttcagcaac acaagcggca    124980
     atagcttctt cgccgccgag tcatctcttg attatccgac ggaatttctc acgccaccgg    125040
     aggtatcagc tcttaaactt ctgtctaact gcctcgagtc tgttttcgac tcgccggaga    125100
     cgttctacag cgatgctaag ctagttctcg ccggcggccg ggaagtttct tttcaccgtt    125160
     gtattctttc cgcgagaatt cctgtcttca aaagcgcttt agccaccgtg aaggaacaaa    125220
     aatcctccac caccgtgaag ctccagctga aagagatcgc cagagattac gaagtcggct    125280
     ttgactcggt tgtggcggtt ttggcgtatg tttacagcgg cagagtgagg tccccgccga    125340
     agggagcttc tgcttgcgta gacgacgatt gttgccacgt ggcttgccgg tcaaaggtgg    125400
     atttcatggt ggaggttctt tatctgtctt tcgttttcca gattcaagaa ttagttactc    125460
     tgtatgaggt aaaacacaat ccactaaatt ctcattgact cataacatca tcttaagtct    125520
     cctctgtttt catttcagag gcagttcttg gaaattgtag acaaagttgt agtcgaagac    125580
     atcttggtta tattcaagct tgatactcta tgtggtacaa catacaagaa gcttttggat    125640
     agatgcatag aaattatcgt gaagtctgat atagaactag ttagtcttga gaagtcttta    125700
     cctcaacaca ttttcaagca aatcatagac atccgcgaag cgctctgtct agagccacct    125760
     aaactagaaa ggcatgtcaa gaacatatac aaggcgctag actcagatga tgttgagctt    125820
     gtcaagatgc ttttgctaga aggacacacc aatctcgatg aggcgtatgc tcttcatttt    125880
     gctatcgctc actgcgctgt gaagaccgcg tatgatctcc tcgagcttga gcttgcggat    125940
     gttaacctta gaaatccgag gggatacact gtgcttcatg ttgctgcgat gcggaaggag    126000
     ccgaagttga taatatcttt gttaatgaaa ggggcaaata ttttagacac aacattggat    126060
     ggtagaaccg ctttagtgat tgtaaaacga ctcactaaag cggatgacta caaaactagt    126120
     acggaggacg gtacgccttc tctgaaaggc ggattatgca tagaggtact tgagcatgaa    126180
     caaaaactag aatatttgtc gcctatagag gcttcacttt ctcttccagt aactccagag    126240
     gagttgagga tgaggttgct ctattatgaa aaccgaggta tgctttcttc cttcacttga    126300
     atatcgaatt tcgggtagga aaatgagtgg aactaatgat aacgatggtc tatacttttc    126360
     agttgcactt gctcgacttc tctttccagt ggaaactgaa actgtacagg gtattgccaa    126420
     attggaggaa acatgcgagt ttacagcttc tagtctcgag cctgatcatc acattggtga    126480
     aaagcggaca tcactagacc taaatatggc gccgttccaa atccatgaga agcatttgag    126540
     tagactaaga gcactttgta aaaccggtat ggattgattc ttatatgtca tctcttttct    126600
     agccaacaaa gaaatgatgt ttagaacttt attttgttgt atcttcagtg gaactgggga    126660
     aacgctactt caaacgatgt tcgcttgatc actttatgga tactgaggac ttgaatcatc    126720
     ttgctagcgt agaagaagat actcctgaga aacggctaca aaagaagcaa aggtacatgg    126780
     aactacaaga gactctgatg aagaccttta gtgaggacaa ggaggaatgt ggaaagtctt    126840
     ccacaccgaa accaacctct gcggtgaggt ctaatagaaa actctctcac cggcgcctaa    126900
     aagtggacaa acgggatttt ttgaaacgac cttacgggaa cggggattaa ggaatgggaa    126960
     atcatattcc atttcactcc cacaactaaa aatgatgtat gtcctatatc atgatgtttc    127020
     gtgagtttca aataaattga aacgtacata tatcagtttt tcatctacgt gactgcgttg    127080
     tatagttttc gttcttcact tagcatcatg tgtattctag ctccaagtgc gtttcaaaca    127140
     aatatagtta tttttagcca attatatata cggttgtgat cagcttgttc actcaagaga    127200
     ttattttagt ggtgatcttt catttccttc taataaatga cgactttgtt cataaagttt    127260
     gagtgttaat gagaaaaagg cttcatgtgt tttaaaaatc taaatagcat aatgtatgtt    127320
     aaactcctac aattactttc gaggctggtc attccttcag aatatcatcg gaccattcct    127380
     ctgttcgacc acaaaaccga ataagacaaa actatatgag actctctaac tcagagagag    127440
     actctctaac tcagagattc tctaactcag agagagactc gacccatgtg acactcacgt    127500
     gacttttaaa ttcccttccc gtgaagtgat ccgtgaaccc cattcttcaa aacttaggac    127560
     agagacaaaa ccctttaacg ggttctaact atggtctatg gctgcaacta ccgacagccg    127620
     aatgcaagga gcatcaagta caactgattt tgaatctcag agagaaaaga cagtgtcact    127680
     tttctatttg acacttgtca attttctatt tgaaattaaa ttagggtttg gatagtactc    127740
     ctttcacact ggaatgaagt tttaacaaag attttccaca caaaaaaaaa gcattggtgg    127800
     ggaaccggtg acggagtacc ttcctgtgtc gggctttaac aaccaatatt ttttgcaaat    127860
     tagattgccc agccatctag gtcacacacc atcaaatgtc atgaatgata tattgtcgtg    127920
     aagctatgat tatctttagc ttatttactc tattatcttg tacgttcata caaccattca    127980
     tatataatct ttctcaaaga aaaaaaaaaa gataaaggag gcatgtcacc tgaaacatat    128040
     tggtcatagc ataatttgca ttgttagaaa acaataatcg tataacaact ctttctaaat    128100
     tgagatattt catacttacc cacactcttg aaaaatatat gtacgaaaaa tatcttcgtc    128160
     gaccgtgatt agacagctag tcatatctca aattattcct tttattagtt tcttgcttta    128220
     aacaaacttc atcataataa ctgaagaatt cttgtaatta tctactcacc agatattttt    128280
     tgagatgatt aatagcttca taatgtatat atgttgatat aagcacgttt catgagattg    128340
     agaaccgtcg ttgtcattag tggttcaata aatagtaaac tgatatcaac tccataccat    128400
     aagaagtaac agatagacca ataaatccag ttgacattaa caaatattac tgttcttaat    128460
     cagaacaatt tagtaattaa acaaacatta atattactag aatctgacga gagaagtatc    128520
     gatgaatgtt tttcttctgt cgcaattatc gatgaatgtt cgatttaaag aaaataatat    128580
     tattagaaat acttttttcc acgtaaaaac agcataaaaa ctacttttac catcgagtaa    128640
     aaacaaaaaa gtgcagtgga actcatacgt ccagatccag caattacgca cacgacacaa    128700
     actagttttg tcatccagtc atcaccaaat ctagaacaca aactagaaaa tacgtatcgt    128760
     aaatgaccta aacgccattc agattcaggg gtatttacca cgaaagtaca aattggaaag    128820
     cgagggaaag acgattccga caaagggtaa aagcgtaatc ttcacttaat cgttcttgag    128880
     catctctctg taccttagaa acgaatctag cctctgtagc ttaagctgtt gcttaaactt    128940
     gttgatgaaa tttgaagctt tatcgtcgac accttcttct cctccgtctc ctatcgacgt    129000
     cgttctctca actctcatcg tctccggcct tctcttctcc acggcctcaa ctgtctcctc    129060
     ctcttcccgg ccgatgtgtc tctcgctagc agatttcatc atcttctttg tagctttctt    129120
     cttcttcttc gtcgccggtt tactcgactc cgacttcgtc ctcgtatgtg tttgcacttc    129180
     tggtgttgga tctgggtcgg atctgtataa agaaggaagc tttatggatt tcacccgctg    129240
     caagagtgat ggagctccga atctaggttc ggtcgtgacg tcatcctccg ggatcttgtc    129300
     gatcgggtcg acccggttag tctcgtcggg ttgggtcatg agctcgtaag cagcgtaatc    129360
     tccttcagaa ttgtgttgtg ggaacttgaa gtaaggcatg ttgatggatt tgacccgttg    129420
     caagagagaa ggaggtgggt tcgggttagg atccgacccg gagtagtgga tctcggattc    129480
     tggtgaagga gaattgtaca gatggaagtt gatggacttt actctgtcta tgagcgaagg    129540
     aggtctgcca aaccgtgcct gattttggtc atgacccgac gacccgtaac catcttgatg    129600
     ttggttgtgt tttcttgaac aggaactgaa ccggttggtg atgaaaatgg tggcgatcgt    129660
     gaaattgagg aggaggaaga gagtcgtcgg agttaaccag ttggtcaagc ttgtgagtag    129720
     ctccattgtt gtttttgtgt gtcgtagagt gaagaatgaa gtagtggata atatttatat    129780
     tagagatatt ttttgtcttg gttaatcatt aatgaccctt gcgttagatt tgttgtatgg    129840
     gtctttgttt ttttttcata tggttttatt tatcaatttg tctttctata ttgattgttt    129900
     tctaacaaag tcagaaatta aacagtacat atgttttggt cttaacgtaa ttatcagtta    129960
     aatagtcctt gtagttgtgg ttttgtttag tatttgtgac ttgtgtagag aagatcatcc    130020
     atttgaaata gttacatcta tttctgacag gctacaaaac tcttacatta ttgacctcat    130080
     tgaaccaagg tttaaatctg tattttaacc ccgtgactct attgtctcat cggctcataa    130140
     tcatcttctt ccctgagccc acatttttct tttgataatc gtacagtttt ctaacatcac    130200
     attccttgag ctttttattc tatttcaaaa atagcttact tttacataaa tcattcatta    130260
     catttttttt ttctttctca ttccttgagc tttttattca tattgtcttt acacttttag    130320
     tttctctttt caaaggtttt caactttaaa tactacttgc atttgcaaag taaaattggc    130380
     taagtgattg tcatttaatt ttttaatgtg tcattttatt tgaattatat tatatatgtc    130440
     aatgaaaaac aggtgggaga aataaataaa taaaaagaca caaaagagga aaacacaaac    130500
     aaaaaagatt tagaaaagaa aagaaagtga agaaagtgaa ggaaaaaaaa gaaagcaaca    130560
     gagaaatttg tcttctacac atggatgcag ctcttcaagt ggaggagagg atcttcaatc    130620
     tctttaatct ttccacaaag tcaagttggg attaaagaaa ccacatcgtg atcaatcaac    130680
     ttgaagcatt acttagcttg tgtgggtggt caaacgatta aaataatatc acaactcgtt    130740
     ttgagtcgta tagtaaattt ataatatcac atttgtttga gtcgtttagt agctaatttt    130800
     tgaaatgaag atatcattaa cgacaaaagt tgctgactat gaaaatgcac aaagagacca    130860
     agaacactgc taataaatgt ccactaatga tatttctgaa agtgaccaag aatactttat    130920
     tgcccatcaa cgagattgtt agtactagta tcgtagataa gaacaataag tttctttatt    130980
     tagaatttcc ggaataagct tggagatgct attttcagaa ctcatttatg accatcttca    131040
     tgcaataaac cgtatcgtcg ttgtagtcca aagtcaaccg taaaacggta gctttccctt    131100
     ttatatgggc tttattgtag gaggtccaaa ggcccaatag atttctgata gtaaaaaaga    131160
     gagcaatgtg gtctcggagc attatcgttt ctctgactct gctggacatc agcgatgatt    131220
     ctggagttga gcttttggtc ttatctgctt caaggtactt cagctcagtg tttttctatt    131280
     gattttgtaa agtttcttat tgattttttc tatttgatta ttgaatattt ggtggagaca    131340
     atttatcgtg tcttatgatc tttaaatcaa ctactgtagt gtacttagaa ttagatatca    131400
     cagtgtttaa gcatttacaa aacttagaga tgaagttaga gcagacaatg aaaatggaat    131460
     tcaaaagctt tgttttttta ttagtctgta aaatacatta tacacttgta gacttgtagt    131520
     atatttatag gcaagataga gataattttc atctatatga gccaataatt cccagtttat    131580
     atgtacattt atatctgtat tctatcaatg acttgcagag agccttaaat ttgtcacaaa    131640
     gaaacagatt ttatcctgaa aaaaatggag tcagaaagct attatttggc tgttcttttt    131700
     acaagagaga tcccattggg ttcaccaccc cattcttcaa gtacaatgac aaggttatta    131760
     gttggcttca gccatgaacg aggcacatgg tacctgaaaa cgaagataaa gttcaaacct    131820
     ttgattcaaa tttggactca agaagaagaa gaatttaggc agttttactc accatctttg    131880
     tgaagcttct ccacagttac tcaaacattt cttctctgtg aaagtcccgg catagctgca    131940
     gcgttcgcat ttcccacgag ctgtatatgc tggccagtgg cgtccgatgt tctgcccatt    132000
     tatccacatt tgacctttcc ccattgtgtt catgtctaaa gccaatggtt cattgcctgt    132060
     tggtgagtca aaagtagact gcaaaaagag atggtgaaaa ttctgccctg tggatttcgg    132120
     ttttcattat attgatctaa ctttgttggt ggtcatgatt cattgattcc tctgtttctc    132180
     ttaccttgta ccaggtcaag ggctgctttt tagccactaa tgatccttct ttccattcta    132240
     ccgttgaact cccggctaag gtatgaacgc tcagagcttc acccttagta ccaatctgct    132300
     tgaaacacaa atgaacaaat gtttatttca ttgttaatga ttgttggtaa gcaaactcgt    132360
     ttctcttgaa tttcaggagg accttgtaag accatttcca tttagtcatg tcccatgttc    132420
     cggagttaac tccattcagt gtcactgggc caagaactcc agtattccaa gtctcataat    132480
     gcacgccaac gttctgtgag caatgaagga ccaggaagct tagaacgtaa tcagtgtatg    132540
     agaaaaaagc gcagagataa actgaggaga actaaccggc agacccgctg cagtactcaa    132600
     tagagcaagt ttgttgaccc ctgcatgtaa tttgatcttc tgactaaatg ttagctttgg    132660
     cttctccagt gatccatatg cagttcctga aacaaagaaa tgtttaacag aagacaaagg    132720
     caagctacca tgaggatgag tttggcctat cttaatgtta cctgcaagct ggccattaac    132780
     gaatacatga agagcatgcc cagctgaccc aatagtaaga agagggtctt caccagttag    132840
     gaacttttca tcaggactga ttgtaatact gatttatatc cacagacaaa accaaccgtg    132900
     agttctccct ttgagacagg aagatagata gtaaccaaaa tgttgtcaag aattttctag    132960
     tattactcac tctgtcagat accagaaata gtctgtcttg tctctggtga tacttatctg    133020
     ttccacaagc ccatcttgtg aaaaggtacc attgtcattt gcagaaggaa tctcttcgtt    133080
     gtatgaaccc caagagaatg gtgtgtttgt aggaaccatc ttcatgtgta tgcttgatgt    133140
     acggacctgt accttgtaac acagaggtca atttcagtga taccatcacc cttaacatat    133200
     caacaaggta atgtgtttga taagtttttt tctcaaagtt gatatacctt ggcagtgttg    133260
     taatactcag ttttgcagtc gggtagaata ctgacagacc aaggaggcag atcatatgta    133320
     gatccgccaa acaagactct tgcagcagaa cttgtgttgt agtttgagag aaaagcagcg    133380
     caagatgact tagacttgaa cacgtgagcc tgaaaaacaa aacatgccca cgaaaaggta    133440
     aataactttt tttggaagtt tttcttctct tctcatgtgt attgatatgc attgcatcca    133500
     ttacttcttg tttatccccg agtgatgtga ctgtaggatc agcagagacc aatgccggtt    133560
     cgcagagctt gatgacctta tgcagccttt tcaagtgact atacttaggt tctctcggta    133620
     acccttttga aaaataaacc aaaacaagta ttagatgatg gttcaatatc gttttgttac    133680
     cattgtgttt tgtaggtaat gagacttcaa attaccgtat tcatcaagag gagcatcata    133740
     gtcatagctg gtggcgatga attcaccggc tgttctgtcg aagttggttc ctccatggta    133800
     ctgtttaaca acatttcctc actccatgaa taatcaaatc tagtatttaa agtttcaact    133860
     atagagaagc tgaatgaagt taccatataa tagttgatga aagagccacc gttctgtatg    133920
     aagcgagcca cggataaggc aatgtcttcg gctggcctgt atggtactgc acctccaaac    133980
     tctgtaaacc tgataaatta tttgcagatt cacaaataaa aaagttattt cgtacaaaaa    134040
     taaaagatac attaaatttt tattttcttg gtcttaaaga tttgtattga atagtaatat    134100
     ttttggaagg gacaattgtg ttgtgtgact taccaaccag tccagttctc tgtccacatt    134160
     ttcggcttat tgtccgagtt tggtttgaaa ttctcacaat aaaacccatt acatgtgttt    134220
     atctgtcgac caaataaata aacaattaat tgtttttttt gtcatttgtt aaaaagaact    134280
     atataataat atgtattcca ttaaatttct ctttttgatc gataagtcca tgtaacggaa    134340
     acatgtgaga agaaggaaat caaattaact gaagtaacgt tatttcccac gttaggaagc    134400
     gtgatataaa cgtcaaattg taacaagaaa ataatgaagt ttttaccaat aaaaaataat    134460
     aatgaagaga actttaaatc aaagaggagt agaggacaca gaatattagt gactaaccta    134520
     ccaagaaaaa tatacgaaga aagatgattc gagctattag agaacacaaa cacaaaggag    134580
     attctataaa aaaattaaaa atgaattaac aaacatcttc ttttgcttaa agaaaacata    134640
     tattataatc gttaggtata ataaaaccaa ttaatagagt atatatatgt attattaaga    134700
     ggtaaaagta agagaagaca agaaaataaa caatacaaaa tgaaaaaaaa aagtatacta    134760
     caaaactttt cttttccttt tgtatcatta agaaaaaaag atttacgaga gaacacaata    134820
     acatatttta agtacaaaat aaaaccccaa aaaaataata aacaaaacta cttcttttgc    134880
     ttaaagaaaa tataagcaga aagcaaatat gtaataacta aagagagaaa aaaggaagaa    134940
     gaacatacaa tagagttagg agcatcatct tgcttgcaca taatccatgg gacaccagtg    135000
     gagagtcctt gtgccatttc agctacccat tttgtgtatg ccttccctgg tgctcctatc    135060
     tcccactcta ttggtccata ctcattctct atctgcccat ttaaaacata caatgtaaat    135120
     atcatctttt tttctttcaa aaacaaagat tcatttggat atacactact gacattatgt    135180
     actaactaat acgaaaacaa acaaacctgt gacagaatga tgggtcctcc ttgagtctca    135240
     aataattttt cttctttcat catcctcaca atcttctcag tgaatttttg cattgcagcc    135300
     ttttcattat cacatcaatt ttttgttagt tatcccaaaa aatggaaact ttataacata    135360
     tgagaagaaa gttagataag ttttatacct tgaaaggttc attgtcggtc ctaaatacca    135420
     taccgggaac atatttgagc cacacaggaa accctctgca aaccattaat ttaaacatat    135480
     ttcaatgaat aattatatca aaaagaaaga gattcaacaa atttaatctg tattaattag    135540
     accatatagt ttacccaaag ttccattcag cgcaaacata gggaccaatc ctgagatgaa    135600
     cgtaaagacc agcttgttgt accaccttga tgaacttaac tagatcatat ctgtcctcaa    135660
     aataatacta aagcagaaat aaaagttata gaattagtta aagaattcaa agttatagaa    135720
     ttagttaaag aatcaaaagt tatagctttg acttacttgt ccaggagaag gttcatgccc    135780
     attccagaaa acataagtct gtataacatc caaccctcca tctttggctt tttgtataag    135840
     gtcaggccac atctatatat aaaacatagc attcaggaga tatttttata aatactttat    135900
     cttatacaaa gaaggaattt gtaatgaaat agtgtagact ataagcaaaa ccaagaaaac    135960
     tccatgtgca gaaaaacttt ggaaacaaag atccaataat aacgcagaaa atatgcatag    136020
     aattaaagaa gaaaaaatgc atgaagattc tgcttaacca caaataaaag agatttaatt    136080
     gttttctatg tattgaagaa attgaagaat acctcaggtg tgcttcttgg gtagtgaatg    136140
     gagccagaga gaaggatcct tctctgacca ttgatgatca cagctttacg atcgtaagtg    136200
     acaattgctt taactgaaca aatcaaagat gaacaacaaa gaatccccag aagtatccat    136260
     gccttttccc tgaaatttaa ccccatcttt ttccttattt gcaaaccttt ggatgttttt    136320
     tttttctttg gtgtgtgtgg agaaaagaag attccaccga aaatgttatg tattgggtat    136380
     tattgggttt ggagttatga ggttcttgaa gctatttata gattaaggtt gacacacatg    136440
     tcatctcatt attatactat cttaaggagt attagagtac ttgcaccaaa atgagaacat    136500
     ttgggagagt aattaagaat ataatcatgg ataaataaca atttataatt ctcctattgc    136560
     caataatgat tttgaattat ggaagtatta tttttgtctc attgtcattt acaaatttta    136620
     atcggaagtt agtgggaccc agtttacttc atttgggcgg gtgactttaa acccttggct    136680
     tggtaccttg ccagttacca gttgagtaat ttgcaatttt cctatttctt taagatccat    136740
     tttcccattt tctaattttt tttttcttgt tgagtagtta aataaccaaa cacacttaga    136800
     tatgaaatct atcaaatttc attaaaaaaa tccaaattaa atatttgtct ctaacatgtc    136860
     tgtttggttt caagattgag tattacatca tatttagaga gatgtaaaat taaagtatgt    136920
     agattttcaa catactgatt tcatattatg agatttatgt taacttatat gttaaaacat    136980
     actgtatcta ttattcttga acatttaata gaccataatg aatctttgaa aatggaatat    137040
     attggaagtt gtgtggtccg tgactctaag tagacaacat gtagaacacc atagtaaaag    137100
     tcgatcgtgc aatgcatatt tattgatgac aaactatata tattttctta tatgaatgta    137160
     aattatgtta ataaattaaa ttttaggcaa actttaagaa atgttgcatt gtttgtttga    137220
     ctgttaaatg ttaaatattt aactcgttag gatattggat taatcaaatg taggcctcgt    137280
     gaactatagt aggatattgt gttaatctat aattcaataa ttgaagtgat gaaatgaggt    137340
     ttagttgaca cattggttcg ttgataaagt caagttgccg catcttatga cttaacttcg    137400
     ttgactacaa agctttacct tcgacgccca ctaaccattc aaagaatgcc acctggctct    137460
     attaaccaaa tcttactaac acccccctat ccaatccccc aacgttcacc aactaaccat    137520
     tgtgacagat ataataatac cgtgtacact tactttgttc ataaaaaact atacatgtat    137580
     tttgaaaaac aaaacaaatc gcatgttaaa gtgaagagtt cgaaaagaaa aatcaaataa    137640
     gttggaaatt cttttatcat aaacctagat tactgttatg aaattgcaat tggaacggga    137700
     gaaatatcac cttattatag cgtatcaaag tagttaggag catacgaaac cttggatttt    137760
     cacaatacaa aaacaaacaa attggtttct aatgcttaat ttgacgtctc ctacgtttcg    137820
     cgttctgtat gaaaagacag aggaaaggag gtcattgaac aaatctaaaa tgaaataaca    137880
     atgctctaac taatcataag ttattctgct ggacaagtga aaagagagaa gttttgtgtt    137940
     ggtatagtgt gtcacactat caacattgtt gtaaattaaa acttggttag gtgctcgaaa    138000
     aacgaattta atctagttaa aagtaacttc tgtcttaaca ttaaaaccaa aaaaaaagaa    138060
     aaagtaaatt ctaaagacaa aatatattgt cccatactcc catttccacc tttatctttt    138120
     gtttcttctc ttaatgggag aaaaaatggg aaaattatat gtttcaattc gaacaaacag    138180
     atgccctttt aaaagcccag tttttttcag cccaataaca aaataatggg atagaagcaa    138240
     acatggacca aaccagatca ttaaccaaac cgaaccaaac ctggataaaa ttcggctgtt    138300
     ctaaaccgtt ttcctttgta gacaacaaga tagcgacggc gacgcattta ttcttcagag    138360
     attatcttct agggtttcta gggtttgggt ttgggtttgg ggacgtatat gcttgaccac    138420
     cacataatta atatatatct atatatgcgt acgttgaaga ttagtctgga ctatatagct    138480
     aagaaaatct tagaaaatcc gatctaatga atgaaaagta tatttgtgat aatgatgcat    138540
     gtaaagatta gatgataata tcgaagaaaa agaaagttca catcacacag atcaatatat    138600
     gtcacaagac agattgatac ggtggtgaag atcagagagg taatggtccc ttttgggaaa    138660
     ttttattata tagaagaaac caaaacaaga gacaagtcat gaaaagtacc aaaatgttgg    138720
     acataacccc aatttcactg acattcacat atatagatat acatacagtc tcatatgtat    138780
     gtctaaatat gtgtcttgtt cctctcaaag tgtcactagg gtgagagaat ttgtgatccc    138840
     tatgccgcat acgtatccca tctctctatc gtttattttt ctcatgccac ttctgttttt    138900
     ttcctaaata catatctatc tgatcggatt cttacttcat ttattgtgat tcagattctg    138960
     ttctttgtgt atgtttccct cttgccctta gcattgtttc aatgggtgct actagggctt    139020
     atagtagttg atggataccc gctgaaacgg accgcgcgcg agttaaataa agtattaagt    139080
     ttttttcctc ttctgaaaat tacatatgtt acctttactt ggtccataat catacatctt    139140
     tgatcttaca ataggcagct tttatgttca attatatatg agagtttgta agaaaagaca    139200
     tccaaaccaa ttcgcatggt cccttacttg gttctgtcaa aagaaaggtc tagagcctac    139260
     gtttttgtat gtttgaactt cttttggtat acttctatgt agcttaatgt ttggttattt    139320
     tctaaccatt ttgttaaaaa gtaaaaaata ttagttttgg ttataaaaat ttgaacatgt    139380
     ggtggggcta cgtacgtatt agctgcgata attggatgta tgtgcataaa gcaagttgta    139440
     gctaaggaac tttcaaaggt gatagatcct cccttttttc ttttgtttgt ttttgatccg    139500
     tgtattgatt tttagggttt ttttatatat ataaattcgt catgggatca taattcacat    139560
     tgtaaaacag taaagatgtt gtctaactca tctattaagc cctgatcaat ctatataatg    139620
     ttattcttcg tttggatcaa acctcatcca ccttcaccaa actttacttg aatcttgatg    139680
     ctcattaagc aagctttaat ttataaagtt ttaaaatagt agagttacga atttgcggtg    139740
     aatcctaagt aataatcaat cattaagtct catttgcaca caaaattaaa cttcaaaagc    139800
     acattgaaac tatataactt tttaaaacat ttagtagcta aactcatgaa agtgaaaatg    139860
     tagaaatgta gaaatacaac atatatataa actaaaaaat gtatgtgggg ggtcctgagt    139920
     gacctgtaaa acttgatcag aaggaattga atggttttgg cgaatactaa ggtggggatg    139980
     ttttcttcct ttgccattct aaacctatca cttgtcttct ctccctctct tccgctcaat    140040
     tatgattccc ctctgtccag gactgctctc tctctctctc tctaagaatg attattgatg    140100
     aatcacatgc gatagaaaga tcaagtgtta tgatacttat atagttatat tatatataat    140160
     actataattt gtgtgtggtc ttttaacata tgattgatat acagtgtatg caatagttaa    140220
     tcactaaact ttaattttaa tagaaaaatg accgatcaac ctcactgatc ctgttttgaa    140280
     ggttcctgca tgtttttatt ttttatttgt tgggtattta tcgaacagtc ttctaccttt    140340
     gcaatgatta accaataaga caacgactga tcaatgacga tagtgaatga attcacgatg    140400
     gagttttgtt acgtgatcaa ttaaacagat cttgaattca aattacgtag ctttatcttt    140460
     ttaagaaagt aaaatcatga catttaggat agagaattgc taaaattgat acaacaaccg    140520
     tactgaaaag ttatatcaga tcatccagag gagccggttg caacgcatca tttgatcatt    140580
     atcatgatat gtgtggctct tgttcaagta attactatta ttatctactt gttatttgtt    140640
     atatggttga gtttctctct tttatagggt aacgaaatat tacagatagg attacttgtg    140700
     ttttggggtc gtccactacc attcctacac tcattttgtc tcatgtgttt gttttcagat    140760
     gtactcacgt gaacctctta atttattact tttggtttgt gttttcctcc acagtttgac    140820
     aagggcgata aatatttttt attcacaaaa taactataga taagttttag atctcagccg    140880
     ttgtagttcg aattaagcaa atttaaccag cagtgcacta gtagttcaat cggttatcta    140940
     aactttagta tagatctcag ctgtctataa tctatccgtt accattatct cttacaatct    141000
     ctaacgatat cattttttac tagcaccaat attcagacag ttgattgctc ttcatcagtc    141060
     tctaaacatg gccatataat ccttgcgtaa gtttatataa cactggtctc tgccctaaat    141120
     tttcgaggga tccattttcc taaaaaagat ttaattgtat agatttttgt tagtgagcaa    141180
     gacacttgtt aataatgcta tgtactacat atatatgtat ctttcaccaa atcagttttt    141240
     caaatttata aacataaaaa gtaagaattg aacccccaaa aaaatacaag aagtaaatat    141300
     aactaaactt ctattcttct tttttttttc ttttttgttg aagaaatggt atttgtattt    141360
     cttaatttgt ttttcttttt gcttaataac ttctttttta tacattagat ttttgatatt    141420
     gtatatatac atcaaacaag ttaaataatg gttttatcca tattttctaa attctcctaa    141480
     ttaactctac tagagttaat atgtgtgtat atagtcacac atatacacaa acatttgttt    141540
     ctgctcgtgg tctatatatt gccttttaaa agggtcaaac atagtatagc ttggatcctt    141600
     ctttacttgt ccctgatctc tcctaatctc tcgtcttccc tctcttttgt gcttcatcga    141660
     tctctatcgg tcatgggttc caattttcat tacacaatag atctcaatga agatcaaaac    141720
     catcagcctt ttttcgcttc tcttggatcc tctcttcatc atcatctaca acaacaacaa    141780
     caacaacaac aacattttca tcaccaagct tcttctaatc cctcttcttt gatgtcaccg    141840
     tctctttcct actttccttt cttgataaac tctcgccaag atcaagtata tgttgggtac    141900
     aacaataaca cttttcatga tgttcttgat acccatatct cccaacctct cgaggtataa    141960
     tttcaaatga atttcatgtc aatatattaa ctcttgatcc ttatatatat ggtttatatt    142020
     catatggaaa tttcagacca agaactttgt atctgatggt ggttcatcat caagtgatca    142080
     aatggtgccc aagaaggaga cacgactaaa attgacgata aagaagaaag ataatcatca    142140
     agaccaaacc gatcttcctc aatccccaat aaaagacatg acaggaacta actcgctcaa    142200
     gtggatatct tcgaaggtga gattaatgaa gaagaaaaag gcgattatta ccaccagcga    142260
     cagcagcaaa caacacacta ataacgacca atcctcaaac ctaagcaatt cggaaagaca    142320
     gaatggttat aacaacgatt gcgtgattag gatttgctcc gattgtaaca caaccaagac    142380
     tcctctttgg agaagtggtc cgagaggtcc caaggtatta atcacacgtc tgttaattac    142440
     acatatatgc gtaagctttt ttttggtttt aatgttaaaa gtagatgcct aagtaatgtc    142500
     atatatactc atattgatta ttagaagctc acgaagaata tgtcttttta tagtactaat    142560
     taatagcaaa tgaaaagtaa atctacaaat ctctaactgg taaaaacaat ttcatgtagc    142620
     attataagtt ggtttaaaca gattaatctt tgagatcttc taaaattcat gttacaagat    142680
     aattaactaa attatcatgt tttttcttgt tttgttatta cagtctcttt gtaacgcttg    142740
     tggaataagg caaaggaagg ccaggcgggc cgctatggcc acggcaaccg caaccgcagt    142800
     ctctggcgta tccccaccgg tcatgaagaa gaagatgcaa aacaagaaca agatatcaaa    142860
     tggagtttat aaaatcttat ctcctttgcc cctaaaggta aacacgtgta agagaatgat    142920
     cacactagag gagaccgcat tagccgagga tttggagacc cagagcaact ccacgatgtt    142980
     atcatcttca gacaatatct atttcgatga tctagcatta ctgttgagca aaagttcagc    143040
     ttatcagcaa gttttccctc aagatgagaa ggaggctgcc attttactaa tggctctatc    143100
     gcacggaatg gttcacgggt gattatttta agtattttaa ttataactcg catgcttaag    143160
     aaataaaata taaaccatac cataagccct catagctagt aatatctaga ttatttgata    143220
     catgaaattt tgttgcggtg atatattaat ttcagtcagt ccaactttat tataagagag    143280
     tgttggggtt tagtagattt tgtatgaaag gcttgtattt tattttttat ggaacttgat    143340
     atcccaacaa tgtggttgtt cttgttcatt cgcatgtttt ttgtgtttct aagttttgag    143400
     agttgatata agaattactt taatttgtca agatctcgtc aagtgtttat acttgatgaa    143460
     aatcttttgg ggatcaaaac ggtttgaagt aaagatcgta ctgtcgtact ggtgtctgta    143520
     gattgatatt aaactcgaac aacatgatta ttgtaatata ccttaactac catataattt    143580
     ttttcaattc tttctggata caattgtaag aaaacagaaa aatcggaaaa atgagaaaat    143640
     tcaccaaaac taatggggtt gttttgaaat tagtttgata cttgaggatt gacaaacgaa    143700
     ttctactttt ccggggaaag aattagagag cgaaacagaa caaaacaaac aaaaagtcat    143760
     gtctccgacg acgacatcgt tacgatccct aagcttctcg ctttacgctt cttctaattc    143820
     tactccgatt tctacaccaa ttgaggcccg acagttactg agttcatgca atagattcta    143880
     cggtctgtcc tcttcgagct cttcttcctc ccttactact tcatctttga tcggaaatct    143940
     tgttttctca tcaaggaatc agtctctctc cgtaaaggta tacaatttcg taaatttttg    144000
     tgatggattt caactttacg gcctaaattc gagaacccat gttccactta ttgagaaatc    144060
     tgcttaattc ttatgtcact tgtagtcgat tgggaaatta gggatttcta tatgtgccat    144120
     tgattgtgat tactctttat gtggtctttt tggtccattt gaagatgttt taagttaggt    144180
     ctctcagcca catagacgat tacattagtc ctgtgtttaa gttcacactg tcttactttg    144240
     attgaagcta ggttgcgtta agggctttta aataacatct aactttatga gtgtttggtg    144300
     ttgtcagtgt ggctacatat tgatgaaatg tatgtgtgtt ttgggatagg tccaagcgtt    144360
     agctgctgaa accgaacagc caaaatggtg ggagaggaaa gcagggccaa acatgattga    144420
     cattacctca gctgagcagt ttctcaacgc gttaaaagat gcgggagata gattagttat    144480
     cgtagatttt tacggaactt ggtgtggttc ttgccgtgca atgttcccaa aggtaacttt    144540
     cccgttagct acttaacgat tgtatctctt cgtgtatact cgatcatctc tcatttcatt    144600
     cagttcgcga gtcttgaacc attatgtttc ttaagcttgc tcaaattatc ggcttgctta    144660
     ttctaaagct gagactcttt tcttattctt ttccagctct gcaaaacggc gaaagaacac    144720
     cctaacatct tgttccttaa agtaaacttt gacgagaaca agtctctctg caaaagctta    144780
     aacgtcaagg tgttaccgta tttccacttc taccgcggtg ctgatggcca agtcgaatcc    144840
     ttctcatgct ctcttgccaa ggttagttct tcttgtccca gctttcttta atttcaaacg    144900
     tcacttgtct atcacgaaac cagagaatag ttactgcatt gtatagtctt gatggcgacc    144960
     tctaagtcta ataagcgtct gcaaacattt atgcagttcc agaaactgag agaggcgata    145020
     gagagacaca atgtaggaag tatcagtaac atctcttctt cagcttctga gaaagttgaa    145080
     gattcaagtg aataatcaat gcctggttca gattgatcac agattatttt gttaaatcgc    145140
     ttccctgtat atatgttgac tgcattttcc atgtggtgca tcataatttt tgtacataaa    145200
     taaatgagtc tgacttcgag ttcatcgcct atcaagtatc agcttcccta aaccgagtaa    145260
     aaccgggaag tgttgggttt caaaattaac ttggtgagtt aacagttaac acacacatcc    145320
     accgttttta gatagataag aggatgccct aataaaacca ctgctttgtc ttgggtaaga    145380
     agaaacgtta acatgttagt tgtcctacaa attcattcat ctataaacgt taaagtctgt    145440
     attaacgaat gaaagtaatc aaaagctaca tatttattac acaaacaaaa atgcatcagt    145500
     tgcatctcgt ctaagaaagc attttttctt cactcgaaga aaaataacaa gaagttgaag    145560
     ccttaggctc acgagccaac tcctttaaca tgtcgagttt ctaatccgag taaaggattt    145620
     gtatttcgtc gagaaagttg ccgcttcttc aaatgtttgg catttgttaa gttgcaactt    145680
     gtctctcttc ttcacgttgt ccattgtatc cttcccactg gaatctttgt aggtggaata    145740
     acaaacaagg aggaacagaa atcggtttgc taattggcgg gttaatagtt ttgtaaaatg    145800
     gtagattaaa catgcgctct atcctgtaac atttctgagc ttgagaactt gtagttgagg    145860
     agaattcagt agcaaattcg ttagtagctt ccaccgctcg tttttcctag tattgtagct    145920
     ccaaatgtac atcattaata gatcatataa aagaaaatta taatttcaaa aaaggctcaa    145980
     gttgaagtat ccaacggtgg tcaatttaag actataccaa cgcctgtact tcaaaagttt    146040
     ctgcaagtat tcattagcag tgacgaattc aaatttgaaa aaaaaaactt ttatctgtaa    146100
     attctccatc cttaacggtc aaatttagtc gggcagcaga caaactctca agtccgatca    146160
     ggaaacgaaa cgagaacaaa agaaaagaga ttggattttg gtgacggcgt ttccttcgcc    146220
     gtcgtgttca ccatgttcaa gagagacgac tacattcgaa ctaatcatga cccctttttt    146280
     tcaaagtggc aggtactctc gcatttcaag aaatttagag attctgggtt tagggttttg    146340
     ctccatcttt cattccgttg aaaacccttt cgagatcaac agaatttcga atgaattctc    146400
     ttggaaatat ctgcaatttt tatttaaaga tctaactttt aacgcctacc acacttttct    146460
     tcaacgtttc tttgttggat ctctggagat tctgagtaat tccattgatg attcttgggt    146520
     ttctttcagg gtttcgcccg atctatgttt ctgcgtaaac ccatttcaga aactgcagaa    146580
     ttcgcaagac ttttgcggac tactccttaa tttctcgaga tttaggtcca aagccaaagg    146640
     tcacattttt aatctctctt catcacattg taacttgtat ctttgttgga taactaggtg    146700
     gcttagtctc atgtttgtca tcaatataag ctctttatct tacgtaatga agttggaaaa    146760
     cacacatttt taaatgtcaa acttattaca cttgaaaaca gattctgata ggagccaacg    146820
     agaaggaaaa tttcagagaa gggaaagatc ttgttggtag aaacagagtc caaggagcct    146880
     tccagggtct gtatgagctc agtcatgacc atggcagaaa agatgatgtt cttgtggcta    146940
     atcttggtca acctgaaagc attagatccc ggctccggtc ttatagtaga tcttttgctc    147000
     atcatgactt gcttaagcag ggtttgtctc aaactattct tcctactact cagaacaaaa    147060
     gtgacaacca aaccgaagag aagaagtctg attctgaaga agagagagag gtcagttctg    147120
     atgctgctga gaaggagagt aattcgcttc catctatact tagactcagt cggtctagac    147180
     ctcaaccggt ttcagagaaa catgatgaca tagttgatga gtctgattct gcttctgctt    147240
     gtggagtctt actagaagat ggtactactt gcactacaac tccagtcaaa ggaagaaaga    147300
     gatgcacaga gcataaaggg aagagacttt ctcgtgtttc ccccgggatc cacataccgt    147360
     gtgaagttcc taccgtaaga gaatgtgaag aaactgagaa tatatgtgga gtgattttac    147420
     ctgacatgat acgttgcaga agtaaacctg tttcaaggag aaaacgatgc gaggatcaca    147480
     agggaatgag agttaacgcc ttcttttttc tgctgaaccc aacagaacgt gataaagccg    147540
     tcaatgagga caaatccaaa cctgagacaa gtacaggcat gaaccaagag ggttcgggtc    147600
     ttttatgtga agctacaaca aagaatggat tgccttgtac aagaagtgct cctgagggca    147660
     gcaaaagatg ttggcagcac aaagataaaa cattgaacca cggatcatct gaaaatgttc    147720
     agtcagcaac tgcaagtcaa gtaatttgtg gctttaagct gtacaatgga tcagtatgcg    147780
     agaaatctcc agtgaaagga aggaagagat gtgaggagca caaggggatg agaatcacat    147840
     cttgaattca aagcagtgga gtataactcc ttttgtaact acctaaccaa aatgttatgt    147900
     atcgagccgg tttggtattg gtaaaatctg ttgatttgcc gtatcatacc tttaactcta    147960
     gataataagg ttgtatgaat taactaagta ggtgcaattt aatcgaaccg aatatgcatt    148020
     tctgtaagaa gcagcttcga tgttctccat caatgtcttg tctctgtaat aaattttgtt    148080
     gctatctgcc ataatgtaga aaacaagctc actactcgta tgtgtagttg ttcagcctat    148140
     caacttctgt cttctttctc atcaactttc aacattgata cacatttgtt ttaagtaagc    148200
     atcactctag aacttaatgg acctccttct tgttttttgc cacatctgct tttgtctact    148260
     agttctgttg tgttgccttt gacacttgaa aatcatctgc agaaccattc taagtcatag    148320
     caatctgagg ggtcctgtta ctttaaggtc ctgaacagaa atagtatgat gtgtatgcat    148380
     tgtttcaacc tgcaagatag aactgggaaa atttcttctg caatttgtct ttttgagtta    148440
     agaaaccgat gagcatgata aatattttga aatcctgaga atcaacaatc tgtgtctcag    148500
     tatttcgtaa ggtaagatac attggaaagt attcaacaaa aacgtataag caattatgtg    148560
     tttacataga gaggtcctag agttttcaat tgggattctg acactgttta tatggaggag    148620
     tgttagcttc agtttcctct accaaaaaat ggaatgtaca atctagtata ataatatgtg    148680
     gttttaaaca ccacaaagaa tcagatcata tggttgatct tagtattagg tgaaaacttt    148740
     cctttttcgt gtcgtcacag cttctgcctc aggttcctct cgaggcggga ctcttaagtg    148800
     cagcttcata atatcataca ctgtgaatcc gattgccaca gacggtacaa cctaaagaaa    148860
     cccgaaagga aaagtgtttg taacttggtt gttcattgtc cgaaaacaaa gatagatcga    148920
     tgaaactagt ctcaaacctt aaggtaattg atgctaagcc ctgagaagag ttgcttccaa    148980
     ccttcttctc ttgcaatctt gaaaagggtt tgcattgttc ctcttcttgt ttcttcctta    149040
     acggctgaat atagtctctc aacctgcagg gagtttcggt tataatacta ctcaggatca    149100
     ttttatgaag attcaaggat gtcttcgatt cgatagaaga agaaccagat caaacctgca    149160
     tttgtctccg gacaacatcg agagggtatg ttaaagtctg accaagcaat ccagcgactg    149220
     acccacaaac gagtttcagg gaaatgtctt gcttatgttc cggagggaca tgacgtttca    149280
     tctcctcgta gaagtagaac ttcaaaccag cataagggaa gatcccatag agagaaggag    149340
     ctgatacaca agcaaccaaa gaaagatcaa ttttttattg agtcttagag aaggagaaga    149400
     tctataacaa atccaaagaa atggttagta atgtacctac accacgatat aggcctcggg    149460
     ctccagattc tctgtatgtc ctcgagaaac aatctacaat tcctctgtat atgatttgtt    149520
     ccacgggaat agcttttact tgcgtctttg ctgaaccaac aacctgcact gctgaactct    149580
     ctatgagcct actaattatg tattatctcg agatgagaca taaaaacaca agatctgaag    149640
     cagcttacct gataagcgag cttagtccgg accaggtcaa gaggataggt gaagagaacc    149700
     gcagtaccac cagcaaatga tccagctacg agatcaagca atgggcctcg agtagtgtct    149760
     gggaaaccaa agataatcca tctcctgtat tcctcataag ccatgtaatg aagagctgca    149820
     tagggaacta tccgagcaac acttgcacca ttccctctgt tcacaaacca aaacgaaagt    149880
     tacagaatca tctgactgaa ctagatccca aaacgcatct aacactaaag acaaacgtac    149940
     ctgtagaaac ccatcaaacc ttcagttttg ccaatcttgt tgattgatcc aacaagtcct    150000
     atccttttaa actcatccct tctggtctga caaaagatca atacatgatc atgagcttct    150060
     ataatccagc aattgtgtaa ccaattcaga atacaaacac taaaagcttt ctaatttcga    150120
     tgcttgaatt tgagtacatg actcagagtc agaggacaaa tcaatcttag ttctggtaat    150180
     ctagaatcaa tacccataat gattgttggt acctggaaaa gaatcttaat tcgctcgagt    150240
     ggagcaacgg cggttttagc tataccaccc gtgacgccgc cggcaataag ctccttagcg    150300
     aataaaggaa tcgaatcaat aattccgttc ttctcttcac cctccgccat ggaaatagaa    150360
     gtggagagag aaaagataga tacggtttaa tggatcttct tcttctcctt ttaccaatct    150420
     ttgtacagtt gaagctgaag ctcaatgaag gaagaagaag aagaagatat taaaattgag    150480
     agagcgaaaa aacgaattgt tcttttgtga tcaatcaaaa gacttggttt ctgtctgatt    150540
     ctcaccttct cctccaagtt atgcaaatat tattctccat taattagtgg aagttaatta    150600
     attagtatga ttttaatttt aatttctgct ttcgctttat tttatttgtc ttgaagattc    150660
     gaagttaggt tcctttttaa atgtgacgat tagactctga attgataatg tatttttgaa    150720
     cgagtaaaca atcaacgaca aattacaaat ctgaatctaa aaatgtatcg acgctggtct    150780
     cttcgaaaca cgagatacaa tatcaattaa gatgtaaagt gagctgaatt acacttccaa    150840
     caggaacttc atctgtgtgt gcatcaacac ttgcttgttg tgagctctag agagtcgaca    150900
     gcatttacat aacagtaaaa actcctgttg aggaattact tatgtgcttc gacggcctta    150960
     gagtaaaact cccatgactc gtgtgtctca gttatggcag tttgaccgaa tggattctcc    151020
     gctacaaact tctgaacgtt ctccgcatcc gctaatcttt ctagatactt ccttagctca    151080
     ccctcaggcc ctgtctcaag aaataaaaca tcagtgtgct attatgctta ccattttatt    151140
     gaaagagaat gatgagtgat ttaagactaa cccaatgcag aatcttgacg gtttgtgtac    151200
     tggtacgggc tagggaagat tccagtgtgt ggctaaaaga gaggaagagc aataccaacg    151260
     gatgttgagg ttaaaagtga cacattcaat gcataagcct attcaaaggt gctcgagtac    151320
     acttacagga ttacacaagg ccttgtcggg tgaatcgtca actagcaaag tgtttgtctc    151380
     atcatacttt cgctttccac aactgatgca tgtcccaata tggtcccata ctcttcgtag    151440
     gtccttgagg aacaaaggtt tatccttctt ctcctgagtt ttaaacttcg ttgtagtgca    151500
     tatattctga tcctgtgtcc ataagattca ttagctagct ggtttttgga ccaactatta    151560
     gaatgagttc tgctcatacg taagctacat atctcatagt caaagaaatg caaagttcac    151620
     aaagattgta gactgtgttt ctacaatctc aatctcaact gcatttctca taatacagtc    151680
     cttctcatat aggaactgca tttctcataa tctactctca aagtcaagaa aatagctcat    151740
     agaggttgca gggatcactt acaaaacaga acaacagatt cctcgcatgg tttttcatga    151800
     caatgttgat catataatcc aacccactag taagagaaaa aggagagaca gagttaattg    151860
     aggaattaaa cttcgtatat gtataagaca cctaactaag aagagtcaaa gacaatgcat    151920
     tttgggtttt gaatcagttc aagaagctca cacacgtctg gaagaccata tcgcaacatc    151980
     aaatctctca aagcaaaagt cgagaaaact aggaagaaaa ggcctcctga agactataaa    152040
     aggacaaaga aattactctg cagtaaaaga aacataaaac aacttacaag tagcgacgtt    152100
     gaaattgatt ctttcttacc tgatctgtat gatactttac catctggaag aaatgtacct    152160
     gtaaaaccct gaacaatatc tgcaaggatt ccatttaaat caaatataac caactttctg    152220
     gtacgttgag ctttacatgt gcatctaggt acatctccag tttctgatga aataactcct    152280
     tgagctacgt tatcattttg tattaagaca gaacttgaca atgacgtttc aagcttttcc    152340
     ctgtcaaatt ctggttcttc atctttccta ggtaatgaaa catcatcctt cccctccata    152400
     tcatcagttt tatgatctaa agaatttttt ttcctcttgc tcttctttgt tttgacctca    152460
     accttgctaa caccttctgc tcccaaatca ttctgatcaa cttcttcctt tttttcattt    152520
     ttctttatac tatcctcctc catattgtca gttttatgat ctaacaaatt tttcttcttc    152580
     ttgcttttct ttgttgtcac ctcaaccgta ctaacacctt ctgctccctt ggcatcctga    152640
     tcaacttctc cctttctatc ctttttcctt tttttggtat ttttatcatc ttgaacgctt    152700
     tcccccttag ttgcagaatc ttcaatgtta ctagccaaat ccttactggc aatctcccca    152760
     tcagcattcc cttcataatt tttcacacct tctccattcg attgatacaa caaagactgt    152820
     actgactcac tatccatggt ggcaactgat tcgcagtttg ttttgttttt tatcttcctc    152880
     ttctctcttt tgtgaccatc atcactaaca ccttctgcgt cgagtgcatc ctgattagat    152940
     tcaatatttt tatcttttgt catttcttta cgttttccag atttctgaac tccacttttc    153000
     tctctcgttg cagatttttc aattttaatt gtcatatcct ctcccccgaa ctcttgtcca    153060
     gcattcccat caaaattttg catgtctttt tcgtttgact gattcaacaa acactctact    153120
     gatcctgatg gctcaaagac ctccatatct gcagatgaag ttttcttctt ctttcccttc    153180
     cgttttttgc tccttacatc acatacacct gctccaagaa cgtcctcttt aacttcagtg    153240
     ttttcatctg tttccttctc tttagttttt ccgagattct gaataccgtt ttcctcccca    153300
     tttacataat tttccgtctg acttgccgaa taactaatta actctcggcc accattccca    153360
     tcattatttt ccacacgctc tactggcccg cttttcatgg aggtagacaa agtatttcct    153420
     aatgggtcac acacctctat tgtttcggtc tttctcttct ttcttctctt ggctttagga    153480
     tcctgagttt gggccacagt ttcactgatg ttgacatctg tgcactcttt ttgttccact    153540
     gtatcatcct tggatttcag acaactactt atcacaacac tagcaacaga tttttcctct    153600
     ttagtcgtcg attttgatcc ttcagcttca gaaatagtat cgtatttaac ttcacgaacg    153660
     tcctctttaa cttcagtgtt tccatctttt tccttattcc catcattatt ttccacacac    153720
     tctactggcc cgctttccgt ggaggtcggc agagtatttc ctaatggatc acaggcctcc    153780
     attgttttgg tttttttctt cttccttttc ttggctttag tactctgagt ttggaagaca    153840
     gtttcattga tttgaacatc tgtgccatct agttgttcca ctgtatcaac cttggatttc    153900
     agacaaccat ttatcaaaac actagcaacg gagttttcct ctatactcat cgatcttgat    153960
     ccttcagctt cagtagtagt attgtcagtt acagcaacct ctgcattggt gctaccaata    154020
     tcaacaccac tttctttcag tacatttcta tccctccttt tgtttctctt tcttttcgag    154080
     gaactagtca tattagtagc atctggcagt gaatctttgc aggttgacag atttgggtct    154140
     gtacaaattt gtgccgctcc aggcttctca catgaatcct gagttagttc acctgacctt    154200
     tcttgtacca taccgtttga caaaggattg ttgggtggat gcacttggtc ttcgctggtg    154260
     attttttcaa cttcatccaa caatttctct tcacaggaca agtcctcttt cttcttcttc    154320
     ttctctctcc tttttgattt ttttgtacta gaacccttcc tattatcatc tggtagagaa    154380
     tcttcacatg agattgggtc tgtatgatgt agtgtagctc taggctcttc acatgagact    154440
     gaatctcgtt gacaggactc tgcaggtaat gaagacaaaa gattctcgga taaccgaact    154500
     tgactttcac tagtggattt ctcattttcc ccttcttttt tttcttgaga tgaaaaggcc    154560
     tcatctgcgt tcccaatttg gctactgata tgagaatcat tatccttcac ctcattatcc    154620
     agtttcctcg attttctctt ctttttcccc gatctcttct tatgcttatc aatcaattct    154680
     ggattcgttt gaccgtcatt tgagtttcca gtttctgaaa gtgtttccac tgaaacactc    154740
     tccatttact cctttaattt agtcggaaat cagctgcagt tcaaaactat caagggaaac    154800
     gttttctcaa gtttagcaca agtgaagtga tgattcacaa agaacggata aattaagatg    154860
     cctcacataa atccatcaaa cggtagctct agaaaaccca acacggagct cttaagtgat    154920
     tggaaactga gcaatagaga ctatgtatta aatgtgaatc aaacaattcc aaccaaagaa    154980
     gcagccatcc agaaaattat gcactttcta ataccattgt tcgtgaaatg atgattggca    155040
     gtgttcttat tcactaaaac accaaaacgc ttcttaacaa aaaccattaa caagagaaaa    155100
     acgaaaaact gccagattca atcgagctga ggatattcca cataaatgat ggcaacctta    155160
     aaaccagaag ttttagtaac tgggtcacat cttaaatctg aatttgaaaa acaaaaatca    155220
     ccctcgaaga agagacggac atgtcaaggt atcaaccgaa attagagcac agggcactgt    155280
     ctcaaaaccg accaggagat ttctcaggct acgcttaata caaatagaag gagaagaaga    155340
     agaagaaaaa gatgagatta cctggaagtt ttcaaattga cgaagagtat ctctgtgaag    155400
     gagacgaaga ggcgcggcga attcgatagc aagggttaac tgaatcttcg tttgtgttaa    155460
     aacttccggt ttatattgaa aaccaaaaca ttatcaataa ccattcaggt ttacaagcat    155520
     gactccaaat aaccaggttt tttggtttgt gaatcacaac tgaaatgttt taatttaaac    155580
     ccaactaatt aggcccatat atgtggccca tttatatatc tattttgatt ctgttcatca    155640
     aatcaagaaa tttactcatc atattgatca tcaaaattca aagtcatact aaagttcgtg    155700
     actcacgttt aattcataca agtaaatggt actttttttt ttttttgtaa acgaagcatg    155760
     caaaaaatga tttaagaact gcaaagtact agttttatct ttttgtaacc gtcaaagttt    155820
     tggatttaag ctccttgcat ctctttgacc aataaaaccc atactgtata tttgactaaa    155880
     agagagaccc ctgaagattt tgatcagtgt tgtgttctca agtctataga ttattgcttt    155940
     cgagtcttca gtaaatctgt aaaagaaagg tagcaacata ccttatctct atatagaaat    156000
     gctccaaaac caaaacacat gttttcttta agtatcacaa tgggtttatt gtataactcg    156060
     gtatttgaaa ttatctgcca ataaacctgt aaagcaactt gaactttata gaaaaaaact    156120
     aagttgcacg cgtagcaaca atttccatct atcacatgct ttatctgcat ttgtacaata    156180
     agcacatttt aacacaattg ggcaaattgg agctaatcat aacggcttgg tgttcttaaa    156240
     ctacttgaca cagctaattg taacgttttg gtgattcttc tcatttctaa agctttatat    156300
     caatctaatt aatcgttcaa taaaagttaa ttgctcaatc agtgagtaga ttatacatac    156360
     atacgtgaga atagactgac tgtcgtattt taccttctta cacgaaagtg tttgtttttc    156420
     tttcgttcgt atttttttat ttatattttg ggcatgagaa tcagtgtcca agtggaagct    156480
     attagctatg ttggttgata attcattttg tatatgtgca aatgtaaagc ttcatatata    156540
     tgtgacccat tcatgcatta ttcagcaatg attgaagatt gtaataaagt gtactcctta    156600
     attataagat attattacaa aatttacaac ttgaccatac tccatgtgtg tttttaattc    156660
     tcgaggcact tttgtgttct tgattatatt tacaactaat caacaattat tatacagcca    156720
     tttatacata taaaaaaaca cagccatatc tgtcgaaaaa ttaatgaagt ccccaattgt    156780
     atatacaaat ccatttttca caagttccaa caccatatat atgatgagta taataattct    156840
     aatcaattgc ttcagtttgg actgataatg caagtgttaa catcaaattt tatgttggaa    156900
     accctatact aagaagggaa ctattaatga tttggcttct ctaattgttt tggttagcaa    156960
     acatgcagta ctatacataa ttgtagcaaa gcaatgacac atcaagaaca cgaacacaaa    157020
     ccactatttg ctgctctaag tttatttctc ttcatattga tatcaaaatg gagaacaaac    157080
     tttagtatac aatcattagt tttccgtgtg cgtgtgtgtg tatacagatc aatcaccata    157140
     ctaaataata tttaatcgta taccaataaa cgagttacca aatacgtatt tcaaactttg    157200
     catttatata ttggcatttt taatttctta attcttgaat tcaatgagaa cccaaaacaa    157260
     tagtagtaca gtataatatt gcaaaacgcg ttatgacatg caagaatatt tcaaacgtgt    157320
     ttgtacgaac acgttgccgt actctgcaac acaagttctc cactgccagt gttactttat    157380
     cttctcaagt attaatttgt ttttgttatg ttttctgcca gtgaattact ttatcttctc    157440
     aagtattaat ttgttttttg ttatgttttt ctatatatat agttatatac tgccaattac    157500
     tatatatttt tattaattag tttaattttt ttattatctt caaaattaaa taaataatta    157560
     ttattttaat gtagggattt taatgtgtaa ggattaagag catccacaat agtggactct    157620
     tagtaaaact ctaaacaaat aataaatatt ttatatgatt taaatattag ataagtctct    157680
     taaatttgaa gaaaattaga tcaattgtct taagagacaa ttgatctaat tttcttcaaa    157740
     tttaagagac acatcattaa aatatattat ttatctatac ttatacttgt aagttagtta    157800
     agaaacccat gtttagagac ttccattgag gatggtctaa gggtatttca taagctcatg    157860
     tgaataaaat atatatacat gctcgtctct agtataataa ctcaatactc ttcaagtgaa    157920
     acaaaaacat atgtacagtt cctgtcttat aatttatatt tctcaccata tggtaggaaa    157980
     atatgtacgt cttctcaaaa tttctatggt atatcgtaaa ttggtaatat aattgaaatt    158040
     acccatgaat acttaagctt attagatatt tatattattc tatatgcatg tgaagccaaa    158100
     atttgccttt tcgctaaaca aatttaggca cattatattg ctccaacata atatattatt    158160
     gttaatcctt ctcctaacta tgaacagtta agggagaaat caagaacctc tttaaataaa    158220
     tacaagttca tgaatacata aaaatatttc tatctagcca agtttatgtg ttcacacgct    158280
     ggtcacgctc gcgccaaatg ataaggctcg tatgattatt atccatgcca aagtcgagat    158340
     aattctttac ttcttcccgt taattaatga gtattttaaa agcaatttta atcattttga    158400
     aattatacgt tttgaactga cgatatgcat aaatagacca tgaagtgtag gtcgacgtaa    158460
     aaaaaaaaaa aaactctaca ctgcatgcat atcctaacaa aaaatgttta cgttttactt    158520
     ctaaaacatt ttaaatcaca aaagtattag gttattcata aacttctcgg atatcaatct    158580
     ttaaaataaa taataaataa aaaaatctcg aatatcaata tcgctaaaaa aaagaaaaaa    158640
     aaagaaaaaa aaaaaaagct aggagtcgcc gcattattga taaagatata gcaaactata    158700
     tacggtggaa tcagaaggtt tggttggaag gatatatgat acgacttacc aactgaagat    158760
     gtttagttaa tctatttctg acaaatgaca agaagagtga aacatgtatc tcgtggcctc    158820
     ttttcattgg tctcatgaga ctgtggaaga tacgactttt cacaaaatca tttataaaaa    158880
     atatttttgc tgacagcaaa tcattaggga ttaggatcat catacttctc agtttggttg    158940
     ctagttgcta caattatctc atggttttgt cttgatcttt ttatttcttt tgactggtta    159000
     tgaatgcttt taaacgagta atggacaccg taccctctag tagtgaaatt gttaacatgt    159060
     taaaaactat attaattata tatgtagtat actagtatgt cagtgcgatt ttagcaaagt    159120
     cgatatatat accttttcgt ttgattgtac actcaacaaa ttatgtaaat ccttataacc    159180
     gggaacgtaa cctatatcaa agcaagaaca accaagttaa aaccaatcct cggaattaaa    159240
     caaaaacaaa ttggaatctt cttggtataa tttatttcct tctaagatgt cattacctaa    159300
     cgcactatat gatttgccta agaaataagt attctcaatt gcttgataat gaaatatcct    159360
     ccaattgctg gtatatcaac ctttcggata tagttaccat gtgtaacaat ctattgtcta    159420
     tggctcgagc taaacacttg cattcatgta gctcatcccc aactccttga aagtgggacc    159480
     tctggaaacc tagctataaa tcacgttaaa aatcttctta aaacaacttt tagaattagc    159540
     atatgataca gtattgacct actgtacaat gggtttcaat gtatgtgtaa gtgaatgaca    159600
     agaaatatca gtagaactta tagttttctt aaaaaagctt tacttaagct gtgtaagtac    159660
     tttttaaagt aggtgcattg gttatctaat gaaaatagtc caatggtcga aaataaatag    159720
     acactccaca cacattaatt agtgaaatcc acatattacg aacaatagtt tataacatta    159780
     acagaaaaag ttcatagact catagctata taactagata atatacttaa ttaataacaa    159840
     agattataga tcgcaatatc gtttgatgca tgtctcgtat attttcatga aggtgctctc    159900
     ctaattagcc gcacaaacag tccccaaact ccacttctct ttcacgttct ctattacaac    159960
     ttgcttcttt gtttatttta aatttatact aaaatagtcg agctattagt atttaaatta    160020
     gtacatacat caatgattgc tccgtaagat atcatgaact tcttcttgaa gatttcgtgt    160080
     tagaattagt aattgattgc aatttcttat acacttatga gaaccaatca atcaattggt    160140
     gactaaattt gattctatgt tcctatgaaa gtacacaaaa ttgtaaacaa tccattggat    160200
     tgtcacgttt gtcgaagaca taatccagca tgatttgaag ccaatctatg acattaaact    160260
     agaagaaatc aaccaattca ttaactcccc aaaaagcttg catctaacat gtttgttttc    160320
     aaaacttaac aaacaattaa tgtgtaaata aatcacgttt ctaaatgtgg atcgttacaa    160380
     tgtctttcga ggatgatata gatcatttaa ttcaacttag aaaatgataa tttttcactc    160440
     tgcaaactaa aatcgttgtg gtatatacac acatgtatat gtgatgcatt acgtttaaaa    160500
     cgctttaatt atcggagttt ggctccatgt acgctagcta taacactcta accatcccgt    160560
     cttctcaata tatattttac agttgaaata aagattaaat tttgcaatat atatatagat    160620
     attcacacta atcctaaaaa tttatcacat agtatattag ttttttttct tcaaagtcta    160680
     ggttattgta atttctattt ataagaccat ataaaacata tagattagca ttaccctttg    160740
     tgttgatcat gtactgagat tcaatctaca gttttatttc cgaatcttaa gctggtgggt    160800
     tcgatcacat gcaaattaca attgtctatt agtattacgt aaatacgaat atacatccat    160860
     atgtaagaac acgtgtgtat aactgtgtat atctccaata tacgtgcatc tacatctata    160920
     agtttacatt gttttcgtta tcttctacct aaatttatta attttcattt gggtcctatt    160980
     gttatgtcga ttaataccct ttaatttagg ctgatgttct aagtccaaac atacaaacag    161040
     ccaatcttaa cacaaaatct taatctcagc atgcgggcaa aattgcgacc atacaactat    161100
     tatgctatga tggttctagt aataaaagca ggcatttagt ttggaaaaaa agtaaaatct    161160
     ccttagagta ctttaattag taaccagtgc tataaacgaa ttgtaaccaa cacgcaatgg    161220
     aatcaataac actctattaa cttaatatag atatgagaaa ctcgtgcttt taatctttgt    161280
     taaaacgtcg acaaaaaaaa agtttttttc tgttaattag ttctcctctt tttaaagttt    161340
     taaatttttg atttcataac tcactattaa ttgcgatatg tggggtcacc taagatcctc    161400
     caagaactta tattcttgat gaacatatat tgttcacaaa ttggaatcat aatcttatcg    161460
     tatgattgta tgtatatgtg tcacgtagtt ggacttttaa ccactattag atctttccaa    161520
     atatcctctc tctttttttg cttcaaattt gttttttttg tgcacacaca tcttatatta    161580
     ttaatatata aaattggatg agctttataa gagttttaat tacatatagg aaaaatagaa    161640
     ctaattaata agatttagat atatgtataa acgtatttat atattgacat gtaagtttta    161700
     aaataatata tcgtcatggg aaatattttt aaaaatctta aaatacagta tggacttata    161760
     tattcatact aaaacctagt ggggtttttt tttgtgtgta catgaaaagt ggtaaaagta    161820
     ttttctcttt tttaattttg ttagattaaa aatatgttaa ggtagcttgt tttgtttatc    161880
     gtcatgtgtt aaagtgtact atatggtaaa gatttataca gtagcatgtg taagcgggtt    161940
     catgagtagg agagaattaa attctgcctt aattaaacaa aggtttcgat tagccgtacg    162000
     taccgccatt aatagggagc ataattatca cccattaggg agcatacttt gaccactagg    162060
     ggaaaattag aaacctatgg taatcgtatt aattaatacg gccaaaatta attctaatta    162120
     acatataaaa ctgtttccca caactaattt ttatagatat atcacctttt agataaaata    162180
     tagaaattct ttcttcatat atatgttact aacaaataaa aatcataccg atgcaatgac    162240
     ctacaatctg accggttagc tcaacaactc agtatttgag aaatgtaatt ttgttcgatt    162300
     accataggtt tttatttgta taaatctaaa tataatcata ttacttcttt ttttatcgaa    162360
     atataatcat attaactcac gcgaagaaac tataataatc catctgactt ctggttcgta    162420
     aatattgtca tacttaatta gagacgaatt gttctcatgg taatcagcaa aagatcgaat    162480
     ttcctaattt ctaatactag tccagaaata tggtatagat ttttatcata attttttttg    162540
     tctagatata ataaagtgta aatggatagc cacccaccca ctcctctcgt ataatgtaaa    162600
     tttctcattt ttttaatgat gccaaatcca tataatcgga atttcaacca ccgtatttgg    162660
     gctatagatc ataactaaag ttatggaaat aaatgaataa attaaaaaat gttaagtaga    162720
     aaaaataagt atcaacaaga gagaaggaag aagaagacat aagctaacag ttgtccgaaa    162780
     ttgattttgg caaaaggtga tctttgattt tgcttaaaac atcgaatcag aacatttaat    162840
     ttagttgttt cctcatttct ttcatctatg gagtttagta tacccaataa atttgattag    162900
     ttacttattc cagctcctat tattatattt aacacacata atgtaaaaca gacgcgtata    162960
     atttatatag aaactgtatg tagttaaaaa cgacatacta gtactgatga ctctttgttt    163020
     acgtaaattt gtattctcaa agaaaaaaag taactacctt ttgttatggt ctctaagaaa    163080
     aaacaaaagt actttacagt tttcttagtg accattctgt aagaatatca aatagtgaaa    163140
     aataggtaaa cgagaatctt tttttctgtg taacaatatt gtattagtga aggattatta    163200
     attacgagac tattatctaa aacgcattag tgaccctttt ggatttaaat cgtagcagcc    163260
     gactaaacca aaatatttag aaagttttcc aaaaacaaac aacattaaaa cacatttaaa    163320
     ctcgtacaca ataatagaaa ctaaactatt tttagcagac taaagtctaa acaacattac    163380
     gtttaaaaat tgataatcag tgttttatag aactggcgat ctcctaaaga tgaaccaccg    163440
     agaagtttca agataaaaac aaaaataaaa atagccaaac actcttatct attcatccat    163500
     ttgcaggtca atgacaccgt atttttccac aatcgaatct tccttattct ttacacaaac    163560
     ttcttctctg tatgtaagta aactaatatt aaaattgaac ttgtcaaaga ctttcctctt    163620
     ggtcacgtct gctatatata ctccttcatt cacacaaatg tttaactcca acacacttct    163680
     ctttctctca acctctctcc ctctctctct ccgattgtgt ttttagagct gtcacgtgtc    163740
     acgtgtcagg ttcgaagctc taagaaaaaa atgggtcttc ctctaatgat ggagagatca    163800
     tcaaacaaca acaacgtcga gctttctcga gtggcggttt cagacactca cggcgaagac    163860
     tcaccgtact tcgccggctg gaaagcttac gacgaaaatc cttacgacga atctcataac    163920
     ccttccggtg tcatccaaat gggtctcgct gagaatcagg taataaaatc tttcatatag    163980
     tcaacttttt tttattaatt gttatatatt gcgataatgt attaattgtc tctttcgatc    164040
     atttttttcc tacaaacagg tctcgtttga tcttcttgaa acttacttgg agaagaagaa    164100
     tccagaaggt tcgatgtggg gatcaaaagg agctcctggg ttccgtgaaa acgcattgtt    164160
     tcaagactac cacggtctca aaactttcag acaagccatg gctagtttca tggaacagat    164220
     tcgaggaggc aaagctagat ttgatcctga ccggatcgtc ctcaccgccg gagccaccgc    164280
     cgctaacgaa ctcttaactt tcattctcgc cgatcctaac gacgcccttc tagttcccac    164340
     accgtattat ccagggtacg tcacacttta taataagata tataatgaat taaattaaga    164400
     aatatggtca ttcgtatata tgaagataaa ctacaaagaa atagctgcaa ctaactaaca    164460
     ccatttaaaa gaaagttata atctagcaaa tcttttattt tcgatattta atgcattgta    164520
     tttaccgaac cgtttattta tttcattaca gattcgatag agatttgaga tggagaaccg    164580
     gagtgaaaat agtacccatc cactgcgaca gctcgaacca tttccagata accccggagg    164640
     cgctagagtc ggcgtaccaa acggctcgtg acgcgaacat tagagtccga ggagtgctca    164700
     taaccaaccc atcgaaccca ttaggggcga cggtccaaaa gaaggttcta gaagatctcc    164760
     ttgacttctg cgtacgcaag aatattcact tggtctcaga cgagatctac tccggctccg    164820
     tcttccatgc ctccgagttc acaagcgttg ccgagatcgt agaaaacata gatgacgtgt    164880
     cagtaaagga acgagttcac atcgtctaca gtctctccaa ggatcttggt cttcctggtt    164940
     tccgcgtggg aactatatac tcgtacaacg ataatgttgt tcggacagcg agaaggatgt    165000
     cgagcttcac gcttgtctcg tctcagacac aacatatgct ggcttctatg ttgtcggatg    165060
     aggagtttac ggagaagtac attaggataa accgggaaag acttagaaga cggtacgata    165120
     ccattgtgga agggcttaag aaggcaggga ttgagtgttt gaaagggaac gcagggctat    165180
     tttgttggat gaatttgggt ttcttgctcg aaaagaaaac taaagacggc gagctccagc    165240
     tttgggatgt gatcttaaag gagctgaacc tgaatatatc tccgggatct tcgtgccact    165300
     gctcggaggt cggatggttt agggtttgtt ttgctaatat gagtgagaac actttggaga    165360
     ttgcgttgaa gagaatacat gagttcatgg accgacgaag gaggttttga aatgttaaaa    165420
     aaaaaagtaa agtaaatccg tttttttggt ggttaaatat atgggggagg ggtaattaat    165480
     tttttaggaa agagaagata attaatttaa acccattgat gtaaaatggg ttttgatttg    165540
     tttctctttt ctagatatta ttgtttgttt tcttgcttgg acaaagcaag ttaatttcat    165600
     gttcatcaag gttgatttgt aatatttatt gttataaacg aattttttaa aatataaagc    165660
     attacagaaa catctctatc ggaaaattat ccctattact taagtacggc aaaaacaaat    165720
     atatttatat tgttaagata atgatacacc tcgcaaatat attatagaca gtagatacag    165780
     atttacttat tgttcttgaa ggttatacat ctgtatgtaa tatttgttga cttttttgtc    165840
     aagttaatat ttgttgtcgt atacagaaaa tgggtctaaa taattttatt tcaatatggt    165900
     tatgtcattg ttgttgtaat tttctgtaaa gaggttagtg ttgttatgtg gtcgggtctt    165960
     tttttgactt ggtcactgta caactctaac aagaaatgtg ttctttttct tctcttaata    166020
     ctagttatcc gaatacacac acggtttcga tgagatcgaa ctagttttgt gtggctacca    166080
     attagtgagg tatttatgac gatttatgac aaaaaaatat tgaaacaact attatattgt    166140
     atttagggtt acatgtataa ttttaggatt ttgataacca aataattaat tgcagtaaca    166200
     aatattctta aataaaacat tttgatgttt gttctagatt aacataatag aaacctttaa    166260
     ctaatcatat aactcgaaat ataatatcta aattacaaac aaatcagctt ataaaagaag    166320
     tgcacattca agttttccgt acgttacaat gagaaatata tttgttgtga tatcattcgg    166380
     gcgattttta aaatttggtc taccagatat tcattttcaa taacgaaatt tgaatgatta    166440
     aattttaaac aaatggttga ttcctagcta aagtctctaa gttatttcgt tttcttggcc    166500
     aagtcgaggt cgtataccac ttggttgaat aaaaacaaat caatttaagt gcaaagacaa    166560
     tggaccattg tcaacggtct ctactaaaat aatataaata atgcaaatta tagttacatg    166620
     tattcaacac acatattttt ttctaaaaag tgtataaata tacagtattg tatttggaat    166680
     gagttcatct atacaataat gacagggaat gccggaatgg tatctatggt atagaagttg    166740
     catgcaacag aactatagac atttcttaca tcatgcacct agaactaaac caatcatgtt    166800
     taatacatca ttttttttat attaaaaact tgctttagat aaatcactag atcgaaagtc    166860
     aggactatag tatataggta aagttgaacc tggcgaactc taaatttaca attgaattct    166920
     gaatattttt caattgcacc aacatttcca aatttatacg tatttttata aatccatatc    166980
     atatatatac tttgacttag ttagtttttt tatgttatga gtatttattg ctttcgttat    167040
     gtcatgcaca aataataaac atatacgtac atactttgac ttacatagct tatagctatg    167100
     tataaaatta atgttataat acttcaactt acagctaatt aggagaagta gtatttgatt    167160
     tgactagtcc ttccaaagga aacccccctt aattaagctt attaaattga gtttcgaaag    167220
     cgtcaaggaa atttaagaat gtaagactag tagactttgc atgcataatc cttttaaatt    167280
     aatcaccgat ttgacatttt agtctcttaa ttttgcatgc ttcattatgt ctttgtactt    167340
     tactactttt gactttatac atgctcatgt cattatctac gtatctaata caatttcttg    167400
     tactcgaagt tttgggtcaa acctagttac cttttcttct tgttaatttt agcatgaatt    167460
     gatcattaat ctcaataaca ttataaaaca gatacacatt tattctaacc agtttcctta    167520
     accgattaat tatgatacat ttcaaaaacc ggctacgtga taggcgtctt cgaattttgg    167580
     tgcctcttat atatttagtt ccaaaagctt tgcacgggaa tacttttgac tttagtacgt    167640
     tcgtgtattt tatagtaatg gtcaaaagat tcaataattt atttgtaatt ttgtgacaac    167700
     tggtaccaaa agttttgtga caggtgcaaa gatagactta tatcaaactt tcgtataata    167760
     agaaagtttt tttttttgta cgtttgtcaa caacaacatg caaaaacatg atattttcaa    167820
     ataaaaatag catttttcat acagacagtg caagtttaac gaatcaaata tagccttttc    167880
     attcataact aatgccgaat ctaatctaaa cgcacgatga tgcaaaatac aatcaaaacc    167940
     ccacgacttc tttcaagaat tatgaggcca tttactttct cttttgtttt tctttggtac    168000
     gtaaatttac aaatgtgatt gatttgccta ctaaacgaat ttttttttat ctacccttat    168060
     gtattctgat agtaaatgtt caaattcaat cttacttctt agaatcaaaa atgtgaagaa    168120
     taaaaaacct catccacacg tgtgtcgcgg tcgttaggat tttccaaccc aatgctactt    168180
     tttgagggtc aaaggtcaat tgaacagctg gaagaatctt agccgtcaga tcagtcccca    168240
     ccgcacacgc gtatcacgct gacaggctgg cgcctaaaat cattggccaa gtcccacgtg    168300
     tgaactaatc atcaacgtcg tcattagttt tactacattg gtctcgtctt cgtgtcgtat    168360
     tacgatcgag ctgcttcaca attatgttct tatggactta tctatacaac aacccgaaac    168420
     ctataaatct ttattgtcaa aaggaaatac acattacaca ctatacacgt acttatattg    168480
     gacccaaaag tggttaggtt aaaagtgttt gtatcagttc tagtaattac taaattagaa    168540
     tattggtata gttccgtttt ttttcttttt ctaaatgata attcaataat tcatatcatc    168600
     cattgtatgt aatctgtaaa aagtacggac agaaattcat tgatcagaaa cttttttttt    168660
     ttaataacca aattttgtgg catcatcatt aattccgaac acagagattg atatatcaca    168720
     cttacatata tagattagtt ggatgattgc tatatcattg ctattgaaaa attgcaaaaa    168780
     gttcttctaa ttcagatgat ataaaatgtg actgtacatt tacttattat ttaataaagt    168840
     cgaatttgta gttgaaaata aatacttgta atcaagtggt ttgtactact agtagtctag    168900
     tacccacgtc gtatcataac ttcattcaaa tttgcaagtg tatgtgttgg agactttgaa    168960
     ttatatacta aaaataaata ggcaaaaaat aaactgaatt tccaaaaatt ctttaaatga    169020
     tttcgtacgt gtattattgc ttgtgatctt tgtttttgtt tagatgattt tagtgagacg    169080
     agaaaaaaag agaagaagat aaaaatgcat gacatcacat gtcagtggat ccagagtatt    169140
     atttgatgac aatctagtca gattaggcat tcggtgttta atcaagtact tgtatatgat    169200
     agctagctaa tcattaagca aaaaaatgag atccaatgac taattaatat atttgattag    169260
     cgtgtttaat gaagatgaca tataattata atacggtgtt gggtgagata tactttgtta    169320
     ctcgctttgt acatacaaca agtgtttgca ttattttatt cctcttgaat atattgaata    169380
     ttacggatga gtctgattgt ttctcaatag ttttggaatg gcaataattt tatcaggaaa    169440
     caaaaaaaac gaaaaacaag gtgataacaa aaagaacaat aggaatatga atgaaaaaaa    169500
     caaaaaagaa caagaaaaac agaaaatgat aataagtagg aaccaagaga aacatagaaa    169560
     tagaacaaaa tgattatggt aaatggtaac aaaaaaggtg aattaatatt taatataata    169620
     attactaaat aatcatttat ttgaattttg tttattattt tcatttaaaa ttaaagttct    169680
     gtataaattt aaaataattt atattataaa tttttcttca aaacatttat ttattttata    169740
     gtaaaatttt caattatatt acaaagttaa aataagtttc actttaaaac atttatttat    169800
     actaatttaa aataaattca taacattcat taaattgaaa gtttgataaa tttttttata    169860
     tatatcaata tatactaaag atatgtaaaa tattatattt aaatataaat attatcataa    169920
     aagctatttt aaatttattt aataaataaa aacgaatttt atttttttgt tcctcttggt    169980
     tcctctacaa ttttgttcta tcattttttt ttttttgagg aatgatgagg aaaaatgtaa    170040
     gacccatatg tataaaaatg gaacaaaaat accttgcaaa tggtaaaaaa aactgaggaa    170100
     caaagaggaa tacaaacttt cctactcatt cttttcctaa aaaatggtta tgaataggag    170160
     ccaataattt agtaatttac acaaatcgaa tatttctatg cgtgagaggt gagacctaac    170220
     aattcaattc aaatttgaca ttatttgggc ctccttctta agattcgcct acgtttgatc    170280
     aatctaattt catattgggc tattaagagt tattaaaggc tcatatgagg cctgtaatgt    170340
     ttttttcgcc gcattatcgg aaaaacctca agaagaagag tggtgacata acaaaacccc    170400
     aaaagctccc aagcctagag attctgttgt tgatccgatt cccgctctcc ttctccggta    170460
     gtacaatctc cgtcgccggt tacatcagcc aggtaagaga cattagtttt tattttgttt    170520
     cgaagtttca tctcttttct ttccacttta tccccttcaa ggaatttgtg ctagatctac    170580
     gcttttaggt cgctggcatt tgattgattt tggaccaaca aaagctaatt taaatgttca    170640
     tgaggtcttg agatttgatg attaggcttt tattttgtcg agactgatgt taggtcgaac    170700
     tatgttgatt taggtttggg attcgatttg attttatgga attggattcc ttagatagat    170760
     cctttatatg catccgttag gtcctctttt aatttgtaat tctaaactgt gtcttaggga    170820
     agagttttaa gagatggcat caaagttgct acaattgaaa tccaaggcat gtgaagcatc    170880
     aaagtttgtt tccaagcatg gaacaactta ctacaaacag ttgctggata agaacaagat    170940
     gtatatccag gagccagcta ctatagagaa atgcaatgaa ttgtctaagc agcttctcta    171000
     cactcgtctt gctaggttag tcttcgctct ctcatctgat cctggatttc gtttgatgtg    171060
     tttgttagac aagaaattgt gcgaaatccc gctaatgatg tagataatcc tgcttcgtta    171120
     tcaaatttgg ttaggggcag tgttataaaa gaattgtgaa attatacatt ctaggtttga    171180
     tggttctgaa ccatgaaact catcacatac ctagttacag tctctacttt gctgcatctg    171240
     aactagatac taacaatccc ctgcttatat agagtatagt atttgtgtag atttcttacc    171300
     agaatagtca tttcactgtt tctagatacg ttattcagaa actgcgtgtc ttctttgttg    171360
     ctatgactga cttgtttttt tcaaatggat cgtagcattc ctgggcgttc tgagtcattt    171420
     tggaaggaag tcaatcacgt gaagggttta tggaagaatc gggcggattt gaaggttgaa    171480
     gatgctggaa tagctgcact ttttggtctg gaatgctttg cgtggtactg tgcaggagag    171540
     attgtaggaa ggggcttcac tttcaccggc tactaccctt gaagaaagaa agcaaccccc    171600
     tcataaacaa acatgcgttt cagatccatt gaataccgaa aagccttttt atatcataat    171660
     tagcggctta ttatctatct cactgctgac attagaagca aagttaattt ctgtttctct    171720
     ggataattta tacacaaaag ttttgaaggt gaggcatcat cactcgtgct agctctaata    171780
     atatcagtcg actaatgttg gccatttggt tttttctttg tcattttcat ttatgtgaat    171840
     aaccattttt cttgggttta gagtctataa accgtttggt aagatgtatc attcgtgaaa    171900
     cctcagcaca taccaacctt accagagaag agtaagacgg cattatatta taaaccgttt    171960
     ggtaatatgt atcattcttc ttctatcaca aaaaaggaag aaaatcctat atttttgaca    172020
     attgtctgaa aatacgatta ggttcagagt atttcaacgt tgtctctgtc atttgtctat    172080
     cgcaatttcg cataaaagca agccttgtag gtgtagaagc catcacacca gattgtagtg    172140
     gatgatcgga aactaagact tcagtcatct ggtattctcc tctctctctc tcgaccggtc    172200
     ctcactataa gtcttctctt tgtaacattt ttgtgatcat tttggatcgt tagttttgta    172260
     gttgttcttt ttttttatga gtgttttgat agtgaacata aacttgattc ataagtcaac    172320
     tgtatgctca atcaattggt ttttgaagaa gttagttcta agaatcaagc aattggataa    172380
     gataaaatca gataaaatct acacgccttt tatcaaggca aagcttatag tgtttaaagc    172440
     tgttttcctt gaaaacttga aagatctaca ctttcagaaa aaagttgtaa actgcagcaa    172500
     cccataatca ataaagaacc agtagtagtt ttcttcagtt atgcaagcaa agattatatg    172560
     aattagcatg gctatttaat atatgctttt ttccttgagc agagacttta cagtgtttga    172620
     ggaacgaaga ttgtgagaca caatggctaa ggatgaagcc aagggattgc tgaaaagtga    172680
     agagctctat aaagtttgtc cttacatact catctctacg ttagttcact tctccatttc    172740
     tctgatacat ttctgtgaaa aatgttgtag tatatactgg agactagtgt gtacccacgc    172800
     gagccagagg ttctcaggga gcttaggaac attactcata accaccctca agctggtatg    172860
     gctactgcac cagacgctgg ccagttgatg gggatgctgc tgaatctggt aaatgcaaga    172920
     aagactatcg aggttggggt tttcactgga tactctcttc tcctcactgc tcttacgcta    172980
     ccagaagatg gcaaggtatt tgcatagata tgaccaaacc aaaagaaaaa gtgtcatgat    173040
     gtttttcgtt gttttgcttc tgtatcattt ctgcaactga tttggtacac gagctctgca    173100
     ggttatcgcc attgacatga atagagactc gtatgaaata ggattgccgg ttataaagaa    173160
     agctggtgtt gaacacaaaa ttgatttcaa agagtctgaa gctcttccag ccctcgacga    173220
     gcttttaaac aatgtacaac ttcatacttc tttgtctttc aaaaaaagaa ttagtatgta    173280
     tcctgagatg gtctttttgt tttgatgttt gtgatgcaga aagtgaatga gggtggattc    173340
     gacttcgcat ttgtggatgc agacaagctg aattattgga actatcatga gaggcttatt    173400
     agattgatca aggttggtgg gatcatagtg tatgataaca ctctctgggg aggatcagtt    173460
     gctgaaccgg actcgtccac gcccgagtgg aggatagaag tcaagaaagc aaccctcgag    173520
     ctgaacaaga aactctcggc tgatcagcgt gtgcagatct cgcaagctgc gcttggcgat    173580
     ggtatcacta tttgcaggag gttatattga gcgagtattg ttgttctttg tgatctttag    173640
     ggtcatatga ttgtgagccc tttatattga gctattgtga tgcaagagtg ttattgttct    173700
     atgtgatatt ttggttcctg tgtgaatgtg aaccttttct atcaagtttg tggatttctt    173760
     caaatttcaa gattataaca gacagttacg aagaaacaca actcatttta tgttttgtgt    173820
     cttttggcaa aactccaaat tctgaacatt gctctaaaat ctaatataaa aagtaaaaaa    173880
     atgaatgggg cgttccgaga atcgaactcg ggacctctcg cacccaaagc gagaatcata    173940
     ccactagacc aaacgcccac attgatatat agtttgctag cttttaatac aatgtatatt    174000
     aaataattta gttttgtgat ataaacagta aacagaacaa gatattttca cccaaagtta    174060
     aaaaatccaa cgtttgttca aaaataagaa aaaaactatc caaagttaaa ttatcaaatg    174120
     ttaaaaatcg ttagacgtta atcacaatat aaaggaactc tttttttttt ttttgagtta    174180
     agaaacactt agttgggcca taaaaatata ggtctagtag atgaaaggcc cataaaatca    174240
     actagggtta gttcttcttc ttatagagcg ccgcatataa gcttcatcct tctccgtcac    174300
     caccggctct gtatttcggc atttgtggag agaagaaggt actctcatcc ctttctcttt    174360
     cttatcttaa tctccttttt taaaatttgt gacaaagtaa aatgagctaa tctcgtcttt    174420
     aagatcatat gtcaaaactg aatttgagtt ttgatatatt caggtaaaga gagaagatag    174480
     aaacataaaa tgtcggagaa gaagggaagg aaagaggagg tggtgaccag agagtacacc    174540
     atcaaccttc acagacgcct tcatagctgg taatttccaa aacaccaaaa acacttttgt    174600
     cttattgctt caaagctttt actgttagat agtggaattg gaatgttgat aatgagctct    174660
     tagctaatgt tttaattcga ttgctctcta tggattgtga cattgaaatg tttgatcttc    174720
     tttgtgtgta aaactagtac ctttaagaag aaggctccaa aggcgatcaa ggagataagg    174780
     aagtttgctg agaaggaaat ggggacaaag gatgtgagag tggatgttaa attgaacaag    174840
     cagatttgga gcaaaggtat cagaggtcct ccgaggagaa tcagagtccg agttgctcgt    174900
     aagagaaatg atgatgaaga tgcaaaggaa gagttcttct ctcttgtcac tgttgctgaa    174960
     atccctgctg aaggactctc tggcctcggc actaagatca ttgaagaaga ggattaaact    175020
     atcttatagt aacaacaaca tttgatcaga tttttcgagt tttgtttttc gaatctttat    175080
     tggagagaac atttatcttc ttgaatcctt aagccttgaa tcatagtatg cgattgagac    175140
     agaatctcag tcttgtgtcg taagtagtct tcaacaatcc ttacacttgt ttcggtaaag    175200
     tttgagcatc tggttcgatc atgataatat ctgcagctat gaataagttt atgcacctct    175260
     ctcaagtgaa ttgcttgaat aaatcaagag tattacatgt atgaactgga atctagttcg    175320
     agtcaatcat gagtttttaa acaaaacgaa cttcagagtt tcgtatctat ttacaacaac    175380
     agaagaatgt tctttagggg ataatagagt caaaacttgc actcttgcta tcacaaattc    175440
     actctgacga ggtttgaaag tagctattat ctctctaccg tgctttatat gcatacatat    175500
     agttcctcag ttttttcact tcctcagatg actcctctag aagatggtcc acgtatagac    175560
     aaattccagc tccactgcaa tttcgaagta cagaaaagtt gatgcaaact ttagttttac    175620
     atacacaggg gcatataaaa caacacaagg ttatatctaa gcgatagata cacataccaa    175680
     agcggcccaa acggaagcca gatagcatcc caccggaatt tcggaagcct agaacacggg    175740
     tgagatttat aagcataaat ttacaaagag cacgaatgga aggaatagac aagaaatgtc    175800
     cttcatgttg aatacagcat aaacgactaa cacaaggatt catgccacta acaatggcat    175860
     tataataatg aaagtttgcg aagtgcaaga ttgtatcgaa aagaaaagaa atgtatactc    175920
     tctagtgtac ctcagcaagt aataaagcca aaagatggtc aatgcagatc caacaacaca    175980
     agagtaccag aaccatcgtc tatgatcatt cttcttatct cgtagcccga caatggagag    176040
     ggagcaagcc atgatagcga tccactctga tccaaaaatc cagtgataaa agatttattg    176100
     ttctagtaat caaataacat gcgaagccaa aaatgaattg aagataaagc aacaaagtct    176160
     tctgaaggca gtaaggtttc agtatgacca taatttgttt tatcttactg tactagcaaa    176220
     gacgcaattt gacttccctc aggtcgaaaa cactcaaaat gcaatcactc tttctaattc    176280
     tacactaatc cactaacaga tatgctctta gattcatatg catataacat atctgttttt    176340
     tcccatgttg ttacaggata ttacacagaa acttccacac aagctcagaa ttggctgtac    176400
     caccatatcg aatggcaaga gaaatctaat aaaccgtgac tacaaagtaa aaaaaatcac    176460
     atagatgtaa gacaaaccag ctgaaatgac catccatgac ttgagatctt ccataaagta    176520
     ggcatgatac cgctgctcaa aaaaaatggc atccataaga acccatggaa tatagaacgt    176580
     agataacgtg acatttgtgt atgtatgtat aagtgcttgc aactccatac gcaggcagaa    176640
     ttagtgtatc atacaaagat tgcaagtgta ttagctcaca atagtcagca agaaactcaa    176700
     agctctaaat ccgtaatcta tcgttaaaaa acaaaatcaa ttttaaactg aactcttaag    176760
     ttttaatcca actttgtctt ctaagatcaa aatcgctgca actgaagaca agtgatctga    176820
     tctgaatttt aactttgaat tcaattcaac ttaagcaaca aaactagtca atcaaatgga    176880
     attgctagaa ggacgaacaa ggccacactt aaggagagat tatcagtacc agttcccatg    176940
     gtgacatgaa ctgctggaaa atggagtaga agaggaaagc tccaaagcag atcagaagaa    177000
     ccacaaacac gctctacaca aaagataaac acaaacttac ttaagaaaca gaactcctca    177060
     aaattttgca gaaattgaat attgttctta gatcataccc tccattgaag actttgctga    177120
     gcatgagctt cctcaagata ccgaacgtac tcctcctgct ctgtaaaacg acagtgatag    177180
     caataaacta ttacgaactt gcttttacaa atctgccaaa aattccagag gatgagagaa    177240
     acaaaataaa ccttgcgtat caataggccg agaatcgacg tcttcagaag taggaaggac    177300
     gaacttatca tcatcttcgt cacgacgagt tctccgccat tttctcgcta acttcttcat    177360
     ttgatttttc ttcagattgc agaagtagaa gatggagaaa ttaggaaaac ttcaatgagc    177420
     atcatcgttt cttcaacgaa agtgtctcca gccaaaacgc ctttaagcta cggcctatta    177480
     agaagcccag cccatagttt agcaagattg attcggtttc ttatctccgg cttggtttgc    177540
     tgtgttgaaa taaatgggct atttaattca acgcaagtgg gcctaactag aacaatttag    177600
     ttacactact ttttttggtc gcaaaactac aagagtacac gtaacgaatg atttaaggga    177660
     ttagggatat ttcagaaagg taacacatat ggcaatatat gccatatgaa tcaaacattc    177720
     aatgcaccga tttaatccgt gagcaaacat aaatattatg aattatcctc gtttccatat    177780
     tagttaagca ttttagattc atttttctat atcctctctg atttaatcca tatgcgcaaa    177840
     tatttatgat gaattatact tagttccata tgtattacaa tttttagatt cattcttctt    177900
     tatccttttc gatttaaatc ttcgtagtca attactccct taaaaaacgt tatcaagagt    177960
     taaaatgttt caaatattct ctaattaatt ctcccctctc ctctcactcc cttatataat    178020
     aaacgctcgt ttctcatatt aattcactta tcatcgcaaa aaaagggttc ttcactaata    178080
     tttttctcat tttaactgtt tgagatggct caaatgtcga tgaccgtcga gaagagtatc    178140
     aaagctgacg tgacggtgag ccatgaccgt gtgaaaaggg cttacgtcac tttccttgct    178200
     ggaaacaaag actactggat gggtgtagtt ggtctagcca agggacttcg taaggtgaaa    178260
     tctgcttatc ctcttgtggt tgcgattctc ccggacgtgc ctgaggaaca ccgtcaaatc    178320
     ctgttggctc agggatgcat catccgtgag attgaaccgg tttatccacc ggaaaacaaa    178380
     accggttatt caatggccta ttacgttatc aactactcca agcttcgtat ttgggaggta    178440
     aaaaactttc ttactatatg tctatatttg tgtttattca tcatccgatc gcatcgttta    178500
     ttttttgtta atgtaattat caattacttt gattgctaca ttagtttaaa agcataataa    178560
     cgtggactaa tgtcactaaa ttattaaaga ttatatatcc aaatttaata ttctgattgt    178620
     tacgtttgtt ttaaaatcat gataacgtct aacgacttgt taatatatgt aaatgcagtt    178680
     tgtggagtat gaaaagatga tttatctaga tggagacatt caagtattta gtaacatcga    178740
     tcatcttttc gatactcctc gtggctactt gtacgctgtc aaagattgct tttgcgagat    178800
     ttcttggtcc aaaactcctc aatttaagat aggttactgc caacaatgtc ctgaaaaggt    178860
     gacatggcct gttgaaagtc ttggttctcc accgccggta tatttcaacg ccggtatgtt    178920
     ggtttttgaa cctaatctcc tcacttacga ggatctcctt cgtgttgttc aaatcaccac    178980
     tccgacatat tttgccgaac aggtttgttt tgttttcttt atcattattt tattttagtt    179040
     tctttattat acaaatctaa tattaatgct tgttttttgt aggattttct gaatgaatac    179100
     tttacagaca tttacaagcc catcccttcg acctacaacc ttgtaatggc tatgctttgg    179160
     cgtcatcctg aacacattga ccttgaccaa atcagtgtta ttcattattg tgcaaatgta    179220
     cgtttaaatt ccttatttcg tctctacata tatgcattaa tgtagattta atgtatttct    179280
     gttactcaaa ttttgtaggg ttcgaagcct tggagattcg atgaaactga agagcatatg    179340
     gatcgtgagg acataaaaat gttggtgaag aaatggtggg atatttatga agattcgagt    179400
     ttagattaca agaactttgt cgagactgag tccaaactga gtccgatcaa tgcaaccttg    179460
     gcttccaagg aatctgttgg cgatgtcctt attagtcttg ccccttccgc tgcataacca    179520
     attctttatg tggaagctct atctatgcaa cttttttttc ctttttgttt taatgagagg    179580
     tttaggctat atataaattt ttatcataac tatatagcaa cctcgtttga gtttgtgttt    179640
     gtgagattag agtggttggt cttgtgtttg tgtcaatgtc gaccttgacc accctttccc    179700
     tctctctttt tttgttttag aatcaataag aagaaaactc ttttggctta attttcttct    179760
     gttcctattt ctttttgcgt tttgcgtttt gtataacaac tttattagat tcgacaataa    179820
     cttttgtttt gatgactgaa ttcttacgac tggtatgttt gtcccatccc tcatgcgcta    179880
     gattaaaatt taaaaccata gttcatcatc tttaaagaaa cttggcttcc atgttgaatt    179940
     attcttgcaa tgcctttacc tccgttgaga gtattttgta aagagaaaag gtgttttgag    180000
     attgtaatac tgtaccattc aatatatatg actggtaatg cattttacac tcggtttact    180060
     ggtatgtttg acccatccct cattatgcgc tagaataaaa ttaggatatt ttttagtttg    180120
     agtttgatgt aatgatttgt ggattggaat cgtgtggttg gttttttctc gtctccttgc    180180
     tcaaaccttt cttatggttg cttaaagttc tcattaattg gagatggcat tgtatcgttt    180240
     aactgataca ttaaagtctc actatttatg acattggttt aaatgaataa taaaacaaag    180300
     gatatataga ttatactaca tattcgtaaa gttaatgcgg attttaatta gtatagaaga    180360
     gaaggagagt ataatttaaa acaaaatgat ctcaggacat tattgttaat tccatataag    180420
     ttggcatttt ccgattctga aactatttga ttcttaccaa tatggtaagc aaataataac    180480
     tgagacatta tttatatgaa tcttactttt gaatcgtttc ctccattagc caattagatt    180540
     ttatatggaa atgtatctca taatattagc gtatttaatg aatacagttg accaaaagaa    180600
     aactatacct cataaatcgt aatattagcg tggttaaata ctactataat tctattcttc    180660
     agttacaatg cattgaccaa atatcatcca tgattcaata attttgaccg gtctgatcgt    180720
     tatgaaccga aattgatttc ggatatttta actcttgaaa tttcacatta ctatgattgg    180780
     tatgccgtca ctgtaatacg tcaccatcgc ttgaacatgt ttttaccaaa aaaatatggt    180840
     tttcctttct ttttttcttc ttaaatgaaa taatgatgac taggtattcc tgctatagcc    180900
     aatacatata gaggaactag agtttggatt tattctttat atatgtttca ttcggacagt    180960
     gtgtggttaa gctcaaatgg ttttgtctaa tatcaaatta ttgtacttga tccatataaa    181020
     taataaatat acaaacattt ttacggattt ttatgccaac agtaatctgc tcttgaattt    181080
     attattaaat attaacatat caatctttat atttgcagct caattactca taccgttcct    181140
     aacaatatac gagtatctga gctagtatat ggttagattt ttagtttaga tttttttgtt    181200
     gtgttttatg aaaaaaacaa gaaaaataat aaccaaatca aaatcggatc ttctttggtt    181260
     tttatttggt ttccattagt taagattagc tatatatatt tgaactttga agcaagatta    181320
     gttttatatc tatttcaatg aatttttatt ggttgttttc tttattttct acttagtgag    181380
     tcatgtacaa ttatagaaat ttgacgccat ataaattttt taatttgttt ttttcatcca    181440
     tttttctgtg atagtttggt ttgattttat ctgattgatc acctagttat gaatctgaat    181500
     taatcacaca ttaaataagt tattggattt taagatcttg gtaaggttat ggctcttcca    181560
     cacttaggag gacttcctca aaggggtgtt gttggtaatt aaagtttaat tatataacgc    181620
     acacccaata gggaatgtgt cactcaacag tcccaggtgg ctacatagaa tggaagcatt    181680
     atgcagtcag catggcaatt tttcatacga taccattctt tatacagtaa gcatttaatc    181740
     tttttttttt aaacacggtt attaaaattt aatttaataa tctgcagcat tgcacacggc    181800
     tggagaatac gcccatttta agaatgagaa agacaaggag aaacctgatc ggctgcacat    181860
     tttcaagtaa tgattattat ttttaaaaca ttagtaactg actgagtctt atttaatcct    181920
     aaaaaaaaat aaatacatat acaatgattg aaaggcaagc ttaattagtt attacgttcc    181980
     tagcctatcg attgtttata tcggtaaata ttttataaat tattgtaatt aacaacaaaa    182040
     aaagcataca attttaatgg ttttgattat attttgctta tattatgcaa caaataagaa    182100
     gaagtgaagc ttgggtttat tcattttaca catgctttat taggacagag tgtgtagttg    182160
     aacataaatg agtttgtcta gtattcaatt attgtactct tttttttttg ggtcatcatt    182220
     caattattgt acctgatagt agccgactgc ttagatcttg agtcttgatt atattattgt    182280
     cgtatcaatc aatacatata attgcagctc aatattcgtc attgcgtgtc tatctcatcg    182340
     tccttttgtt gggtcttatt atgcttgttt tcatttaagt acaaattatt aatggttttg    182400
     aagtatgtat atgccttcgt agtaaaattt taatgttgtg attttggatg tgagaaaaat    182460
     tgatatatgt caagtaagtt aatagtactt cattcagagt aaagcttatt ttaattaatt    182520
     aattacacta caggttctcc ttgtcttcct ccttcataag atgggtgtgt tttcattctc    182580
     cagcggtgtg caatgctcca gaaaaaaaaa aaatcttaag tggctataca cgtatgtttt    182640
     taagtaatta catttcttaa acatgattaa gtgattaatt ggttgacttt aatcctaata    182700
     agttgaatca ctaatattct atatattctt gttattacag cacaagttat acactagaag    182760
     caaaaagttc acgtctatct atcgaagacg acgaagcgtt cttggcaccc gagataaatg    182820
     ccttcgggga tcagttcagg tttctttttt cttccatcta tatacattga attaaaaaag    182880
     atattttgaa tatataaaga aaaattggag tttttttctt ttggtcgtcg gatctaaaat    182940
     cttgacttga tccgtaacga ttacattggt atttggtcgc agggactacg atgccgagaa    183000
     tgagaggcag aaaggcgtgg aagcctttta gaaatctcaa cacattaacc aaactgtcga    183060
     ctttgtaaga ttcttaaaaa ctaataaggg tttatatata tttaattatt tatacaacat    183120
     ctatatagat ctatgggatc cacgtagaat atatatgtgt aatatctata taaattaaac    183180
     aatataattt ttcaggtgat agagacgagg gcagaatttg gtaaattgga taaagaagtg    183240
     atgagcattt gggaatgttg tgagcttctt aatgaggtgg tggacgagag tgatccagat    183300
     ctcgacgagc ctcaaattca acatttgctt caatctgccg aagccatcag caaggattac    183360
     cttagcgaag cttggcttca tctaaccgct ctcattcatg gtaatttgtt attacaaata    183420
     gtctaatata gtgtgccttt tttataatca gaactatata tgagtatctg agttagtttt    183480
     tttttttttt tttttttttg gagcaacatc tgagctagtt catggttaga tttgtttaga    183540
     tttttttttt tgtgtgtttt atgaaaagac aagaaaaata ataagcaaat cgaagtcaaa    183600
     tctactttgg ttttgatctg gtttcaatta gttaagatta gttatatatg tatttgaaac    183660
     aggattactc ttatatctat tttaatgagt tttattggtt atttttctat gtagtcagtc    183720
     atgtataatt atagaagttt gacgccatac tgatttgttt aattcgtttt tatccatttt    183780
     tctgtggtgg tttcggtttg attttatcca attgatcacc tagttgtgaa tcaaaaataa    183840
     tcacacttct gattttattg catcttcaga tctttatgat tcttccacac ttcggaggac    183900
     tttctcaatg ggattttgtt ggtgattaaa gtttaatttt gttattagta tatatagtca    183960
     ttaatatttt aattatgcga attataaggg tatgtggaac taataattta tttttctctc    184020
     acaaaaactt gcaggtgaca tagattcctt gttaggtgtg catttgatga atctaacgta    184080
     caacacgggg taatcaatac tagcaattta tgatcaagaa aagaatatta gacacccaca    184140
     ttatatggtt tttcttaaga gtttatacca aaatacgatt aatttaatga ctgttatttt    184200
     ctctttcttt tcggcagtat ttaaccaaaa atggcatcta cagtcaagca tgtggactaa    184260
     acaatgagca tgatgtcatg gggccatgac gactacatgt acatggaatt tacactcaag    184320
     gatgtggatt aaacaatata gttaagcaaa gttcattttg acttgatctt catcacgtca    184380
     acatgaactt tgattttact gtataacttg tatttactgt aataacaaca atatataaca    184440
     attagaggtt gtagatatta tgatcaatta cttaatcatg tcttgatcct aataactacg    184500
     gtctctgaat tgctgtatat tattattatt acagcaagta caagttatac cgcaagatca    184560
     aagttcacgt tgatgtggag aaagtcaagt cctactagat gtctctgata ggtggtggtg    184620
     gagaaagttc acgttgatct agaaagtgag tatctattct tctccatttg caaagaaatt    184680
     atgaattttc aactaattat tcgttttgaa tttttacagt atattccgga ggtggtggtg    184740
     aagtgtggag aagaaaagaa gtggggcatc acttagaaga attcaagaaa tacagatagt    184800
     acaatatctt aaataaagag acatttgtat atgtatcata agttaacata actccataaa    184860
     caaggagaac tagtgtatct acaaagattg taagtgtaat ccatatagta aaaaaaaaaa    184920
     ttagcttctc atagtcgagc aagaagttca aagctctttt tttttttttt ttttttattg    184980
     tcaacaattt agtcccagcc catataagag tatagcccaa agccccaaag tattataagt    185040
     tattatccaa ttatttatag actaccagta aaaccatcgt atcttctaaa ccgaaacaga    185100
     ccaaatcaac tcacccaaac caataaacga caccaactca agtcaagcag cacataagaa    185160
     aaacatttca cattatctgt gtttgatata atgcaaatga ttaaattgta atgatactgg    185220
     taattagatt caattttcca atattttgat gatactgata actatctaca atgttaatat    185280
     ttgtaacatt gaatttgtgg aaaatataga tagccttaac atttaaaaga agcgtatttg    185340
     aagtacatgt tgaagatggt gagtagatat ttcgtcatgc atgtgtggaa aagcaaatca    185400
     gtagaattta gataacatat aaatgaaggc cacgtaatgg tgagtcactc cttgatttat    185460
     tttaagaaca tttctgactt gtacaagcta caattcaagc taacactttt tcatactttt    185520
     cgaggacaaa actcatgcaa tatttaagtt taaggacaat tcattgttat ttttataaat    185580
     tattggcata ttatttttct tgttgcatgt gtgttagaca ctaaaaaacg aattgagact    185640
     tgttattaaa acaaatttct atgattgtgt tagcaaatta ctaacatttg ttctttggtc    185700
     aagtaaggct ttttttactg tacacaatat aattagttct gaccagtaga ggattttatt    185760
     ggtcacatta attagcgtcc gtttaaaatt acttaccaac caaaaaacag tatatagatt    185820
     taaaactttt aaaagatatt ttgataactg ttatctggtt atttccaaaa tcacaacgta    185880
     aatttaatca atataagcaa aaataggaat tatcgattct tatcttctgt ttttgacatg    185940
     gaattatcga ttcttatcta aaatgataaa aaaaaacaca gtcaacataa tagctaaaaa    186000
     aaccagtaaa atatagcaaa aaattacacc agaaaatcaa atcactgact gatcataaat    186060
     ttccttatcg taaaatttag acaatacaaa aaaagaaata aacagaaagt cgttcctggt    186120
     ttggataaat ataaaaagta gttgtttaga aagaaacaaa taattcgtca ataaggactt    186180
     agattttctc caaatattaa ggaggggaat tgtctcataa tccttatcca ccactataaa    186240
     taccgtaact cctaattaaa ctcgtaaagt cttcatcgca gaagtatata taatcaaaaa    186300
     gcaaatcgag ttattttctc tctcaattca tcccaaaccg tcgtaaccat tctctttcgt    186360
     ttcgtttcgt ttcttctctt ttaaaaacct ttcttcgaaa agatgacgat ctctgttgag    186420
     aagccgattt ttggtaagaa tctattctca caatcttttg ggaaataacg tctttatcaa    186480
     gatattatta ttttccggct aaatcaacga ttttctagga aaataatgta ttttggtggt    186540
     ggctaattca caacaagttt ttgggatttt tttgtgtcta aattatatat atcttacaaa    186600
     gatttttttc tttcaagaag aagaggtttc tgcattcgag aagagtgggg acaatatcgg    186660
     agagttgaaa ttggacggag gattttcgat gccgaaaatg gacaccaatg acgacgaagc    186720
     ttttttggct cctgagatga atgcatttgg ccgccaattc aggtttcttt ttcttccaca    186780
     tttttctatt caattcaaga atgaagaaaa tatttaatta aatcaaactg agtgtttttt    186840
     gtttgtttgt ttggccggat ctaaaccttg acttgatcca taacgtgtac attggtggta    186900
     tttggtcgca gggactacga tgttgagagt gagaggcaaa agggcgtcga agagttttac    186960
     agattacaac acatcaacca aactgtcgac tttgtaagat tcttaaaaaa gttattaggg    187020
     tttatgtgta taatgacaca tcttattata acttatgtga tccaggtagt atatgtatac    187080
     ttttatttaa ttaataaata atataaataa ttgtatgttt tgtaggtgaa aaagatgagg    187140
     gctgaatatg gaaaattaga taaaatggtg atgagcattt gggaatgttg tgagcttctc    187200
     aatgaggttg tggatgagag tgatccagat cttgacgagc cccagattca gcatttgctt    187260
     caatctgccg aagccatccg caaagattac cctaatgaag attggcttca tctgaccgct    187320
     cttatccatg gtaaatttgt tgtaaccaat agtcttttct atgaattaat tagagcagga    187380
     acgatacgtc ctcgtccaat attttgaccg aatgagttgt tctaatggaa ttttcagatc    187440
     ttgggaaagt tattactctt ccacaattcg gaggacttcc tcaatgggct gttgttggta    187500
     agtcaagttt gattttgtca ttaatatttt gaatatgcga actatatttg aaactaattg    187560
     tttattccct cttacaaaaa cctataggtg acacattccc tgttggatgt gcatttgatg    187620
     aatctaacgt acatcacaag gtaaataatt gattcaatct cttaagttgt tgatagaaat    187680
     taatttatta gttttgttga aatttctata catactctca aaatatagga ttctcatttc    187740
     tttctcatga gtttataccc aaagcaagca acaattaact aacatatcgt ttctcttatc    187800
     cacagtactt tgtggaaaac ccagattttc acaacgaaac ctacaacact aaaaatggga    187860
     tttactctga agggtgtgga ttaaacaatg tcatgatgtc ttggggccat gacgactaca    187920
     tgtacctggt aattacttga ttatttttac agtttagagt aatgtttttt cagaaaagtt    187980
     taatcaatct tgagttttgt aaaggataaa gttgatgtta attaatattt tttttcaggt    188040
     ggctaaagaa aacggaagta ccttgccgtc ggctggacag tttatcataa gataccattc    188100
     cttttaccgt aagcacttca actaagaaat atatgatttt agtaacatta taaatttgta    188160
     gctatgagta aaggttattt taataaatca attgaatata tgcagctttg cacacggctg    188220
     gagaatacac ccatcttatg aacgaggaag acaaggagaa tctgaagtgg ctacacgttt    188280
     tcaagtaatc acattttctt aaacatgatt aagtgatttg ttgtttctcc taatagcatc    188340
     tctaaactgc tatatatata tatgaatttt attacagcaa gtacgacttg tacagtaaga    188400
     gcaaagttca cgttgatgtg gagaaggtca agccttacta catgtctctt atcaagaaag    188460
     tgagtatata ttgcatgctc attacaaaaa acaatgaaaa gtgtattaat attgaaaaca    188520
     ttcatatatt tctaaattct tcagctgact ataaattctt tcttctcttt ttcgattttg    188580
     cagtatttcc cggaaaactt gaggtggtga attcggtgga gtaaaaaagt gcccatggag    188640
     gattagtcgt tttatttact tacaaatatt tttacacatt ttcgagttaa tgtgaatcta    188700
     ttgtaattgt gttatatata tcttatgtta atcatattca ggctgtctct gaaatgtaat    188760
     cacaatcaac cctcgtgaat gctaaagagt ttgtacgtcg ggtgatataa gatcttaaat    188820
     aatgaagttt atttataata atctaagcct ccaaggtcta aaaattgtgc attgtaatgt    188880
     aaacaaagtt ttattaacgt aactctaagt gtacaatatt acattagtac tgatacatcc    188940
     atgcgaacaa tgtcatgacc tttaatgctc atactcagat agaggtgttc aaattgatca    189000
     cggtatcttt gcatcttcgc ttctgttagg tcatggacag aagagaatta cgtaccaaac    189060
     aggtgtaatt cgtaagatac gtaatcacat atttctatat gacgatgata atgatctagt    189120
     ataactgtca tttcgtatga aattatctac aaaatttatg ttgatcacat ggttaaaact    189180
     ttgaaggatt caccatgtta tagttgaaag caagaacttg aatatttgca ttttgatttc    189240
     agcaaagaac atatttttaa cgtcttaaat agcaaataat caatcatcac attgacatga    189300
     tcatgcattg acaattcgta gctagattat tctatatata agcagaatgt aaaatgggat    189360
     aaatggaact tatttatatg acgtgggact aaagcatcat gacgtggaaa attacaacgt    189420
     gaggcatcta acaaagattg ctttgttatg ccaaaaaggg taaaaccgtc aacaccctat    189480
     tattttactc aactacctaa aacatgtaac atcttttgaa aacgcaaagc ttttctgtcg    189540
     ttgttcttat gttcaggtca cttggtgatc tctttggtga ctggaggaac atccaccacg    189600
     ccattgcagt taccatcgtc aaggagagcc gacatcggtt tctctttatt atcaaagaca    189660
     tctttggggc ccaagaaact cggctggttt gtcgaagaga gtagccttgc ccacatcctg    189720
     tctgtgatca ccacatggtt ctgtttctcc gttatcctct gtaacataaa aatgatgttt    189780
     acataaaagt gatactatga ttatgatgat atgaggatga tgactttaac ggtgatgata    189840
     actgatgaca gtatgatgat actggtataa tgatcatgca tcatcaattt ttggtgctct    189900
     attttttgat tgccaaagca tgctatcaca tcattaaaat ttaaatcgat tttatgactt    189960
     acgtaaaagg gtatgtaggt ttgtcttccg ttcactagac cactgatata gccagtgtat    190020
     ccagccattg caccgtgcac tgcactctga gccagaagtg tacaataaac attgtctgac    190080
     gcattgctag gaacagctcg aatcatgtat gttggatctg aaattaagac aagaaaaatg    190140
     aacaatcaag aaactcatgg tggagagaat gcaatgcaag ggatataaat tgtacctatg    190200
     tacttgaggt tcatcaccat cttcttctga ttaaaatgat cctacaaccg agtaaaacca    190260
     aaatttagta gtaggtgagt ttagtctgat tttcctatgc atcaatgttt gatgctgtct    190320
     ctgtaattta tggtttacct tgatgctttg tgacagccaa aggccaacat ctttaagaag    190380
     tttgttacca gatgcatctt tgagtgtcat agattccatg ctcttcgaca ttagatcttg    190440
     tcctgcacct tctgcaatca caagaaccat gtgaccgctc tccttgagtc gtttctctat    190500
     gtactcaaac agtccgcctt ctccttccag gtaaaatggt gactccggaa tcaaacagca    190560
     gtccacatct ctgcttgcta gagtggcata catcgctatg aaccctgtta aagcagtgaa    190620
     caaacttgtg aaatagtcta ataagagagc ttgataaggc aaagaagaag tagaagagtg    190680
     aattctcacc gctgtagcga cccataagct tgacaactcc gataccattc tctatactct    190740
     cggcttccac atgtgctgca ttaatagctc gttgagcctc ttctacagca gtgtcaaacc    190800
     caaaagattt gtctatcacc tgcacaaata caaaagtcaa gttctcaatt tctccacata    190860
     agaaatacag ctcttctata gagacaaagc agtagaaaga gatacataca ggtatgtcat    190920
     tatcgattgt tttcgggatt ccaataactg caactttcag gccacgtctt ctaatttcct    190980
     acatggttac caccaaaaga tcagtaaaca ctgaaattgt agaattgtaa ggtagaagtg    191040
     aaatttacct caaatatgac agatgctcct cgctgtgttc catctcctcc tataatgtaa    191100
     acctgaacga tgaaaaaaac tacatcaaga acgagtttgt atgtactctt ggaacagaac    191160
     acggtgtaaa gaggtgatgg ttatcaaaac ctgattgatt cctcgatctt gaatgctgtc    191220
     aactatcttt gtggtatcgt gaccacctcg tgaggtccca aggatagtcc ctccacgctt    191280
     atggatatca tttacaactt tagagtccaa ggagacagta ttcttagcat aaaagcctct    191340
     atatccaccc tgaaaaagtc tcaagcatgt gaaaatgaaa caaatgaata ccgtgtttgt    191400
     tttggtaaga aggagattac aatcacagaa acttacatct attcccagta ttctcttcac    191460
     tccatacata taagatagac tgctcactat ttctctaatc acggtattaa ggccaggaca    191520
     aagacctcca caggtaacta tgcaagcatg cacttcatca gattcgaagt atacctgcag    191580
     agaactaagt caacaacaga ccctattgaa atggaaaaag gactttaaag caattcgata    191640
     aaacgacgaa aaaccttctg acgtggcccg gctcgtctaa aatgaatccc ccttggacca    191700
     tccttgtgaa caacgatcta aaacaacaaa aagaagagtc agtaagacaa aacatgagct    191760
     ccaaattctc aggatgccct gatattatag aaagaaccca accaaatata taccttttga    191820
     ggaacactgt catcagcatc aacaaagtat tgcctgaaaa tttccaaaaa taaaaaacta    191880
     atgtaacaac tgcaggctaa tgattgaatc accataggac acaattagga accttagtca    191940
     ccaaaacatc tgtgagaaag gacttactta accactgagt aagctggatt gtcttgcaat    192000
     ggattaggat aagtctacaa taacataaaa ccaaaagaaa attgaccatt aatcaaaact    192060
     taaccatcat tcgatcccaa aaataacatg gtaaaaggac aaaaactctt aaaccatgct    192120
     acagattttg atccaggttc ataattcttg agacccaaat acaaaagacc cctttttctt    192180
     taccctgggc tatcttatac taatcagaat ctgggaaatt catttcatct atctcaaatt    192240
     ccaaacaaaa aaactaaaca gtcctcagct gaaaaaattg atatataaat atctatcaac    192300
     atagatcaaa gtttcaacct tttgcaacag ttaaagctca aaagcaaaag ctttaatcaa    192360
     atcagattaa aaaaagagag aggtaaacat acaggaagac caggaaggta atcggagaga    192420
     tgcggtacat cttctagaac ataaccacaa gagccattga tgatcttcgg tttgctactc    192480
     tccacagtac tcataacgaa cgctcgaaac agaggaacaa caatttcagg ggaaaagtct    192540
     tataatataa taaaaaacga tttttttttc tggtatagag acttttgaac tggtcaacta    192600
     caaattgaat acgaaagcag gaagaaaggt aaaaagaaag atgaatcaaa tccgttgatc    192660
     aaaaacaagg cgacccattt ttataggagt agagaaattt tgaccattgt agtcggtaaa    192720
     caaattacaa agccaggtag agatagagag agagaggaaa ccattaaagg tcttagctat    192780
     gtgcggaaat ggtggttttg gtcactgctt tgtagattat ttgacagtaa cgacgactag    192840
     tacaagtact tgcagagaaa gatcgatatt tttctagaat tgatatttgt ttattggttt    192900
     tctattttgt taccttttat tgattttttc caactgttgg gcttggttat caagtcaagg    192960
     tcaagccatg cattaatacg gtccgaccga taaccgaaat aaccgatccg gtttattatt    193020
     tctcagaatt ttgaaaccat gaacctttac atgatcaaag gatacaggta cttattgtta    193080
     caatgcattt caaaggaaaa caaaacacaa acaacacata aacatcacta attcagaatt    193140
     ttaaaaccat gcaccttaac atcagaaggg tcacttatta attattacaa tgcattttca    193200
     aaccaaacct cggaataatc tttgagtttc tccttcatga tcatgtcgat tttgctaccc    193260
     atttccggag ttagatgatt cttccagtca ccaactatcc ctttgcggaa atggttcttg    193320
     tactctatgc cattgattga ctttccggtc ttgttaacct ccaaactgct caggttaggc    193380
     agagaacaca tctccaagat cttatttaga gatccgttct tttcttcttc cttagaaaat    193440
     ggacaaccca aaaactctgc gagtttcttg agctgaccat gaggatctgt ttttatctca    193500
     tcatacctca tgaaaagcac ttgctttggc ttttccaagc tagctttcca gtaactcagg    193560
     atatgatccc aaaacggacc aaacaagcag actccgctgc aaaaggactc aaacatagac    193620
     tcaagaatgg ttctgtcctc ttctttattc agactcctgc aaacgatatg ccaacgtgac    193680
     accagcgaat ctttcgcgtc cctgcagatg taaaccacct tgcaaggaga gtccttgaca    193740
     gctacttgca gcgtgtggaa aggcgtgtga gtagagaaca accttggaga tgatgatgag    193800
     agctaggtca agtccggtgt ttgggtatcc cggtaaagat tcatctcaag gacaggtacg    193860
     aggttgtgag gattgttgga tagaagagga tggctcatag gatcatcatg agaagggttc    193920
     tttgttctct caaaaagcgc gacagtgagt gccttgagcc acagggtgcc ggattttggg    193980
     tacgatgcga cgataatatc agtgtcttga ggcttaaaac ctctctggaa attgagaaca    194040
     ccttggagaa agttgtagta ataccaagag ccttggtact tgcagaggtt tcgaccgagg    194100
     taccctttct ctgaagaaag tgaagagatt agagtctttg tttcttccgt taagtcttcg    194160
     tctctcaagt tcatccactt ctccattttt cttttgtttt tacttttagc gacttatttt    194220
     gaatgctgtg tttgcttcaa acccctagta tcactattta tattaaaatg ttaaaatata    194280
     tgatccaata aaacgtttac acatcacttt taaaaatatt tattttattt tattacgaac    194340
     atgtatctca aaaatcgaga ggcaatagtg acgtacaaaa acaaaaagag agataacgtg    194400
     gtaggggatt atgaaattat gaatcagaaa ttatagtgca tgtattttta tactagaagt    194460
     gtaatacata caaaaaaaag ttcttttact cgtgaaaagt atgtcttcct ataactagca    194520
     tacgataact ataaacttga tatttttaaa agtaaaaatt ctgtcttctt tgtctatgag    194580
     ataataggac attaaaatcc aaagattcca aaattatctt ttctgctgcc aaggattcca    194640
     ttcactttcc aactggtatc taccatcgat ttttatctat ttgtacctca gcctgcccga    194700
     atggtcattt gatgattcaa taatatacaa tgtcctgacc tatacatatc acttagggca    194760
     tcacttattc actttaatcg agagtgttta tattggaaac gtacatgaca tcgcaatgtc    194820
     agcattaatt atttaaatat tttaatatat tcctatcgca agataatgtc taagttagat    194880
     tataggttca acattctgca actttcatat attttttttt taagctggtt aacaggttag    194940
     tttaagtgtt tgacgtaacc ataagagaat tgattcattt tagcttgtgt gtaatagttg    195000
     gcgggaaggg taattttgtt ggcatactct tctctgctat ttaaccaggg cttgaataac    195060
     aaatatggat gtgacattga cacagttcat aagcaaatat acaaaattga gggagcaaat    195120
     ttacgtaaca ttttgtaaaa tttacgtgta tatataattt atcattagct tacaattttt    195180
     atactcgtag aattgcacaa caccataatt aatgcataaa atctccattt ataattcaaa    195240
     ccatcattta gaaattaaga gatgaccata tgtaacatgt tagggtagat gtgattatgg    195300
     tgctaaacta aagaagaaga ctagattgtt ggaacgaaat tagaactcac ggaacacgtt    195360
     ggcatgtcca ggagaatagt tatttacatg acatcattga tagcataaaa aacatggata    195420
     aagttaataa cgttcaaatg gtcaccataa ttacaacaat ttcctttaaa gcattcacaa    195480
     caatttctga tctagaatgg ttatatctac tcgaatttga atggaaaaaa aataaaaata    195540
     aaaataagat aaaagagtca accttatgtc caattcaaga taattgttaa aaaaacaatc    195600
     caaaattcga tttcagtcgt tcataattta tattcaattg ggatttggga tcaagataaa    195660
     agagtcaacc ttatgttttt atgagaggct agagaaaaaa tagattatga ttaataaatt    195720
     tgatagaaga aacagagtaa aacgttatcc acaggccaca gcttgcacgt aagtaatacc    195780
     tatacattat cgtttattcg ttatcctttt ttctcttact aaaccgtatc tcttcgctta    195840
     tctacatgtg taatcctcta cctccctcta tatatataca aaacacaact tttatcaaaa    195900
     aaaaaaaaaa aaactagaac agaacacaaa catctcgaca agaactctct gttctttctt    195960
     atcaaaaaaa aaaagaactc tctgttctgt tcttattgat caagaaacct tttcttgtcc    196020
     ttttggttaa gacttcaaaa gaaagatcaa atcagaatct aaacataatt gacaaaagaa    196080
     gaagagatga acattcgcga tggtaatctt atttcgacta caaaagaaga agagggtgtt    196140
     attggagttt caggatcctc tgcaaaagtt tcatcttcat cttctatctc tatgtgttca    196200
     tctgatttaa cagaggatgc ttcttcttct tcttcttctt cttcttcttc ttcaaatggg    196260
     cctttcgacg atctttcgga cctcat                                         196286
//

If you have problems or comments...

PBIL Back to PBIL home page