(data stored in SCRATCH zone)

EMBL: AL161565

ID   AL161565; SV 2; linear; genomic DNA; STD; PLN; 198320 BP.
XX
AC   AL161565;
XX
DT   16-MAR-2000 (Rel. 63, Created)
DT   14-NOV-2006 (Rel. 89, Last updated, Version 3)
XX
DE   Arabidopsis thaliana DNA chromosome 4, contig fragment No. 65
XX
KW   .
XX
OS   Arabidopsis thaliana (thale cress)
OC   Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
OC   Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae; Pentapetalae;
OC   rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis.
XX
RN   [1]
RP   1-42972
RA   Rose M., Hempel S., Entian K.-D., Mewes H.W., Lemcke K., Mayer K.F.X.;
RT   ;
RL   Unpublished.
XX
RN   [2]
RP   25731-106407
RA   Vandenbol M., Jallet C., Portetelle D., Mewes H.W., Lemcke K.,
RA   Mayer K.F.X.;
RT   ;
RL   Unpublished.
XX
RN   [3]
RP   68133-160789
RA   Zimmermann W., Grueneisen A., Wambutt R., Kalicki J., Wohldmann P.,
RA   Smith A., Mewes H.W., Lemcke K., Mayer K.F.X.;
RT   ;
RL   Unpublished.
XX
RN   [4]
RP   92775-93172
RA   Volckaert G., Grymonprez B., Voet M., Robben J., Mewes H.W., Lemcke K.,
RA   Mayer K.F.X.;
RT   ;
RL   Unpublished.
XX
RN   [5]
RP   149164-198320
RA   Lecharny A., Chefdor F., Krivitzky M., Kreis M., Mewes H.W., Lemcke K.,
RA   Mayer K.F.X.;
RT   ;
RL   Unpublished.
XX
RN   [6]
RP   1-198320
RA   EU Arabidopsis sequencing project;
RT   ;
RL   Submitted (10-MAR-2000) to the INSDC.
RL   MIPS, at the Max-Planck-Institut fuer Biochemie, Am Klopferspitz 18a,
RL   D-82152 Martinsried, FRG, E-mail:
RL   lemcke@mips.biochem.mpg.de,mayer@mips.biochem.mpg.de Project Coordinator:
RL   Mike Bevan, Molecular Genetics Department, Cambridge Laboratory, John Innes
RL   Centre, Colney Lane, NR4 7UJ Norwich, UK, E-mail: michael.bevan@bbsrc.ac.uk
XX
DR   MD5; 7af372ebf2e5b2e6e1e6c349a48b0b8f.
DR   ENA-CON; AJ270060.
DR   GOA; B3GS44.
DR   InterPro; IPR039307; LORELEI-like.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00069; SNORD24.
DR   RFAM; RF00204; snoR12.
DR   RFAM; RF00768; MIR405.
DR   UniProtKB/Swiss-Prot; B3GS44; LRE_ARATH.
XX
CC   Information on performance of analysis and a more detailed annotation
CC   of this entry and other sequences of chromosomes 3, 4 and 5 can be
CC   viewed at: http://www.mips.biochem.mpg.de/proj/thal/
CC   this fragment has an overlap with ATCHRIV64 at the 5' end and an overlap
CC   with ATCHRIV66 at the 3' end.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..198320
FT                   /organism="Arabidopsis thaliana"
FT                   /chromosome="4"
FT                   /variety="Columbia"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:3702"
FT   gene            5578..10287
FT                   /gene="AT4g26300"
FT   CDS_pept        complement(join(5578..5688,5802..5900,5995..6063,
FT                   6449..6538,6620..6689,6872..6941,7047..7233,7337..7421,
FT                   7592..7770,7871..7975,8089..8172,8302..8382,8490..8705,
FT                   8795..8896,8975..9050,9148..9287,9374..9448,10198..10287))
FT                   /gene="AT4g26300"
FT                   /product="arginyl-tRNA synthetase"
FT                   /note="Contains Aminoacyl-transfer RNA synthetases class-I
FT                   signature AA190-201"
FT                   /note="contains EST gb:AI995766.1, T76307"
FT                   /db_xref="GOA:O23247"
FT                   /db_xref="InterPro:IPR001278"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR005148"
FT                   /db_xref="InterPro:IPR008909"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR035684"
FT                   /db_xref="InterPro:IPR036695"
FT                   /db_xref="UniProtKB/Swiss-Prot:O23247"
FT                   /protein_id="CAB79485.1"
FT                   /translation="MFIFPKDENRRETLTTKLRFSADHLTFTTVTEKLRATAWRFAFSS
FT                   RAKSVVAMAANEEFTGNLKRQLAKLFDVSLKLTVPDEPSVEPLVAASALGKFGDYQCNN
FT                   AMGLWSIIKGKGTQFKGPPAVGQALVKSLPTSEMVESCSVAGPGFINVVLSAKWMAKSI
FT                   ENMLIDGVDTWAPTLSVKRAVVDFSSPNIAKEMHVGHLRSTIIGDTLARMLEYSHVEVL
FT                   RRNHVGDWGTQFGMLIEYLFEKFPDTDSVTETAIGDLQVFYKASKHKFDLDEAFKEKAQ
FT                   QAVVRLQGGDPVYRKAWAKICDISRTEFAKVYQRLRVELEEKGESFYNPHIAKVIEELN
FT                   SKGLVEESEGARVIFLEGFDIPLMVVKSDGGFNYASTDLTALWYRLNEEKAEWIIYVTD
FT                   VGQQQHFNMFFKAARKAGWLPDNDKTYPRVNHVGFGLVLGEDGKRFRTRATDVVRLVDL
FT                   LDEAKTRSKLALIERGKDKEWTPEELDQTAEAVGYGAVKYADLKNNRLTNYTFSFDQML
FT                   NDKGNTAVYLLYAHARICSIIRKSGKDIDELKKTGKLALDHADERALGLHLLRFAETVE
FT                   EACTNLLPSVLCEYLYNLSEHFTRFYSNCQVNGSPEETSRLLLCEATAIVMRKCFHLLG
FT                   ITPVYKI"
FT   exon            complement(5578..5688)
FT                   /number=1
FT   intron          complement(5689..5801)
FT                   /number=1
FT   exon            complement(5802..5900)
FT                   /number=2
FT   intron          complement(5901..5994)
FT                   /number=2
FT   exon            complement(5995..6063)
FT                   /number=3
FT   intron          complement(6064..6448)
FT                   /number=3
FT   exon            complement(6449..6538)
FT                   /number=4
FT   intron          complement(6539..6619)
FT                   /number=4
FT   exon            complement(6620..6689)
FT                   /number=5
FT   intron          complement(6690..6871)
FT                   /number=5
FT   exon            complement(6872..6941)
FT                   /number=6
FT   intron          complement(6942..7046)
FT                   /number=6
FT   exon            complement(7047..7233)
FT                   /number=7
FT   intron          complement(7234..7336)
FT                   /number=7
FT   exon            complement(7337..7421)
FT                   /number=8
FT   intron          complement(7422..7591)
FT                   /number=8
FT   exon            complement(7592..7770)
FT                   /number=9
FT   intron          complement(7771..7870)
FT                   /number=9
FT   exon            complement(7871..7975)
FT                   /number=10
FT   intron          complement(7976..8088)
FT                   /number=10
FT   exon            complement(8089..8172)
FT                   /number=11
FT   intron          complement(8173..8301)
FT                   /number=11
FT   exon            complement(8302..8382)
FT                   /number=12
FT   intron          complement(8383..8489)
FT                   /number=12
FT   exon            complement(8490..8705)
FT                   /number=13
FT   intron          complement(8706..8794)
FT                   /number=13
FT   exon            complement(8795..8896)
FT                   /number=14
FT   intron          complement(8897..8974)
FT                   /number=14
FT   exon            complement(8975..9050)
FT                   /number=15
FT   intron          complement(9051..9147)
FT                   /number=15
FT   exon            complement(9148..9287)
FT                   /number=16
FT   intron          complement(9288..9373)
FT                   /number=16
FT   exon            complement(9374..9448)
FT                   /number=17
FT   intron          complement(9449..10197)
FT                   /number=17
FT   exon            complement(10198..10287)
FT                   /number=18
FT   gene            11284..13244
FT                   /gene="AT4g26310"
FT   CDS_pept        complement(join(11284..11361,11487..11526,11704..11827,
FT                   12412..12481,12598..12648,12741..12754,12843..12873,
FT                   13014..13244))
FT                   /gene="AT4g26310"
FT                   /product="putative protein"
FT                   /note="similarity to elongation factor P (efp) RP238,
FT                   Rickettsia prowazekii, PIR2:B71678"
FT                   /note="Contains Elongation factor P signature
FT                   AA176-195;Prokaryotic membrane lipoprotein lipid attachment
FT                   site AA42-52"
FT                   /note="contains EST gb:F20046"
FT                   /db_xref="GOA:Q9STQ4"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013185"
FT                   /db_xref="InterPro:IPR013852"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR015365"
FT                   /db_xref="InterPro:IPR020599"
FT                   /db_xref="UniProtKB/TrEMBL:Q9STQ4"
FT                   /protein_id="CAB79486.1"
FT                   /translation="MRGLHHFKRISISRSLFSFSNATSPGAVTTRRSLYSLSRSLLSST
FT                   PYAAGGCCRETPPLHSPWSALQRRGVKVNAIQLRAGNVIERTGRTFRVVEAEHKQQGRG
FT                   GASIQVELRDVDTGNKLNLRFGSEESVEKEMKVQLQLYDGRALSASIPKHITCTVVETQ
FT                   LPMKGLTSAPRYKRALLDNGSTIQVPSYLEAGEKIVINTEDDSFVKRYY"
FT   exon            complement(11284..11361)
FT                   /number=1
FT   intron          complement(11362..11486)
FT                   /number=1
FT   exon            complement(11487..11526)
FT                   /number=2
FT   intron          complement(11527..11703)
FT                   /number=2
FT   exon            complement(11704..11827)
FT                   /number=3
FT   intron          complement(11828..12411)
FT                   /number=3
FT   exon            complement(12412..12481)
FT                   /number=4
FT   intron          complement(12482..12597)
FT                   /number=4
FT   exon            complement(12598..12648)
FT                   /number=5
FT   intron          complement(12649..12740)
FT                   /number=5
FT   exon            complement(12741..12754)
FT                   /number=6
FT   intron          complement(12755..12842)
FT                   /number=6
FT   exon            complement(12843..12873)
FT                   /number=7
FT   intron          complement(12874..13013)
FT                   /number=7
FT   exon            complement(13014..13244)
FT                   /number=8
FT   gene            14413..14592
FT                   /gene="AT4g26320"
FT   CDS_pept        complement(14413..14592)
FT                   /gene="AT4g26320"
FT                   /product="putative protein"
FT                   /note="contains EST gb:T44583"
FT                   /db_xref="GOA:Q9STQ3"
FT                   /db_xref="InterPro:IPR039281"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9STQ3"
FT                   /protein_id="CAB79487.1"
FT                   /translation="MEAMKMRLFVAVLVAAMAFSAVQQAAAVEAPAPSPTSDASLAIPA
FT                   FFASVATLAFGFLF"
FT   exon            complement(14413..14592)
FT                   /number=1
FT   gene            17586..20639
FT                   /gene="AT4g26330"
FT   CDS_pept        join(17586..17721,17908..18073,18117..18825,18930..18997,
FT                   19135..19383,19484..19598,19760..19973,20056..20639)
FT                   /gene="AT4g26330"
FT                   /product="subtilisin protease-like"
FT                   /note="strong similarity to subtilisin-like protease,
FT                   Arabidopsis thaliana, AF055848"
FT                   /note="Contains Prokaryotic membrane lipoprotein lipid
FT                   attachment site AA513-523;Serine proteases, subtilase
FT                   family, active sites AA518-528"
FT                   /note="contains EST gb:H37371, H36411, AI994965.1, T76394,
FT                   T43440, AI993428.1"
FT                   /db_xref="GOA:Q9STQ2"
FT                   /db_xref="InterPro:IPR000209"
FT                   /db_xref="InterPro:IPR010259"
FT                   /db_xref="InterPro:IPR015500"
FT                   /db_xref="InterPro:IPR023828"
FT                   /db_xref="InterPro:IPR034197"
FT                   /db_xref="InterPro:IPR036852"
FT                   /db_xref="InterPro:IPR037045"
FT                   /db_xref="InterPro:IPR041469"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9STQ2"
FT                   /protein_id="CAB79488.1"
FT                   /translation="MISSMNFWRCRCSKDDAEQSMLYSYNNGFLGFSAKLNSTQAASLA
FT                   KLNQVITVFKSKSLKLHTTRSWDFLGLAVDNARRTPPPQLAYGSDIVVGIFDTGLFISL
FT                   KLLLLSILGIWPESESFRETPEAKPIPSSWNGKCVGGEDFDPSVHCNRKLIGARFYLRG
FT                   FEETYGTIDFTRDPEYRSPRDYLGHGTHTASTAVGSVVRNVSGFFGLGRGTARGGAPLA
FT                   RLAVFKTCWGKDLEGVCTEADILAAFDDAIHDGVHVISASFGYSPPLSPFFESSADIGA
FT                   FHAAERGISVVFSTGNDGPDPGVVQNVAPWAVSVAASTVDRSFPTRIVIDGSFTLTGQS
FT                   LISQEITGTLALATTYFNGGVCKWENWMKKLANETIILCFSTLGPVQFIEEAQAAAIRA
FT                   NALALIFAASPTRQLAEEVDMIPTVRVDILHGTRIRNYLARSPTVPMVKIGPSKTVIGE
FT                   TTAPSVAYFSSRGPSSLSPDILKPDITAPGIGILAAWPPRTPPTLLPGDHRSIEWNFQS
FT                   GTSMSCPHVAGVMALLQSAHPDWSPSAIRSAIMTTAYTRDTSYDLILSGGSMKSTDPFD
FT                   IGAGHINPLKAMDPGLVYNTRTDDYVLFMCNIGYTDQEIKSMVLHPEPSTTCLPSHSYR
FT                   TNADFNYPSITIPSLRLTRTIKRTVSNVGPNKNTVYFVDIIRPVGVEVLIWPRILVFSK
FT                   CQQEHSYYVTFKPTEIFSGRYVFGEIMWTNGLHRVRSPVVVFLSNAGFLASS"
FT   exon            17586..17721
FT                   /number=1
FT   intron          17722..17907
FT                   /number=1
FT   exon            17908..18073
FT                   /number=2
FT   intron          18074..18116
FT                   /number=2
FT   exon            18117..18825
FT                   /number=3
FT   intron          18826..18929
FT                   /number=3
FT   exon            18930..18997
FT                   /number=4
FT   intron          18998..19134
FT                   /number=4
FT   exon            19135..19383
FT                   /number=5
FT   intron          19384..19483
FT                   /number=5
FT   exon            19484..19598
FT                   /number=6
FT   intron          19599..19759
FT                   /number=6
FT   exon            19760..19973
FT                   /number=7
FT   intron          19974..20055
FT                   /number=7
FT   exon            20056..20639
FT                   /number=8
FT   gene            21308..22737
FT                   /gene="AT4g26340"
FT   CDS_pept        join(21308..22144,22450..22737)
FT                   /gene="AT4g26340"
FT                   /product="putative protein"
FT                   /note="similarity to various predicted proteins,
FT                   Arabidopsis thaliana"
FT                   /db_xref="GOA:Q8H1R7"
FT                   /db_xref="InterPro:IPR001810"
FT                   /db_xref="InterPro:IPR006566"
FT                   /db_xref="InterPro:IPR013101"
FT                   /db_xref="InterPro:IPR032675"
FT                   /db_xref="InterPro:IPR036047"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8H1R7"
FT                   /protein_id="CAB79489.1"
FT                   /translation="MDRISQLSDDLLLQILSFIPGKDVVATSLLSKRWQSLWMLVSELE
FT                   YDDSYHTGDYKSFSQFVYRSLLSNNAPVIKHLHLNLGPDCPAIDIGLWIGFALTRRLRQ
FT                   LKINIRTSSNDASFSLPSSLYTSDTLETLRLINFVLLDVPSSVCLPSLKVLHLKTVDYE
FT                   DDASLPSLLFGCPNLEELFVERHDQDLEMDVTFVVPSLRRLSMIDKNYGQCDRYVIDVP
FT                   SLKYLNITDDAVYDVRQIENMPELVEAHVDITQGVTHKFLRALTSVRQLSLCLSLSEKQ
FT                   HESGLCGIETPIGWKLPSSVPECLLFSLEAFEWIGYKGRRGDREVATYVLKNAACLRTA
FT                   KFSPESTDVGEKYHMLKELASVPTASTSSKLLFD"
FT   exon            21308..22144
FT                   /number=1
FT   intron          22145..22449
FT                   /number=1
FT   exon            22450..22737
FT                   /number=2
FT   gene            24031..25493
FT                   /gene="AT4g26350"
FT   CDS_pept        join(24031..24897,24977..25111,25200..25493)
FT                   /gene="AT4g26350"
FT                   /product="putative protein"
FT                   /note="similarity to various predicted proteins,
FT                   Arabidopsis thaliana"
FT                   /db_xref="GOA:Q9STQ0"
FT                   /db_xref="InterPro:IPR001810"
FT                   /db_xref="InterPro:IPR006566"
FT                   /db_xref="InterPro:IPR013101"
FT                   /db_xref="InterPro:IPR036047"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9STQ0"
FT                   /protein_id="CAB79490.1"
FT                   /translation="MDIISQCPDHLLLRILSFIPTKDVIVTSLLSKRWGSLWRWVPKLE
FT                   YDFTRQNMRFVKFVYRSLLQNNAPVLESLHLKNIILYAECRTVDIGGWIDIAVSRRVRE
FT                   LEISINCSDEKFRLPSSLYTCGTLESFILTIKHCHLVDVPLAVCLPSLKKLHLRCIGWA
FT                   YNATLLRLISGCTNLEELRLARPDDDGDYIMIHEAGSTIDYMSIFERRYMFEFMFDQMF
FT                   GKGSSNGINAPLKYFSISNNYRIHNFRGIEKMPDWVEARIAVTGGSHKYLKEITYAKGL
FT                   YVCLSVSEVMNPYDMIFHMLVDLTICTCTQGWWDLLTHMLQGSPKLRFLTLTNDHCREL
FT                   PSLETPACWKRPSSVPACLLSSLQAFTWSGYKGRQGDKEVVKYVLRNATGLKKRIFISK
FT                   SNDFGEKFCMLQELASVPTPSPSCQLLFDRIF"
FT   exon            24031..24897
FT                   /number=1
FT   intron          24898..24976
FT                   /number=1
FT   exon            24977..25111
FT                   /number=2
FT   intron          25112..25199
FT                   /number=2
FT   exon            25200..25493
FT                   /number=3
FT   misc_feature    25731..42972
FT                   /note="overlap to BAC M3E9, EMBL accession AL022223 ;
FT                   please refer to this entry for analysis and annotation"
FT   gene            25941..29553
FT                   /gene="AT4g26360"
FT   CDS_pept        complement(join(25941..26124,26238..26826,26859..28122,
FT                   28165..29553))
FT                   /gene="AT4g26360"
FT                   /product="putative protein"
FT                   /note="similarity to RNA-directed DNA polymerase,
FT                   Arabidopsis thaliana retrotransposon Ta11-1, PIR2:S65812"
FT                   /note="Contains Prokaryotic membrane lipoprotein lipid
FT                   attachment site AA787-797"
FT                   /db_xref="InterPro:IPR000477"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="UniProtKB/TrEMBL:O65598"
FT                   /protein_id="CAB79491.1"
FT                   /translation="MSCGFNIPSHRNGFKKWFKVNRPIFGGVIEKHVKQPKDKKFINAL
FT                   LPGWFFDENYGFSDLGKIWVLWDPSVEVVIVAKSLQMITCEVLFPNSRTWIVISVVYAA
FT                   NEDDKRKELWREITALVASPVTFNRPWILLGDFNQVLHPHEHSRHVSLNVDRRIRDFRE
FT                   CLLDAELSDLVYKGSSFTWWNKSKTRPVAKKIDRILVNESWSNLFPSSFGLFGPPDFSD
FT                   HASCGVVLELDPIKAKRPFKFFNFLLKNPEFLNLVWDVWYSTNVVGSSMFRVSKKLKAL
FT                   KKPIKDFSRLNYSNLEKRTEEAHETLLSFQNLTLDNPSLENAAHELEAQRKWQILATAE
FT                   ESFFRQRSRVTWFAEGDGNTRYFHRMADSRKSVNTITTLVDDSGTQIDSQQGIADHCAL
FT                   YFENLLSDDNDPYSLEQDDMNLLLTYRCPYSQVADLEAMFSDEDIKAAFFGLPSNKACG
FT                   PDGFPVTAAVREFFISGNLLKQWNATTIVLIPKFPNASCTSDFRPISCMNTLYKVIARL
FT                   LTDRLQKLLSCVISPSQSAFLPGRLLAENVLLATEMVHGYNWRNISLRGMLKVDLRKAF
FT                   DSVRWEFIIAALLALGVPTKFINWIHQCISTPTFTVSVNGCCGGFFKSAKGLRQGDPLS
FT                   PYLFVLAMEVFSKLLNSRFDSGYIRYHPKASDLSISHLMFADDVMIFFDGGSSSLHGIC
FT                   ETLEDFASWSGLKVNNDKSHFFCAGLEQAERNSLAAYGFPQGCLPIRYLGLPLMCRKLR
FT                   IAEYEPLLEKSPKNSDHGQQIVYLTQVEFNLLLPLSMVSSTFGCPLSCCQRVALRRLKA
FT                   FVLGSFERETLMVVEEQRSLGLLFASQKMKVGLALEDSPSGTKRFVCVLFGFSLIIKVR
FT                   FGFLGTLITILEADPWSWRMLLFLRPLAEQFVKCNLGNGRIAHFWHDSWTSLGPLIKVM
FT                   GDYGSRSLRIPLNARVVEALGVNGWKLPLSRSAPAQAIHEHISTIMTPSPATIEDSFDW
FT                   VVGGVVCQGSLRQGLGMLLDQEHRNWTGQRLFGSRVLFLSMPSTCGLVSWIDSQLVKGL
FT                   PLGAISSLSIVAYALLRLSPETISFFPVNLRLRKVSAHAIIYNIWRQRNNVLHNNLRIA
FT                   PLIIFKIVDREIRNIISSRYHRKRWRNLMVLWIR"
FT   exon            complement(25941..26124)
FT                   /number=1
FT   intron          complement(26125..26237)
FT                   /number=1
FT   exon            complement(26238..26826)
FT                   /number=2
FT   intron          complement(26827..26858)
FT                   /number=2
FT   exon            complement(26859..28122)
FT                   /number=3
FT   intron          complement(28123..28164)
FT                   /number=3
FT   exon            complement(28165..29553)
FT                   /number=4
FT   gene            31277..33331
FT                   /gene="AT4g26370"
FT   CDS_pept        complement(join(31277..31414,31516..31614,31885..31972,
FT                   32065..32119,32257..32391,32557..32633,33018..33255,
FT                   33301..33331))
FT                   /gene="AT4g26370"
FT                   /product="putative protein"
FT                   /note="similarity to transcription termination factor nusB,
FT                   Synechocystis sp., PIR2:S76233"
FT                   /db_xref="GOA:O65597"
FT                   /db_xref="InterPro:IPR006027"
FT                   /db_xref="InterPro:IPR011605"
FT                   /db_xref="InterPro:IPR035926"
FT                   /db_xref="UniProtKB/TrEMBL:O65597"
FT                   /protein_id="CAB79492.1"
FT                   /translation="MEGTFSPLCLHSHRSIGFTLVDSLRPTNLVSLRTGNKRSSSSSLR
FT                   LFLSPTRSALRTPTISAEEVKDVPMPKIDKSGRLSSPRAARELALVILYAACLEGSDPI
FT                   RLFEKRINARREPGYEFDKSSLLEYNHMSFGGPPVKTETKEEEDELVRHDEKESKIEAE
FT                   VLSAPPKLVYSKLVLRFAKKLLAAVVDKWDSHVVIIEKISPPDWKSAPAGRILEFSILH
FT                   LAMSEVAVLETRHPIVINEAVDLAKRFCDGSAPRIINGCLRTFVKDRATTSTPQALELK
FT                   QEVSV"
FT   exon            complement(31277..31414)
FT                   /number=1
FT   intron          complement(31415..31515)
FT                   /number=1
FT   exon            complement(31516..31614)
FT                   /number=2
FT   intron          complement(31615..31884)
FT                   /number=2
FT   exon            complement(31885..31972)
FT                   /number=3
FT   intron          complement(31973..32064)
FT                   /number=3
FT   exon            complement(32065..32119)
FT                   /number=4
FT   intron          complement(32120..32256)
FT                   /number=4
FT   exon            complement(32257..32391)
FT                   /number=5
FT   intron          complement(32392..32556)
FT                   /number=5
FT   exon            complement(32557..32633)
FT                   /number=6
FT   intron          complement(32634..33017)
FT                   /number=6
FT   exon            complement(33018..33255)
FT                   /number=7
FT   intron          complement(33256..33300)
FT                   /number=7
FT   exon            complement(33301..33331)
FT                   /number=8
FT   gene            35256..38738
FT                   /gene="AT4g26380"
FT   CDS_pept        join(35256..38212,38645..38738)
FT                   /gene="AT4g26380"
FT                   /product="hypothetical protein"
FT                   /note="similarity to various predicted proteins,
FT                   Arabidopsis thaliana"
FT                   /note="contains EST gb:AA651112"
FT                   /db_xref="InterPro:IPR001965"
FT                   /db_xref="InterPro:IPR004146"
FT                   /db_xref="UniProtKB/TrEMBL:O65596"
FT                   /protein_id="CAB79493.1"
FT                   /translation="MDSESELMISLISQLLSILGGGEDTHTPQLKSKLIALTCQLISLV
FT                   NSLDLDSQPEPESKLKSLIKQIIYVSNSVSEPGPESQSVSVVTKMISIIGSIDFDLKES
FT                   EPELMSLTSQIFALIMAMDEESELFSLLSEVASLVQTEEQKLINNQQVPPLTTEEEEKD
FT                   DLIYGYTDDMNWESELMFYIISKMISTLRGEDMCQEVARDFIAYANQLIPLIESLDMDS
FT                   NSEPKQEPKITSLVRQIISLSKVVSGPESQLVSLVTRIISITSSTDLDPTESQWRLTSV
FT                   TYKISRILKEIKDSEDSEMASLINQIHDLVDAEEGRKPESRLISSITQLMSHINSWSFY
FT                   SGMDPKIISLIIRIIYLVRSMDLDSQTKPKSELMSLVTQTIAVYNSMDLDSQPRPLRKV
FT                   VSVFSQYGFDVNSTVSDSESDSSENYVSHIKDSLKLEPEPELISFIHRIGSLVISMNPN
FT                   WEKLISFCPQFEVILSDDGKFQVEEGRLSKNQLSDDIPMKWNCLQVNWNLLKLHAGEKD
FT                   FTHFRCRGCNGDNHKENEKAPLEVKHPLHPKHPLQLVLSQSSGGRTRECYCCDEDLLHI
FT                   FYCCLACNFSMNVACTKKPAVLYRNHPRWHEHTLALFPRQASLTCNLCALADSSSPIYM
FT                   CPPCDFVVHLRCTGLPRVIKISRHLHRISFTFSFDRGDLSCSVCRRKIDEDYGGYTCIK
FT                   DGCSYAAHSKCATQKNVWDGIELEGEPEEVEEEVVDPFVTISDGVIQHFGHPQHHLRLD
FT                   ENTSRDYDEDKLCQACVMPIYFGNFYSCTQCNYILHEACANFSRKMHHPVHPHVLTLVN
FT                   SDGAINVRKECAACPWMCTTGFFYECSKEDFQLHVQCANLSEPLVHESHMHPLFLTSKP
FT                   GERRLCSACKESYFSVTRETFNCIECDFALCFRCATLPQKVRYKHDKHMLTLSYGEETS
FT                   TMTYWCEVCERNLNPKERFYKCDEYCSITLHIECMLGVALYIRPGSSWICFNNKKILIK
FT                   MKAKKVAYTGIEPVTFALLARRSNQLS"
FT   exon            35256..38212
FT                   /number=1
FT   intron          38213..38644
FT                   /number=1
FT   exon            38645..38738
FT                   /number=2
FT   gene            39385..41596
FT                   /gene="AT4g26390"
FT   CDS_pept        join(39385..39603,40235..40696,40784..41596)
FT                   /gene="AT4g26390"
FT                   /product="pyruvate kinase like protein"
FT                   /note="strong similarity to pyruvate kinase, Nicotiana
FT                   tabacum, PIR2:S41379"
FT                   /note="Contains Pyruvate kinase active site signature
FT                   AA222-234"
FT                   /note="contains EST gb:T46063, AA713162, T76023, AA404815,
FT                   AB015097, F20011, AA042524"
FT                   /db_xref="GOA:O65595"
FT                   /db_xref="InterPro:IPR001697"
FT                   /db_xref="InterPro:IPR011037"
FT                   /db_xref="InterPro:IPR015793"
FT                   /db_xref="InterPro:IPR015795"
FT                   /db_xref="InterPro:IPR015806"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018209"
FT                   /db_xref="InterPro:IPR036918"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/Swiss-Prot:O65595"
FT                   /protein_id="CAB79494.1"
FT                   /translation="MAMEQRPKTKIVCTLGPASRSVPMVEKLLMAGMSVARFNFSHGSY
FT                   EYHQETLDNLRQAMLNTGMLCAVMLDTKGPEIRTGFLKDGKPIQLKQGQEITISTDYDL
FT                   KGDEKTICMSYKKLAQDVNPGMVILCADGTISLKVLSCDKEKGTVRCRCENTSMLGERK
FT                   NVNLPGVVVDLPTLTEKDKQDILEWGVPNQIDMIALSFVRKGSDLVQVRKLLGKHAKTI
FT                   LLMSKVENQEGVANFDDILINSDAFMIARGDLGMEIPIEKIFLAQKVMIYKCNFMGKPV
FT                   VTATQMLESMIKSPRPTRAEATDVANAVLDGTDCVMLSGETAAGAYPELAVRTMAKICV
FT                   EAESTLDYGDIFKRIMLHAAVPMSPMESLASSAVRTATSSRATLMMVLTRGGSTARLVA
FT                   KYRPGIPILSVVVPEITSDSFDWACSNEAPARHSLIYRGLVPVLYAGSARASIDESTEE
FT                   TLEFASEYGKKKQLCKTGDSVVALFRTGNAIVIKILTVK"
FT   exon            39385..39603
FT                   /number=1
FT   intron          39604..40234
FT                   /number=1
FT   exon            40235..40696
FT                   /number=2
FT   intron          40697..40783
FT                   /number=2
FT   exon            40784..41596
FT                   /number=3
FT   gene            42131..43165
FT                   /gene="AT4g26400"
FT   CDS_pept        complement(42131..43165)
FT                   /gene="AT4g26400"
FT                   /product="putative protein"
FT                   /note="similarity to RING zinc finger protein, Gallus
FT                   gallus"
FT                   /note="contains EST gb:Z34755, N65737"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="UniProtKB/TrEMBL:O65594"
FT                   /protein_id="CAB79495.1"
FT                   /translation="MVNPVIGAEIKCPFCQSGFVEEMSREINGGSSSSLREVQDPEIDF
FT                   GTDRALSLWGPILLGMMSNPRRRRRFRRTEFGVDNDEVNVSDDVDGNDSVDIDRHHHRR
FT                   HRHRQQGREIDLDREFESILRRRRRSSATILQLLQGIRAGIASEYESSDRDLLNQSAVV
FT                   QGSTSLNQNRNNTSLSAIGDYFVGSSLDHLLEHLADNDSIRHGSLPARKEVVDNLPTVK
FT                   ISESLQCSICLDDFDKGSEAKEMPCKHKFHIRCIVPWLELHSSCPVCRYELPPDDETKV
FT                   NPVRPRTRTLEINVSNENVEDDARNSNVSERRFSFPWPFSGLFSSSSSSSASASGSSHL
FT                   GENS"
FT   exon            complement(42131..43165)
FT                   /number=1
FT   gene            43938..45969
FT                   /gene="AT4g26410"
FT   CDS_pept        join(43938..44180,44673..44739,44956..45033,45269..45467,
FT                   45555..45619,45735..45793,45880..45969)
FT                   /gene="AT4g26410"
FT                   /product="putative protein"
FT                   /note="contains EST gb:T46533, AI999195.1, AA394459"
FT                   /db_xref="GOA:Q84K90"
FT                   /db_xref="InterPro:IPR016803"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q84K90"
FT                   /protein_id="CAB79496.1"
FT                   /translation="MSETEATGVTDDSAPAIETETVSDAMEHTAIGVVESVEGAIEGAE
FT                   KWVGDLQRTVKESKDTAMRSARSLRENSTSQFRSIQDFIPHALTQYKTYENAFFSKVTD
FT                   ELIYAKEHPAAAIGIGVAASLVLMRVALVCVPSLIFTSTSKSSSLQAQFLKAEKHVQEL
FT                   NMSVDLMKKESRKLLERTALAEKDMKRGLSELMNSGNDIHRLAKSVHKAECEAADLMDG
FT                   LRQIPGRDAIKLRAEVASMTSLLRQKRIALNKRIMGMSDLGVSV"
FT   exon            43938..44180
FT                   /number=1
FT   intron          44181..44672
FT                   /number=1
FT   exon            44673..44739
FT                   /number=2
FT   intron          44740..44955
FT                   /number=2
FT   exon            44956..45033
FT                   /number=3
FT   intron          45034..45268
FT                   /number=3
FT   exon            45269..45467
FT                   /number=4
FT   intron          45468..45554
FT                   /number=4
FT   exon            45555..45619
FT                   /number=5
FT   intron          45620..45734
FT                   /number=5
FT   exon            45735..45793
FT                   /number=6
FT   intron          45794..45879
FT                   /number=6
FT   exon            45880..45969
FT                   /number=7
FT   gene            46316..49664
FT                   /gene="AT4g26420"
FT   CDS_pept        complement(join(46316..46805,47197..47520,48157..48431,
FT                   48520..48807,49182..49664))
FT                   /gene="AT4g26420"
FT                   /product="putative protein"
FT                   /note="similarity to various predicted proteins,
FT                   Arabidopsis thaliana"
FT                   /note="contains EST gb:AI999195.1, AA394459"
FT                   /db_xref="GOA:F4JUY5"
FT                   /db_xref="InterPro:IPR005299"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR042086"
FT                   /db_xref="UniProtKB/Swiss-Prot:F4JUY5"
FT                   /protein_id="CAB79497.1"
FT                   /translation="MESSRSLEHVLSMQGGEDDASYVKNCYGPAARLALSKPMLTTAIN
FT                   SIKLTEGCSSHLKIADLGCAIGDNTFSTVETVVEVLGKKLAVIDGGTEPEMEFEVFFSD
FT                   LSSNDFNALFRSLDEKVNGSSRKYFAAGVPGSFYKRLFPKGELHVVVTMSALQWLSQVP
FT                   EKVMEKGSKSWNKGGVWIEGAEKEVVEAYAEQADKDLVEFLKCRKEEIVVGGVLFMLMG
FT                   GRPSGSVNQIGDPDSSLKHPFTTLMDQAWQDLVDEGLIEEEKRDGFNIPVYFRTTEEIA
FT                   AAIDRCGGFKIEKTENLIIADHMNGKQEELMKDPDSYGRDRANYAQAGLKPIVQAYLGP
FT                   DLTHKLFKRMRGRGPRSGFASSCGGDGSTLTLNQHQKNDVGPSVTPENTPFGGGSPRTL
FT                   EEMILQLEVEEDIVRRARLRESYYGTYDNCDDHNDVDDDKLYHQPARMSCVNSSDILRS
FT                   ARNALNQYPRFSLDGKDAMYRSSFRRHLGTSADMTIQGGRRSHCGDQRTSKRSSQMSLE
FT                   TKRLPRTVAGESVVWCKTGVVAKLMGLEMIPVPDKGKSGKDKLGTLLKRERLRRRERTL
FT                   DVNGRTGPTTEASCSSGGFNITRPIGAVGSPSRMGGWPTARLP"
FT   exon            complement(46316..46805)
FT                   /number=1
FT   intron          complement(46806..47196)
FT                   /number=1
FT   exon            complement(47197..47520)
FT                   /number=2
FT   intron          complement(47521..48156)
FT                   /number=2
FT   exon            complement(48157..48431)
FT                   /number=3
FT   intron          complement(48432..48519)
FT                   /number=3
FT   exon            complement(48520..48807)
FT                   /number=4
FT   intron          complement(48808..49181)
FT                   /number=4
FT   exon            complement(49182..49664)
FT                   /number=5
FT   gene            52406..54503
FT                   /gene="AT4g26430"
FT   CDS_pept        join(52406..52703,52784..52872,52960..53053,53149..53210,
FT                   53301..53379,53754..53854,53984..54039,54422..54503)
FT                   /gene="AT4g26430"
FT                   /product="putative protein"
FT                   /note="similarity to hypothetical protein YOR261c, yeast,
FT                   PIR2:S67158"
FT                   /note="contains EST gb:T21187"
FT                   /db_xref="GOA:Q8W1P0"
FT                   /db_xref="InterPro:IPR000555"
FT                   /db_xref="InterPro:IPR024969"
FT                   /db_xref="InterPro:IPR033859"
FT                   /db_xref="InterPro:IPR037518"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8W1P0"
FT                   /protein_id="CAB79498.1"
FT                   /translation="MAPSSSSGLTFKLHPLVMLNISDHFTRVKTQLNPPAASCATGNGS
FT                   NNADAMLLQNPRVYGCVIGLQRGRTVEIFNSFELIFDPALDTLDRSFLEKKQELYKKVF
FT                   PDFYVLGWYSTGSDATESDMHIHKALMDINESPVYVLLNPAINHAQKDLPVTIYESEFH
FT                   VIDGIPQSIFVHTSYTIETVEAERISVDHVAHLKPSDGGSAATQCDKPCENSVLRQVSS
FT                   LLRSLPAAESEKFNENFLMEYNDKLLMSYLAMITNCTSNMNEVVDKFNTAYDKHSRRGG
FT                   RTAFM"
FT   exon            52406..52703
FT                   /number=1
FT   intron          52704..52783
FT                   /number=1
FT   exon            52784..52872
FT                   /number=2
FT   intron          52873..52959
FT                   /number=2
FT   exon            52960..53053
FT                   /number=3
FT   intron          53054..53148
FT                   /number=3
FT   exon            53149..53210
FT                   /number=4
FT   intron          53211..53300
FT                   /number=4
FT   exon            53301..53379
FT                   /number=5
FT   intron          53380..53753
FT                   /number=5
FT   exon            53754..53854
FT                   /number=6
FT   intron          53855..53983
FT                   /number=6
FT   exon            53984..54039
FT                   /number=7
FT   intron          54040..54421
FT                   /number=7
FT   exon            54422..54503
FT                   /number=8
FT   gene            54773..56727
FT                   /gene="AT4g26440"
FT   CDS_pept        complement(join(54773..55304,55381..55539,55627..56324,
FT                   56410..56727))
FT                   /gene="AT4g26440"
FT                   /product="putative protein"
FT                   /note="similarity to SPF1 protein, Ipomoea batatas,
FT                   PIR2:S51529"
FT                   /note="contains EST gb:N37131, AA585811, T44598,
FT                   AI995443.1, AI993164.1, T45479, F14100"
FT                   /db_xref="GOA:O65590"
FT                   /db_xref="InterPro:IPR003657"
FT                   /db_xref="InterPro:IPR036576"
FT                   /db_xref="UniProtKB/Swiss-Prot:O65590"
FT                   /protein_id="CAB79499.1"
FT                   /translation="MAGIDNKAAVMGEWFDCSTTNHRKRSKAELGREFSLNYIKNEDSL
FT                   QTTFQESSRGALRERIAARSGFNAPWLNTEDILQSKSLTISSPGLSPATLLESPVFLSN
FT                   PLLSPTTGKLSSVPSDKAKAELFDDITTSLAFQTISGSGLDPTNIALEPDDSQDYEERQ
FT                   LGGLGDSMACCAPADDGYNWRKYGQKLVKGSEYPRSYYKCTHPNCEAKKKVERSREGHI
FT                   IEIIYTGDHIHSKPPPNRRSGIGSSGTGQDMQIDATEYEGFAGTNENIEWTSPVSAELE
FT                   YGSHSGSMQVQNGTHQFGYGDAAADALYRDENEDDRTSHMSVSLTYDGEVEESESKRRK
FT                   LEAYATETSGSTRASREPRVVVQTTSDIDILDDGYRWRKYGQKVVKGNPNPRSYYKCTA
FT                   NGCTVTKHVERASDDFKSVLTTYIGKHTHVVPAARNSSHVGAGSSGTLQGSLATQTHNH
FT                   NVHYPMPHSRSEGLATANSSLFDFQSHLRHPTGFSVYIGQSELSDLSMPGLTIGQEKLT
FT                   SLQAPDIGDPTGLMLQLAAQPKVEPVSPQQGLDLSASSLICREMLSRLRQI"
FT   exon            complement(54773..55304)
FT                   /number=1
FT   intron          complement(55305..55380)
FT                   /number=1
FT   exon            complement(55381..55539)
FT                   /number=2
FT   intron          complement(55540..55626)
FT                   /number=2
FT   exon            complement(55627..56324)
FT                   /number=3
FT   intron          complement(56325..56409)
FT                   /number=3
FT   exon            complement(56410..56727)
FT                   /number=4
FT   gene            59733..65855
FT                   /gene="AT4g26450"
FT   CDS_pept        join(59733..61570,61651..61804,61862..61958,62897..63796,
FT                   63975..64454,64827..64914,65666..65855)
FT                   /gene="AT4g26450"
FT                   /product="putative protein"
FT                   /note="contains EST gb:N96063, T45506, AA395523"
FT                   /db_xref="GOA:Q8GXA4"
FT                   /db_xref="InterPro:IPR040276"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0CB21"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8GXA4"
FT                   /protein_id="CAB79500.1"
FT                   /translation="MHARQRNVGNGYRSGSIGMGMSGSRISPERPMRGHGFYGSEHQHR
FT                   GFNRGYGRGRGRSKSYHNQLPPPLPPPPVQRRSSGGDVFMEAGRLATEYLVSQGVLPQT
FT                   VLSSKWQNGNFRKQAGEFQSSRSQEEARMDVSAPAAEKRRYIDGYSSAGSRNSLKGRRS
FT                   HRYDSDFGRSGSWSERSKAFETETGDDSVSGHQEEQPLAEDIASSVQRSASGEFMRKCE
FT                   GAGDSESVLDKYNLQDEAQSKTGSSSAGKDIVQDCEISKVSEGSSSLSAGSGEMKGRSG
FT                   GNGGEDENQTAIEDGSIHQRCEDASIDQQCGADESFTKSGIDLATLCKFEKVPTRTRSS
FT                   LTAKGPKLYLSHNIKDTSHNSGLEEEDQTENRCETRGQSSGKADSTGDENDQVEDFALV
FT                   QYIENSKCHRSNSFPSSILRDNSEKESGLELPNLHRSHSVGKVGEKRPGEGSDLEEGSK
FT                   RQRDWVAVSEANERFNMFKTSGNQCDPEEEGKTSSFNKRLIDGAAGKRVSHESLVNNST
FT                   YNRTHTGRTGPGYAEEHQLFPASFKMCDLNLGGASDVNDGIKESRQAVDFDLSISSSSK
FT                   SLEFGTSTRMSNGKEIEVINLDDDQEVVKSSNDPGRKQEAAPYMGIDDVPDYNERLMMV
FT                   EYLDSFTPINQGTSSVPQNNNTVSLQDREILKTSQGAIGNDQVPNNTDDDSIFMSLGEI
FT                   PLNFFVESMDLESESSALESVDDNVLIQQSASNVCDDGRSLDNGSCSDESVKLLSTSNS
FT                   VELGKPMSFDSPGDGGGAYSPVLKGQGLRKWRRIRRDLVKDTSANMENSKALKRGLSGV
FT                   AHSHGKQMQFQSPEVEQESQGSVGSVNMLKSSGDGFDILGSSGYDSRFVAGVGFSAGMD
FT                   LEIDDDRSSKSSTVARAPKVIRYEKPMISSGQGGNIRVENSKKHRGESVDFEKENSYSS
FT                   LESDSRKQSGRMMDYNGENGETSMRKDDAGGEGGESINTDNRYSDEMDPLTEAINGFLA
FT                   LQDALEKEVQQFQEIGNEPMPQHHEQVSEANSPHPEIVTLVNNVEQLENMLEETRSMLE
FT                   VKESHIRDLESTTNQSKHSWGGTEIVVEDIFRQKIEAEIEYLIYSRSIDNLNSQMKLID
FT                   EQESLAEEQTHETLNKLGRVQTKAANFTNRAQDLQNDCIEITGTIKKRAFNTNKAKTAV
FT                   AAEINSEIKRGVESAVEAFRKRRPIRNKLKMEGGEGRQQKDIPDMELEEERDTNSAIRK
FT                   KNNNISSMKLLLKKLVTFSKKNT"
FT   exon            59733..61570
FT                   /number=1
FT   intron          61571..61650
FT                   /number=1
FT   exon            61651..61804
FT                   /number=2
FT   intron          61805..61861
FT                   /number=2
FT   exon            61862..61958
FT                   /number=3
FT   intron          61959..62896
FT                   /number=3
FT   exon            62897..63796
FT                   /number=4
FT   intron          63797..63974
FT                   /number=4
FT   exon            63975..64454
FT                   /number=5
FT   intron          64455..64826
FT                   /number=5
FT   exon            64827..64914
FT                   /number=6
FT   intron          64915..65665
FT                   /number=6
FT   exon            65666..65855
FT                   /number=7
FT   gene            66707..67188
FT                   /gene="AT4g26460"
FT   CDS_pept        join(66707..66928,67036..67188)
FT                   /gene="AT4g26460"
FT                   /product="hypothetical protein"
FT                   /db_xref="GOA:O65588"
FT                   /db_xref="InterPro:IPR005299"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:O65588"
FT                   /protein_id="CAB79501.1"
FT                   /translation="MLIYALDFFIRFPRKDDSQIMELCIGTVNNGTSDKTADQIKATME
FT                   AAYRVLYRHAPLPRNIFGPMFPMSYLHVAVPEKVVENGWNKRKAWIEGSDRQVLMRYAE
FT                   QADKDLVDFLAEPCRGILMP"
FT   exon            66707..66928
FT                   /number=1
FT   intron          66929..67035
FT                   /number=1
FT   exon            67036..67188
FT                   /number=2
FT   misc_feature    68133..106409
FT                   /note="overlap to BAC M3E9; please refer to this entry for
FT                   analysis and annotation"
FT   misc_feature    68137..106407
FT                   /note="overlap to BAC T15N24 ; please also refer to
FT                   EMBL:AL078465 for analysis and annotation"
FT   gene            68554..69520
FT                   /gene="AT4g26470"
FT   CDS_pept        join(68554..68752,68831..69033,69141..69309,69345..69520)
FT                   /gene="AT4g26470"
FT                   /product="putative protein"
FT                   /note="similarity to probable calcium-dependent protein
FT                   kinase, Oryza sativa, PIR2:S56652"
FT                   /note="Contains EF-hand calcium-binding domain
FT                   AA67-79;EF-hand calcium-binding domain AA158-170;EF-hand
FT                   calcium-binding domain AA211-223"
FT                   /note="contains EST gb:H77175"
FT                   /db_xref="GOA:Q52K82"
FT                   /db_xref="InterPro:IPR002048"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q52K82"
FT                   /protein_id="CAB79502.1"
FT                   /translation="MGGAVTKSETLQKEWVPETKLEAKIIEAVQRRASRGTTMKSFNSI
FT                   VLKFPKIDDGLRNCKAIFQEFDEDSNGSIDHTELKNCIRKLEISFDEEEINDLFKACDI
FT                   NEDMGITFTEFIVLLCLVYLLKDDSSTLQKKWTMGMPKLEPTFETLVDTFVFLDENKDG
FT                   YVSREEMVRAIDESGERSSGRIAMKRFAFFFTEPRILILIPVSAEEMDWDKNGMVNFKE
FT                   FLFAFTQWVGIDENEEEEEEDNNEKA"
FT   exon            68554..68752
FT                   /number=1
FT   intron          68753..68830
FT                   /number=1
FT   exon            68831..69033
FT                   /number=2
FT   intron          69034..69140
FT                   /number=2
FT   exon            69141..69309
FT                   /number=3
FT   intron          69310..69344
FT                   /number=3
FT   exon            69345..69520
FT                   /number=4
FT   gene            70062..75567
FT                   /gene="AT4g26480"
FT   CDS_pept        complement(join(70062..70208,70301..70444,70527..70643,
FT                   70719..70832,71310..71449,72060..72145,72792..72999,
FT                   73356..73413,73911..74083,74897..75138,75229..75433,
FT                   75534..75567))
FT                   /gene="AT4g26480"
FT                   /product="putative protein"
FT                   /note="similarity to qkI-7, Mus musculus"
FT                   /note="contains EST gb:H76841, T21753, H36880"
FT                   /db_xref="GOA:Q0WLR1"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR019446"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR032377"
FT                   /db_xref="InterPro:IPR036612"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0C8L4"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0WLR1"
FT                   /protein_id="CAB79503.1"
FT                   /translation="MNITATSLDSEDELSIKYMDAVDNINILKRYGCDIQHEVDVHTMS
FT                   FDNSLSLQRYDRIVFNFPHAGSRFFGRELSSRAIESHKELVRGFLENAKEMLEEDGEIH
FT                   ITHKTTYPFSDWGIKKLGKGEGLKLLKKSKFELSHYPGYITKRGSGGRRSDDYFPVDVD
FT                   PCDLKGFEVLEIYHPSMSDGFVNSVMVARKLTDRLIKYEWCTGTRSLNSLKKTRQTEPD
FT                   QFNKREINRSGPGQVAEEEEEVVAVMMMMTSLGGGAGGGGGGGGSGGGRFVTYPPPLSV
FT                   PPSAPQSPNFSGGLRSQPSFLVEQEKYLSELLAERHKLTPFLPVLPHVCRLMNQEILRV
FT                   TTLLENALSQSRFDHPSPLASGGIFQNSRADMNGWASQFPSERSVSSSPAPNWLNSPGS
FT                   SSGLIVKRTIRVDIPVDKYPNYNFVGRLLGPRGNSLKRVEASTDCRVLIRGRGSIKDPI
FT                   KEDMMRGKPGYEHLNEPLHILVEAELPIEIVDARLMQAREILDDLLTPVEETHDFYKKQ
FT                   QLRELALLNGSLREEGSPMSGSISPYNSLGMKRAKTRG"
FT   exon            complement(70062..70208)
FT                   /number=1
FT   intron          complement(70209..70300)
FT                   /number=1
FT   exon            complement(70301..70444)
FT                   /number=2
FT   intron          complement(70445..70526)
FT                   /number=2
FT   exon            complement(70527..70643)
FT                   /number=3
FT   intron          complement(70644..70718)
FT                   /number=3
FT   exon            complement(70719..70832)
FT                   /number=4
FT   intron          complement(70833..71309)
FT                   /number=4
FT   exon            complement(71310..71449)
FT                   /number=5
FT   intron          complement(71450..72059)
FT                   /number=5
FT   exon            complement(72060..72145)
FT                   /number=6
FT   intron          complement(72146..72791)
FT                   /number=6
FT   exon            complement(72792..72999)
FT                   /number=7
FT   intron          complement(73000..73355)
FT                   /number=7
FT   exon            complement(73356..73413)
FT                   /number=8
FT   intron          complement(73414..73910)
FT                   /number=8
FT   exon            complement(73911..74083)
FT                   /number=9
FT   intron          complement(74084..74896)
FT                   /number=9
FT   exon            complement(74897..75138)
FT                   /number=10
FT   intron          complement(75139..75228)
FT                   /number=10
FT   exon            complement(75229..75433)
FT                   /number=11
FT   intron          complement(75434..75533)
FT                   /number=11
FT   exon            complement(75534..75567)
FT                   /number=12
FT   gene            77749..78408
FT                   /gene="AT4g26490"
FT   CDS_pept        join(77749..77872,77930..78408)
FT                   /gene="AT4g26490"
FT                   /product="hypothetical protein"
FT                   /note="contains EST gb:AI996141.1"
FT                   /db_xref="InterPro:IPR004864"
FT                   /db_xref="UniProtKB/TrEMBL:O65585"
FT                   /protein_id="CAB79504.1"
FT                   /translation="MVLTKPATVRFNGLDAEPRKDRVILRQPRSSRTSLWIWCVAVFLA
FT                   IRPRIPVFDIPNANLHTIYFDTPEFFNGDLSMLVNFTNPNKKIEVKFEKLRIELFFFNR
FT                   LIAAQVVQPFLQKKHETRLEPIRLISSLVGLPVNHAVELRRQLENNKIEYEIRGTFKVK
FT                   AHFGMIHYSYQLHGRCQLQMTGPPTGILISRNCTTKK"
FT   exon            77749..77872
FT                   /number=1
FT   intron          77873..77929
FT                   /number=1
FT   exon            77930..78408
FT                   /number=2
FT   gene            79633..80748
FT                   /gene="AT4g26500"
FT   CDS_pept        complement(79633..80748)
FT                   /gene="AT4g26500"
FT                   /product="putative protein"
FT                   /note="similarity to Uvi31, Schizosaccharomyces pombe,
FT                   G1381578"
FT                   /db_xref="GOA:Q84W65"
FT                   /db_xref="InterPro:IPR002634"
FT                   /db_xref="InterPro:IPR003808"
FT                   /db_xref="InterPro:IPR036065"
FT                   /db_xref="PDB:4PUI"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q84W65"
FT                   /protein_id="CAB79505.1"
FT                   /translation="MAAAMSSSCCASSLRLIPFKRTLFSSIHYPAKTLLLRPLKPSEVP
FT                   SFRRTIITFQKISTGIVPPPSASSSPSSYGDLQPIEELPPKLQEIVKLFQSVQEPKAKY
FT                   EQLMFYGKNLTPLDSQFKTRENKVEGCVSQVWVRAFFDEERNVVYEADSDSVLTKGLAA
FT                   LLVKGLSGRPVPEILRITPDFAVLLGLQQSLSPSRNNGLLNMLKLMQKKALHLEVKGEE
FT                   DSSSGESSESSFVSIPETKDEANVPEVDLESKPDLVEDLGTEKIDDSESGSNVVALGSR
FT                   GMRIREKLEKELDPVELEVEDVSYQHAGHAAVRGSAGDDGETHFNLRIVSDAFQGKSLV
FT                   KRHRLIYDLLQDELKSGLHALSIVAKTPAEV"
FT   exon            complement(79633..80748)
FT                   /number=1
FT   gene            83862..85096
FT                   /gene="AT4g26510"
FT   CDS_pept        join(83862..83936,84028..84088,84209..84269,84372..84465,
FT                   84537..84609,84747..84829,84947..85096)
FT                   /gene="AT4g26510"
FT                   /product="putative uracil phosphoribosyl transferase"
FT                   /note="strong similarity to uracil phosphoribosyl
FT                   transferase, Saccharomyces cerevisiae, PIR2:JH0147"
FT                   /note="contains EST gb:AI994412.1, AI993297.1, T76323,
FT                   U74107, AA728457"
FT                   /db_xref="GOA:O65583"
FT                   /db_xref="InterPro:IPR000764"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR006083"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/Swiss-Prot:O65583"
FT                   /protein_id="CAB79506.1"
FT                   /translation="MHTLIRDSQTTKHDFVFYSDRLIRLVVEHGLGHLPFTEKQVITPT
FT                   GCVYSGVDFCKRLCGVSVIRSGESMENALRACCKGIKIGKILIHREGDNGQQLVYEKLP
FT                   NDISERHVLLLDPILGTGNSAVEAINLLISKGVPEGNIIFLNLISAPQGVHVVCKKFPR
FT                   IKIVTSEIDNGLNEEFRVIPGMGEFGDRYFGTDDD"
FT   exon            83862..83936
FT                   /number=1
FT   intron          83937..84027
FT                   /number=1
FT   exon            84028..84088
FT                   /number=2
FT   intron          84089..84208
FT                   /number=2
FT   exon            84209..84269
FT                   /number=3
FT   intron          84270..84371
FT                   /number=3
FT   exon            84372..84465
FT                   /number=4
FT   intron          84466..84536
FT                   /number=4
FT   exon            84537..84609
FT                   /number=5
FT   intron          84610..84746
FT                   /number=5
FT   exon            84747..84829
FT                   /number=6
FT   intron          84830..84946
FT                   /number=6
FT   exon            84947..85096
FT                   /number=7
FT   gene            85852..87367
FT                   /gene="AT4g26520"
FT   CDS_pept        join(85852..85879,85960..86213,86346..86774,87002..87367)
FT                   /gene="AT4g26520"
FT                   /product="fructose-bisphosphate aldolase"
FT                   /note="Contains Fructose-bisphosphate aldolase class-I
FT                   active site AA217-227"
FT                   /note="contains EST gb:AI994456.1"
FT                   /db_xref="GOA:P22197"
FT                   /db_xref="InterPro:IPR000741"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR029768"
FT                   /db_xref="UniProtKB/Swiss-Prot:P22197"
FT                   /protein_id="CAB79507.1"
FT                   /translation="MSAFVSKYEDELIKTAKYIATPGRGILAADESTETIGKRFAGINV
FT                   ENTESNRQAYRELLFTSPGSYPCLSGVILFEETLYQKTSDGKPFVDLLMENGVIPGIKV
FT                   DKGLVDLAGTNGETTTQGLDSLGARCQQYYEAGARFAKWRAFFKIGATEPSVLSIQEDA
FT                   RVLARYAIICQENGLVPIVEPEVLTGGSHDIKKCAAVTETVLAAVFKALNYHHVLLEGT
FT                   LLKPNMVTPGSDSPKVAPELIAEYTVTALRRTVPPAIPGIVFLSGIQREEQATLNLNAM
FT                   NKLDVLKPWTLTFSFGGALQQSAIKAWAGKPENVAKAQAKFLTRCKANKDATLGKYTGW
FT                   ASGDSAAFENLVVIGYRY"
FT   exon            85852..85879
FT                   /number=1
FT   intron          85880..85959
FT                   /number=1
FT   exon            85960..86213
FT                   /number=2
FT   intron          86214..86345
FT                   /number=2
FT   exon            86346..86774
FT                   /number=3
FT   intron          86775..87001
FT                   /number=3
FT   exon            87002..87367
FT                   /number=4
FT   gene            88742..90113
FT                   /gene="AT4g26530"
FT   CDS_pept        join(88742..88769,88849..89102,89219..89647,89748..90113)
FT                   /gene="AT4g26530"
FT                   /product="fructose-bisphosphate aldolase-like protein"
FT                   /note="strong similarity to fructose-bisphosphate aldolase,
FT                   Arabidopsis thaliana, PIR1:ADMU"
FT                   /note="Contains Fructose-bisphosphate aldolase class-I
FT                   active site AA217-227"
FT                   /note="contains EST gb:AI994456.1, H36738, T44098,
FT                   AI099760"
FT                   /db_xref="GOA:O65581"
FT                   /db_xref="InterPro:IPR000741"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR029768"
FT                   /db_xref="UniProtKB/Swiss-Prot:O65581"
FT                   /protein_id="CAB79508.1"
FT                   /translation="MSAFVGKYADELIKTAKYIATPGKGILAADESTGTIGKRFASINV
FT                   ENIESNRQALRELLFTSPGTFPCLSGVILFEETLYQKTTDGKPFVELLMENGVIPGIKV
FT                   DKGVVDLAGTNGETTTQGLDSLGARCQEYYKAGARFAKWRAVLKIGATEPSELSIQENA
FT                   KGLARYAIICQENGLVPIVEPEVLTDGSHDIKKCAAVTETVLAAVYKALNDHHVLLEGT
FT                   LLKPNMVTPGSDSPKVAPEVIAEYTVTALRRTVPPAVPGIVFLSGGQSEEEATLNLNAM
FT                   NKLDVLKPWTLTFSFGRALQQSTLKAWAGKTENVAKAQATFLTRCKGNSDATLGKYTGG
FT                   ASGDSAASESLYEEGYKY"
FT   exon            88742..88769
FT                   /number=1
FT   intron          88770..88848
FT                   /number=1
FT   exon            88849..89102
FT                   /number=2
FT   intron          89103..89218
FT                   /number=2
FT   exon            89219..89647
FT                   /number=3
FT   intron          89648..89747
FT                   /number=3
FT   exon            89748..90113
FT                   /number=4
FT   gene            91849..95203
FT                   /gene="AT4g26540"
FT   CDS_pept        complement(join(91849..92353,92396..93697,93921..95203))
FT                   /gene="AT4g26540"
FT                   /product="receptor protein kinase-like protein"
FT                   /note="strong similarity to Cf-2.1, Solanum
FT                   pimpinellifolium"
FT                   /note="Contains Protein kinases signatures and profile
FT                   AA691-713;Protein kinases signatures and profile AA804-816"
FT                   /note="contains EST gb:N37940, AA395026, T41929"
FT                   /db_xref="GOA:C0LGR3"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR001611"
FT                   /db_xref="InterPro:IPR003591"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR013210"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR032675"
FT                   /db_xref="PDB:5HYX"
FT                   /db_xref="PDB:5HZ0"
FT                   /db_xref="PDB:5HZ1"
FT                   /db_xref="PDB:5HZ3"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0LGR3"
FT                   /protein_id="CAB79509.1"
FT                   /translation="MPPNIYRLSFFSSLLCFFFIPCFSLDQQGQALLSWKSQLNISGDA
FT                   FSSWHVADTSPCNWVGVKCNRRGEVSEIQLKGMDLQGSLPVTSLRSLKSLTSLTLSSLN
FT                   LTGVIPKEIGDFTELELLDLSDNSLSGDIPVEIFRLKKLKTLSLNTNNLEGHIPMEIGN
FT                   LSGLVELMLFDNKLSGEIPRSIGELKNLQVLRAGGNKNLRGELPWEIGNCENLVMLGLA
FT                   ETSLSGKLPASIGNLKRVQTIAIYTSLLSGPIPDEIGYCTELQNLYLYQNSISGSIPTT
FT                   IGGLKKLQSLLLWQNNLVGKIPTELGNCPELWLIDFSENLLTGTIPRSFGKLENLQELQ
FT                   LSVNQISGTIPEELTNCTKLTHLEIDNNLITGEIPSLMSNLRSLTMFFAWQNKLTGNIP
FT                   QSLSQCRELQAIDLSYNSLSGSIPKEIFGLEFLDLHTNSLSGSLLGTTLPKSLKFIDFS
FT                   DNALSSTLPPGIGLLTELTKLNLAKNRLSGEIPREISTCRSLQLLNLGENDFSGEIPDE
FT                   LGQIPSLAISLNLSCNRFVGEIPSRFSDLKNLGVLDVSHNQLTGNLNVLTDLQNLVSLN
FT                   ISYNDFSGDLPNTPFFRRLPLSDLASNRGLYISNAISTRPDPTTRNSSVVRLTILILVV
FT                   VTAVLVLMAVYTLVRARAAGKQLLGEEIDSWEVTLYQKLDFSIDDIVKNLTSANVIGTG
FT                   SSGVVYRITIPSGESLAVKKMWSKEESGAFNSEIKTLGSIRHRNIVRLLGWCSNRNLKL
FT                   LFYDYLPNGSLSSRLHGAGKGGCVDWEARYDVVLGVAHALAYLHHDCLPTIIHGDVKAM
FT                   NVLLGPHFEPYLADFGLARTISGYPNTGIDLAKPTNRPPMAGSLWLHGSSFDFDLFCLL
FT                   GFTEHASMQRITEKSDVYSYGVVLLEVLTGKHPLDPDLPGGAHLVKWVRDHLAEKKDPS
FT                   RLLDPRLDGRTDSIMHEMLQTLAVAFLCVSNKANERPLMKDVVAMLTEIRHIDVGRSET
FT                   EKIKAGGCGSKEPQQFMSNEKIINSHGSSNCSFAFSDDSV"
FT   exon            complement(91849..92353)
FT                   /number=1
FT   intron          complement(92354..92395)
FT                   /number=1
FT   exon            complement(92396..93697)
FT                   /number=2
FT   intron          complement(93698..93920)
FT                   /number=2
FT   exon            complement(93921..95203)
FT                   /number=3
FT   gene            99930..103353
FT                   /gene="AT4g26550"
FT   CDS_pept        complement(join(99930..100040,100413..100517,
FT                   100562..100964,101190..101489,103019..103201,
FT                   103298..103353))
FT                   /gene="AT4g26550"
FT                   /product="putative protein"
FT                   /note="EST DBES:T21637 matches to coord. (3049-3110,
FT                   3207-3389, 3910-3977), EST DBES:AA395643 matches to coord.
FT                   (4367-4444, 4534-4789)"
FT                   /note="similarity to probable membrane protein YBL102w,
FT                   yeast, PIR2:S45393"
FT                   /note="contains EST gb:AI994236.1, T21637"
FT                   /db_xref="GOA:Q944B0"
FT                   /db_xref="InterPro:IPR001179"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q944B0"
FT                   /protein_id="CAB79510.1"
FT                   /translation="MAMAMEISLPFVGSSMALSAGKSRNSVSRISRVGFSSVSAVHVPR
FT                   RMFMQLSGFGSVLTLLDFPSLAAPVPQMKEPEVISCGVYQKTLKRQRKISDRRRSGLSL
FT                   FAFLEDPETQKMSQGWFSMGGSSTVDQQQQSGSSLLADWNSYAASRDFEESGGSFGFDI
FT                   ESAVRSANDTVSGTFSVCFQESSFVSLIKFLFFCCFCNVPEFDDYRVSKGVRDIPGSLQ
FT                   SATSSMPSGKALMYFGLLLASGVFFIFIAFTMFLPVMVLMPQKFAICFTLGCGFIIGSF
FT                   FALRGPKNQLAHMSSMEVCYTVLLCVCHALNPRRLPSTLGFIATMVGTIYVSMVLHSYI
FT                   LSVLFSVLQVLALVYYCISYFPGGSSGMRFLSSALTSSALRVFGR"
FT   exon            complement(99930..100040)
FT                   /number=1
FT   intron          complement(100041..100412)
FT                   /number=1
FT   exon            complement(100413..100517)
FT                   /number=2
FT   intron          complement(100518..100561)
FT                   /number=2
FT   exon            complement(100562..100964)
FT                   /number=3
FT   intron          complement(100965..101189)
FT                   /number=3
FT   exon            complement(101190..101489)
FT                   /number=4
FT   intron          complement(101490..103018)
FT                   /number=4
FT   exon            complement(103019..103201)
FT                   /number=5
FT   intron          complement(103202..103297)
FT                   /number=5
FT   exon            complement(103298..103353)
FT                   /number=6
FT   gene            103908..105148
FT                   /gene="AT4g26560"
FT   CDS_pept        complement(join(103908..103965,104069..104181,
FT                   104296..104429,104553..104661,104737..104796,
FT                   104908..104955,105026..105148))
FT                   /gene="AT4g26560"
FT                   /product="putative calcineurin B-like protein"
FT                   /note="strong similarity to calcineurin B-like protein 3
FT                   -Arabidopsis thaliana, PID:g3309086"
FT                   /note="Contains EF-hand calcium-binding domain AA83-95"
FT                   /note="contains EST gb:AI999389.1"
FT                   /db_xref="GOA:Q9SUA6"
FT                   /db_xref="InterPro:IPR002048"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9SUA6"
FT                   /protein_id="CAB79511.1"
FT                   /translation="MDSTRNSASSNSTGCFTDQKKRKALYEVFKKLSGVDCQRNEGNVV
FT                   EGVTCYYGEMNKEQFHVAIFQTDKNESLFSERVFDLFDTNHDGLLGFEEFARALSVFHP
FT                   SAPIDDKIDLSFQLYDLKQQGFIERQGVKQLVVATLAASGMSQSDEIVESIIDKTFVQA
FT                   DTKHEGMIDEEEWMDLVFRHPLLLKNMTLQYLKDITTTFPSFVLHSQVEDT"
FT   exon            complement(103908..103965)
FT                   /number=1
FT   intron          complement(103966..104068)
FT                   /number=1
FT   exon            complement(104069..104181)
FT                   /number=2
FT   intron          complement(104182..104295)
FT                   /number=2
FT   exon            complement(104296..104429)
FT                   /number=3
FT   intron          complement(104430..104552)
FT                   /number=3
FT   exon            complement(104553..104661)
FT                   /number=4
FT   intron          complement(104662..104736)
FT                   /number=4
FT   exon            complement(104737..104796)
FT                   /number=5
FT   intron          complement(104797..104907)
FT                   /number=5
FT   exon            complement(104908..104955)
FT                   /number=6
FT   intron          complement(104956..105025)
FT                   /number=6
FT   exon            complement(105026..105148)
FT                   /number=7
FT   gene            105783..107173
FT                   /gene="AT4g26570"
FT   CDS_pept        complement(join(105783..105840,105938..106050,
FT                   106168..106301,106422..106530,106617..106676,
FT                   106802..106884,107050..107173))
FT                   /gene="AT4g26570"
FT                   /product="calcineurin B-like protein 3"
FT                   /note="contains EST gb:AI999389.1, T21746"
FT                   /db_xref="GOA:Q8LEM7"
FT                   /db_xref="InterPro:IPR002048"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8LEM7"
FT                   /protein_id="CAB79512.1"
FT                   /translation="MSQCIDGFKHVCSSFFRCFDIDIYKQSGGLGDPELLARETVFSVS
FT                   EIEALYELFKKISSAVIDDGLINKEEFQLALFKTNKKESLFADRVFDLFDTKHNGILGF
FT                   EEFARALSVFHPNAPIEDKIDFSFQLYDLKQQGFIERQEVKQMVVATLAESGMNLSDEI
FT                   IESIIDKTFEEADTKHDGRIDKEEWRTLVLRHPSLLKNMTLQYLKDITTTFPSFVFHSQ
FT                   VEDT"
FT   exon            complement(105783..105840)
FT                   /number=1
FT   intron          complement(105841..105937)
FT                   /number=1
FT   exon            complement(105938..106050)
FT                   /number=2
FT   intron          complement(106051..106167)
FT                   /number=2
FT   exon            complement(106168..106301)
FT                   /number=3
FT   intron          complement(106302..106421)
FT                   /number=3
FT   exon            complement(106422..106530)
FT                   /number=4
FT   intron          complement(106531..106616)
FT                   /number=4
FT   exon            complement(106617..106676)
FT                   /number=5
FT   intron          complement(106677..106801)
FT                   /number=5
FT   exon            complement(106802..106884)
FT                   /number=6
FT   intron          complement(106885..107049)
FT                   /number=6
FT   exon            complement(107050..107173)
FT                   /number=7
FT   gene            108880..110846
FT                   /gene="AT4g26580"
FT   CDS_pept        complement(join(108880..109026,109117..109474,
FT                   109562..110133,110177..110242,110471..110609,
FT                   110734..110846))
FT                   /gene="AT4g26580"
FT                   /product="putative protein"
FT                   /note="similarity to RING zinc finger protein - Gallus
FT                   gallus (chicken), PID:e223435"
FT                   /note="contains EST gb:T88029"
FT                   /db_xref="GOA:Q9SUA5"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="UniProtKB/TrEMBL:Q9SUA5"
FT                   /protein_id="CAB79513.1"
FT                   /translation="MEDKLDVLIMGELKLELVELRHYFPSSPLFDSITKLSEGREGERE
FT                   ERWRCLTKKKTRIDKAAAVAVGVLLRRQKTKVVRFYRPTSEDKVFDENASLIYPSMSFF
FT                   LHLKLYSVSLCSCSGDQIKDLSVSDMSTRYSSQLQSSAINSITVSSSSSFASTQLDDNT
FT                   HTAPESSPSSSFFMRLAMRVSRARWFIFLRRVFHYQNASRSDLGTNPFNSIAWMVSELI
FT                   ALLLQITVITSTLALSKNERPVWPMRLWITGYNVGCLLNLMLLYGRYRQQDTSHENAFS
FT                   FGDIEQQQRSREETTRCSHLMNKCRTSLELFFAIWFVIGNVWVFDSRFGSFHYAPILHV
FT                   LCISLLAWNALCYSFPFLLFLLLCCVVPLVSSFLGYNMNVGSSEKGASDDQISSLPSWK
FT                   YKLIDETSDSSQANNDPECCICLAKYKEKEEVRKLPCSHRFHLKCVDQWLRIISCCPLC
FT                   KQDLPN"
FT   exon            complement(108880..109026)
FT                   /number=1
FT   intron          complement(109027..109116)
FT                   /number=1
FT   exon            complement(109117..109474)
FT                   /number=2
FT   intron          complement(109475..109561)
FT                   /number=2
FT   exon            complement(109562..110133)
FT                   /number=3
FT   intron          complement(110134..110176)
FT                   /number=3
FT   exon            complement(110177..110242)
FT                   /number=4
FT   intron          complement(110243..110470)
FT                   /number=4
FT   exon            complement(110471..110609)
FT                   /number=5
FT   intron          complement(110610..110733)
FT                   /number=5
FT   exon            complement(110734..110846)
FT                   /number=6
FT   gene            111309..114025
FT                   /gene="AT4g26590"
FT   CDS_pept        complement(join(111309..112380,112500..113072,
FT                   113142..113239,113322..113773,113959..114025))
FT                   /gene="AT4g26590"
FT                   /product="isp4 like protein"
FT                   /note="strong similarity to isp4 protein
FT                   -Schizosaccharomyces pombe, PIR2:S45495"
FT                   /note="Contains Prenyl group binding site (CAAX box)
FT                   AA750-753;Prokaryotic membrane lipoprotein lipid attachment
FT                   site AA439-449;Prokaryotic membrane lipoprotein lipid
FT                   attachment site AA457-467"
FT                   /note="contains EST gb:AI995580.1"
FT                   /db_xref="GOA:Q9SUA4"
FT                   /db_xref="InterPro:IPR004648"
FT                   /db_xref="InterPro:IPR004813"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9SUA4"
FT                   /protein_id="CAB79514.1"
FT                   /translation="MVGSLEVSKPPEHKVESKIVIADEEEEDENDSPIEEVRLTVPITD
FT                   DPSLPVLTFRTWFLGMVSCVVLAFVNNFFGYRSNPLTVSSVVAQIITLPLGKLMATTLP
FT                   TTKLRLPGTNWSCSLNPGPFNMKEHVLITIFANTGAGGAYATSILTIVKAFYHRNLNPA
FT                   AAMLLVQTTQLLGYGWAGMFRKYLVDSPYMWWPANLVQVSLFRALHEKEEKREGKQTKL
FT                   RFFLIVFFLSFTYYIVPGYLFPSISYLSFVCWIWTRSVTAQQIGSGLHGLGIGSFGLDW
FT                   STVAGFLGSPLAVPFFAIANSFGGFIIFFYIILPIFYWSNAYEAKKFPFYTSHPFDHTG
FT                   QRYNTTRILNQKTFNIDLPAYESYSKLYLSILFALIYGLSFGTLTATISHVALFDGKFI
FT                   WELWKKATLTTKDKFGDVHTRLMKKNYKEVPQWWFVAVLAASFVLALYACEGFGKQLQL
FT                   PWWGLLLACAIAFTFTLPIGVILATTNQRMGLNVISELIIGFLYPGKPLANVAFKTYGS
FT                   VSIAQALYFVGDFKLGHYMKIPPRSMFIVQLVATIVASTVSFGTTWWLLSSVENICNTD
FT                   MLPKSSPWTCPGDVVFYNASIIWGIIGPGRMFTSKGIYPGMNWFFLIGFLAPVPVWFFA
FT                   RKFPEKKWIHQIHIPLIFSGANVMPMAKAVHYWSWFAVGIVFNYYIFRRYKGWWARHNY
FT                   ILSAALDAGTAVMGVLIYFALQNNNISLPDWWGNENTDHCPLANCPTEKGIVAKGCPVF
FT                   "
FT   exon            complement(111309..112380)
FT                   /number=1
FT   intron          complement(112381..112499)
FT                   /number=1
FT   exon            complement(112500..113072)
FT                   /number=2
FT   intron          complement(113073..113141)
FT                   /number=2
FT   exon            complement(113142..113239)
FT                   /number=3
FT   intron          complement(113240..113321)
FT                   /number=3
FT   exon            complement(113322..113773)
FT                   /number=4
FT   intron          complement(113774..113958)
FT                   /number=4
FT   exon            complement(113959..114025)
FT                   /number=5
FT   repeat_region   115475..116482
FT   repeat_region   115863..116308
FT   gene            116804..120432
FT                   /gene="AT4g26600"
FT   CDS_pept        join(116804..117343,117440..117503,117633..117772,
FT                   117875..117958,118050..118124,118214..118285,
FT                   118379..118452,118698..118750,118833..118942,
FT                   119300..119374,119545..119637,119731..119810,
FT                   119898..119988,120103..120432)
FT                   /gene="AT4g26600"
FT                   /product="putative protein"
FT                   /note="similarity to proliferating-cell nucleolar antigen
FT                   P120 -Homo sapiens, PIR2:A48168"
FT                   /note="Contains ATP/GTP-binding site motif A (P-loop)
FT                   AA350-357"
FT                   /note="contains EST gb:T21343"
FT                   /db_xref="GOA:Q9LDL2"
FT                   /db_xref="InterPro:IPR001678"
FT                   /db_xref="InterPro:IPR023267"
FT                   /db_xref="InterPro:IPR023273"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR031341"
FT                   /db_xref="UniProtKB/TrEMBL:Q9LDL2"
FT                   /protein_id="CAB79515.1"
FT                   /translation="MAALTRNKKKGSNSQTPPLNKQTKASPLKKAAKTQKPPLKKQRKC
FT                   ISEKKPLKKPEVSTDEEEEEEENEQSDEGSESGSDLFSDGDEEGNNDSDDDDDDDDDDD
FT                   DDDEDAEPLAEDFLDGSDNEEVTMGSDLDSDSGGSKLERKSRAIDRKRKKEVQDADDEF
FT                   KMNIKEKPDEFQLPTQKELEEEARRPPDLPSLQMRIREIVRILSNFKDLKPKGDKHERN
FT                   DYVGQLKADLSSYYGYNEFLIGTLIEMFPVVELMELIEAFEKKRPTSIRTNTLKTRRRD
FT                   LADILLNRGVNLDPLSKWSKVGLIVYDSQVPIGATPEYLAGFYMLQSASSFLPVMALAP
FT                   REKERVVDMAAAPGGKTTYVAALMKNTGIIYANEMKVPRLKSLSANLHRMGVTNTIVCN
FT                   YDGREVISKDESVKTSKSADDIKKFAHLQKQLILGAIDLVDANSKTGGYIVYSTCSVMI
FT                   PENEAVIDYALKNRDVKLVPCGLDFGRPGFREHRFHPSLEKTRRFYPHVHNMDGFFVAK
FT                   LKKMSNAMQPSGNDEPAVTMEQAQVSSSDDDDEKAEAIEELEKPPVASGQPKRESNTKE
FT                   DTNKRKNPRSKEIHKGKRNKNTKTESGNVEEPRKQKKKRSQWKNEIAQAR"
FT   exon            116804..117343
FT                   /number=1
FT   repeat_region   117082..117126
FT   intron          117344..117439
FT                   /number=1
FT   exon            117440..117503
FT                   /number=2
FT   intron          117504..117632
FT                   /number=2
FT   exon            117633..117772
FT                   /number=3
FT   intron          117773..117874
FT                   /number=3
FT   exon            117875..117958
FT                   /number=4
FT   intron          117959..118049
FT                   /number=4
FT   exon            118050..118124
FT                   /number=5
FT   intron          118125..118213
FT                   /number=5
FT   exon            118214..118285
FT                   /number=6
FT   intron          118286..118378
FT                   /number=6
FT   exon            118379..118452
FT                   /number=7
FT   intron          118453..118697
FT                   /number=7
FT   exon            118698..118750
FT                   /number=8
FT   intron          118751..118832
FT                   /number=8
FT   exon            118833..118942
FT                   /number=9
FT   intron          118943..119299
FT                   /number=9
FT   exon            119300..119374
FT                   /number=10
FT   intron          119375..119544
FT                   /number=10
FT   exon            119545..119637
FT                   /number=11
FT   intron          119638..119730
FT                   /number=11
FT   exon            119731..119810
FT                   /number=12
FT   intron          119811..119897
FT                   /number=12
FT   exon            119898..119988
FT                   /number=13
FT   intron          119989..120102
FT                   /number=13
FT   exon            120103..120432
FT                   /number=14
FT   gene            122743..124363
FT                   /gene="AT4g26610"
FT   CDS_pept        join(122743..123419,123520..124363)
FT                   /gene="AT4g26610"
FT                   /product="putative protein kinase"
FT                   /note="strong similarity to protein kinase -Arabidopsis
FT                   thaliana, PIR2:JN0505"
FT                   /note="Contains Protein kinases signatures and profile
FT                   AA244-256"
FT                   /note="contains EST gb:AI996119.1, AA042649, H36204,
FT                   AA041115"
FT                   /db_xref="GOA:Q9SUA3"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9SUA3"
FT                   /protein_id="CAB79516.1"
FT                   /translation="MASKYGSGVLPENKKEKGDKETPETSYSSQSVSVNTLADQVSSTL
FT                   SFAPSSDSKTGGEVKFNEKSDQSGKSNTCRPSTSSDISDESTCSSFSGNNKPHKANDVR
FT                   WEAIQAVRTKHGVLGLNHFRLLKRLGCGDIGTVHLAELHGTRCFFAMKVMDKGALASRK
FT                   KLLRAQTEREILQCLDHPFLPTLYSHFETEKFSCLVMEFCPGGDLHTLRQRQPGKRFSE
FT                   QAAKFYVAEVLLAMEYLHMLGIIYRDLKPENVLVRDDGHVMLSDFDLSLRCTVSPTVVR
FT                   STVLASEGQKNSGYCAQPACIQQPSCISAPTTCFSPRYFSSKSKKDKKMKNETGNQVSP
FT                   LPELVAEPTSARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGS
FT                   GNRATLFNVVGQPLRFPESPVVSFAARDLIRSLLVKEPQHRLAYKRGATEMKQHPFFEG
FT                   VNWALVRCASPPEIPKPVDYESAPATPAAATSTSVKSDQSNYLEFDFF"
FT   exon            122743..123419
FT                   /number=1
FT   intron          123420..123519
FT                   /number=1
FT   exon            123520..124363
FT                   /number=2
FT   gene            124774..127052
FT                   /gene="AT4g26620"
FT   CDS_pept        complement(join(124774..125106,125155..125384,
FT                   125783..125985,126093..126178,126675..127052))
FT                   /gene="AT4g26620"
FT                   /product="sucrase-like protein"
FT                   /note="similarity to sucrose cleavage protein - potato,
FT                   Pir2:S51376"
FT                   /note="contains EST gb:F14262"
FT                   /db_xref="InterPro:IPR009737"
FT                   /db_xref="UniProtKB/TrEMBL:Q9SUA2"
FT                   /protein_id="CAB79517.1"
FT                   /translation="MGSGRDRDDPLSFTSNPSTASSPVTVSDYLDNFLGEPTSRSGSFQ
FT                   SESLLGGGGGESINDADFGFARPDFRSEQLAGTVQFYERHVFLCYKKPSVWPARIEAAE
FT                   FDRLPRLLSAAVSARKGSMKKETRLTICEGHDGTETSNGDVLIFPDMIRYRRLTHFDVE
FT                   TFVEEVLVKDGEWLPGNPELLKGSYVFVCSHGSRDRRCGVCGPSLVSRFREELEFHGLQ
FT                   AHQQRRDCRPAMEVRTKFSCSVSFLAVSGLVVIGRFTHDASLIIRGEMGLSEEDQKKTQ
FT                   EGRFQLNGTVHSVKINGKSRAAEPNGCCQQNGNSSSCCQDDTTLMLSLGTSEDNQLESE
FT                   NNTEKLTPGRKIAEKTFFRINSDKGSSTRKVCGIPTWLESWEREDTYAALAVVCAAASV
FT                   AVAYTCYKQL"
FT   exon            complement(124774..125106)
FT                   /number=1
FT   intron          complement(125107..125154)
FT                   /number=1
FT   exon            complement(125155..125384)
FT                   /number=2
FT   intron          complement(125385..125782)
FT                   /number=2
FT   exon            complement(125783..125985)
FT                   /number=3
FT   intron          complement(125986..126092)
FT                   /number=3
FT   exon            complement(126093..126178)
FT                   /number=4
FT   intron          complement(126179..126674)
FT                   /number=4
FT   exon            complement(126675..127052)
FT                   /number=5
FT   gene            128048..132052
FT                   /gene="AT4g26630"
FT   CDS_pept        complement(join(128048..128217,128305..128335,
FT                   128556..128647,128844..129342,129517..129600,
FT                   129683..129775,129975..130085,130165..130224,
FT                   130395..130477,130909..130942,131018..132052))
FT                   /gene="AT4g26630"
FT                   /product="putative protein"
FT                   /note="similarity to various Caenorhabditis elegans
FT                   predicted proteins"
FT                   /note="contains EST gb:AI996874.1, AI994758.1, H76680,
FT                   N38510, W43030, Z18476, AI996256.1"
FT                   /db_xref="GOA:Q9SUA1"
FT                   /db_xref="InterPro:IPR014876"
FT                   /db_xref="UniProtKB/TrEMBL:Q9SUA1"
FT                   /protein_id="CAB79518.1"
FT                   /translation="MGEDTKATIEPTANKTTSLEKPSEAMAGKENAGGKETQELAKDED
FT                   MAEPDNMEIDAQIKKDDEKAETEDKESEVKKNEDNAETQKMEEKVEVTKDEGQAEATNM
FT                   DEDADGKKEQTDDGVSVEDTVMKENVESKDNNYAKDDEKETKETDITEADHKKAGKEDI
FT                   QHEADKANGTKDGNTGDIKEEGTLVDEDKGTDMDEKVENGDENKQVENVEGKEKEDKEE
FT                   NKTKEVEAAKAEVDESKVEDEKEGSEDENDNEKVESKDAKEDEKEETNDDKEDEKEESK
FT                   GSKKRGKGTSSGGKVREKNKTEEVKKDAEPRTPFSDRPVRERKSVERLVALIDKDSSKE
FT                   FRVEKGRGAYLKDIPNVANKVMRKRSDETLKLLHPILFGGRRGKAAQIKTNILGFSGFV
FT                   WHGDEKKAKEKVKEKLEKCTKEKLWEFCDVLDIHITKATTKKEDIITKLFEFLEKPHVT
FT                   GDVTGDTTVSEKEKSSKGAKRKRTPKKTSPTAGSSSSKRSAKSQKKSEEATKVVKKSLA
FT                   HSDDESEEEKEEEEKQEEEKAEEKEEKKEEENENGIPDKSEDEAPQPSESEEKDESEEH
FT                   SEEETTKKKRGSRLSAGKKESAGRARNKKAVVAAKSSPPEKITQKRSSAKRKKTDDDSD
FT                   TSPKASSKRKKSENPIKASPAPSKSASKEKPVKRAGKGKDKPSDKVLKNAIVEILKRVD
FT                   FSTATFTDILKELAKEFTEDLTPRKSSIKMIIQEELTKLADEEEEEEKKEEDSEKEEAG
FT                   GSGGGEEVKA"
FT   exon            complement(128048..128217)
FT                   /number=1
FT   intron          complement(128218..128304)
FT                   /number=1
FT   exon            complement(128305..128335)
FT                   /number=2
FT   intron          complement(128336..128555)
FT                   /number=2
FT   exon            complement(128556..128647)
FT                   /number=3
FT   intron          complement(128648..128843)
FT                   /number=3
FT   exon            complement(128844..129342)
FT                   /number=4
FT   intron          complement(129343..129516)
FT                   /number=4
FT   exon            complement(129517..129600)
FT                   /number=5
FT   intron          complement(129601..129682)
FT                   /number=5
FT   exon            complement(129683..129775)
FT                   /number=6
FT   intron          complement(129776..129974)
FT                   /number=6
FT   exon            complement(129975..130085)
FT                   /number=7
FT   intron          complement(130086..130164)
FT                   /number=7
FT   exon            complement(130165..130224)
FT                   /number=8
FT   intron          complement(130225..130394)
FT                   /number=8
FT   exon            complement(130395..130477)
FT                   /number=9
FT   intron          complement(130478..130908)
FT                   /number=9
FT   exon            complement(130909..130942)
FT                   /number=10
FT   intron          complement(130943..131017)
FT                   /number=10
FT   exon            complement(131018..132052)
FT                   /number=11
FT   gene            134473..137868
FT                   /gene="AT4g26640"
FT   CDS_pept        complement(join(134473..134944,135209..135364,
FT                   135449..135605,135696..136200,136493..136648,
FT                   136725..136766,137641..137868))
FT                   /gene="AT4g26640"
FT                   /product="putative protein"
FT                   /note="similarity to SPF1 protein -Ipomoea batatas,
FT                   PIR2:S51529"
FT                   /note="contains EST gb:AA585811, AI995443.1, N37131,
FT                   T44598, AI993164.1, F14100, T45479, W43265"
FT                   /db_xref="GOA:Q93WV0"
FT                   /db_xref="InterPro:IPR003657"
FT                   /db_xref="InterPro:IPR036576"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q93WV0"
FT                   /protein_id="CAB79519.1"
FT                   /translation="MNPQANDRKEFQGDCSATGDLTAKHDSAGGNGGGGARYKLMSPAK
FT                   LPISRSTDITIPPGLSPTSFLESPVFISNIKKTVFFKTSCLLIDQPEPSPTTGSLFKPR
FT                   PVHISASSSSYTGRGFHQNTFTEQKSSEFEFRPPASNMVYAELGKIRSEPPVHFQGQGH
FT                   GSSHSPSSISDAAGSSSELSRPTPPCQMTPTSSDIPAGSDQEESIQTSQNDSRGSTPSI
FT                   LADDGYNWRKYGQKHVKGSEFPRSYYKCTHPNCEVKKLFERSHDGQITDIIYKGTHDHP
FT                   KPQPGRRNSGGMAAQEERLDKYPSSTGRDEKGSGVYNLSNPNEQTGNPEVPPISASDDG
FT                   GEAAASNRNKDEPDDDDPFSKRRRMEGAMEITPLVKPIREPRVVVQTLSEVDILDDGYR
FT                   WRKYGQKVVRGNPNPRSYYKCTAHGCPVRKHVERASHDPKAVITTYEGKHDHDVPTSKS
FT                   SSNHEIQPRFRPDETDTISLNLGVGISSDGPNHASNEHQHQNQQLVNQTHPNGVNFRFV
FT                   HASPMSSYYASLNSGMNQYGQRETKNETQNGDISSLNNSSYPYPPNMGRVQSGP"
FT   exon            complement(134473..134944)
FT                   /number=1
FT   intron          complement(134945..135208)
FT                   /number=1
FT   exon            complement(135209..135364)
FT                   /number=2
FT   intron          complement(135365..135448)
FT                   /number=2
FT   exon            complement(135449..135605)
FT                   /number=3
FT   intron          complement(135606..135695)
FT                   /number=3
FT   exon            complement(135696..136200)
FT                   /number=4
FT   intron          complement(136201..136492)
FT                   /number=4
FT   exon            complement(136493..136648)
FT                   /number=5
FT   intron          complement(136649..136724)
FT                   /number=5
FT   exon            complement(136725..136766)
FT                   /number=6
FT   intron          complement(136767..137640)
FT                   /number=6
FT   exon            complement(137641..137868)
FT                   /number=7
FT   repeat_region   140177..140199
FT   gene            142921..144981
FT                   /gene="AT4g26650"
FT   CDS_pept        join(142921..143148,143552..144670,144754..144981)
FT                   /gene="AT4g26650"
FT                   /product="hnRNP-like protein"
FT                   /note="several differences to database entry PID:e1169033"
FT                   /note="Contains Eukaryotic putative RNA-binding region
FT                   RNP-1 signature AA49-56;Eukaryotic putative RNA-binding
FT                   region RNP-1 signature AA156-163"
FT                   /note="contains EST gb:T21874, AI995401.1, Z24471"
FT                   /db_xref="GOA:Q9SU99"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR034131"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="UniProtKB/TrEMBL:Q9SU99"
FT                   /protein_id="CAB79520.1"
FT                   /translation="MESASDLGKLFIGGISWDTDEERLQEYFGKYGDLVEAVIMRDRTT
FT                   GRARGFGFIVFADPSVAERVIMDKHIIDGRTVEAKKAVPRDDQQVLKRHASPMHLISPS
FT                   HGGNGGGARTKKIFVGGLPSSITEAEFKNYFDQFGTIADVVVMYDHNTQRPRGFGFITF
FT                   DSEESVDMVLHKTFHELNGKMVEVKRAVPKELSSTTPNRSPLIGYGNNYGVVPNRSSAN
FT                   SYFNSFPPGYNNNNLGSAGRFSPIGSGRNAFSSFGLGLNQELNLNSNFDGNTLGYSRIP
FT                   GNQYFNSASPNRYNSPIGYNRGDSAYNPSNRDLWGNRSDSSGPGWNLGVSVGNNRGNWG
FT                   LSSVVSDNNGYGRSYGAGSGLSGLSFAGNTNGFDGSIGELYRGSSVYSDSTWQQSMPHH
FT                   QSSNELDGLSRSYGFGIDNVGSDPSANASEGYSGNYNVGNRQTHRGTLIDVLKHRKKST
FT                   KRSENCRSRRTAISVAEFEELLFRYQVEKETNFLHHSEFLVLFFSSLASQTQKREVYFY
FT                   FKNSYIR"
FT   exon            142921..143148
FT                   /number=1
FT   intron          143149..143551
FT                   /number=1
FT   exon            143552..144670
FT                   /number=2
FT   intron          144671..144753
FT                   /number=2
FT   exon            144754..144981
FT                   /number=3
FT   gene            145929..148989
FT                   /gene="AT4g26660"
FT   CDS_pept        join(145929..146186,146310..146480,146599..147456,
FT                   147555..147641,147849..148616,148711..148989)
FT                   /gene="AT4g26660"
FT                   /product="putative protein"
FT                   /note="similarity to probable kinesin - Arabidopsis
FT                   thaliana, Pir2:H71402"
FT                   /note="Contains Prokaryotic membrane lipoprotein lipid
FT                   attachment site AA219-229"
FT                   /note="contains EST gb:AI998850.1"
FT                   /db_xref="GOA:Q9SU98"
FT                   /db_xref="InterPro:IPR027640"
FT                   /db_xref="UniProtKB/TrEMBL:Q9SU98"
FT                   /protein_id="CAB79521.1"
FT                   /translation="MKSPAILSENRFLGSITSSSIRNLLPKSISGKQKPIIQNPDTKIP
FT                   RSNDENAIPVDPNQKASDHHTALQFTKQSDSKDGNFGEPIKDNKMGQSTFAEDKRSLLD
FT                   SPLKVESRSILSRRTNSVPSEIKEEDDDDSLGDQIRELKEELIRTKSDGYNKADASKSG
FT                   HFARDSLSQLRVSINKSLLMSCPKRDESEGKEVIVDGEDVLELNKHIEKLHGSYDSVHS
FT                   SFASASCYEADSMSGDDEDVCSEDLEKPMHGNHKDVDFVDNDPSQLDNVEFDTTGSGIS
FT                   IRSQLPSCVLEEPIFSESPKFKNVQKSVAASTKFSANPRNVSESSNIGDMKVNQISPCM
FT                   SKKVSGPTDSLAASLQRGLQIIDYHQGSSLSKSSSVSFSFGHMALKPCAEGENLNASVQ
FT                   SFRKDKASEGGLSSILLCLSCRKKVDQEAEVTEEAGSNEKHLKNMCMEQAAKIEELTLL
FT                   LRKSDDGEDGTEFIKETYETKQISEEFGKTNFEVSEKEALLKEIADLKSKLQPTKSTDN
FT                   LRSSLLLRSIQMRKSIDVSRNGENSDDLAKEREMWTEMESEWISLTDDLRMDIDNHRSR
FT                   AENLEFELKQEKLATEELNDALTRAVLGHSRFIEQYTELQETYNELGEKHSVMMAGITD
FT                   VKKAASKAAMNGRHGKRFAKAFSDELSAIRAEKEKERELLKKENKNLRTQLRDTAEAVQ
FT                   AAGELLVRLRESEQALQVSEERFSVVEEEKERLKKQMEQLKSKHKTEIGTMKQYLAESK
FT                   LPGSALLQPWYKDEEDEIEQVSEHETGAVSFDDYEDDQAWRAEFGATYQDHHY"
FT   exon            145929..146186
FT                   /number=1
FT   intron          146187..146309
FT                   /number=1
FT   exon            146310..146480
FT                   /number=2
FT   intron          146481..146598
FT                   /number=2
FT   exon            146599..147456
FT                   /number=3
FT   intron          147457..147554
FT                   /number=3
FT   exon            147555..147641
FT                   /number=4
FT   intron          147642..147848
FT                   /number=4
FT   exon            147849..148616
FT                   /number=5
FT   intron          148617..148710
FT                   /number=5
FT   exon            148711..148989
FT                   /number=6
FT   misc_feature    149163..160789
FT                   /note="overlap to BAC F10M23; please refer to this entry
FT                   for analysis and annotation"
FT   gene            149432..150754
FT                   /gene="AT4g26670"
FT   CDS_pept        join(149432..149633,150029..150087,150168..150240,
FT                   150342..150395,150516..150754)
FT                   /gene="AT4g26670"
FT                   /product="putative protein"
FT                   /note="weak similarity to probable membrane protein YDL217c
FT                   - yeast, EMBL:Z74265"
FT                   /note="Contains Prokaryotic membrane lipoprotein lipid
FT                   attachment site AA129-139"
FT                   /note="contains EST gb:AA404844, T46407"
FT                   /db_xref="GOA:Q94EH2"
FT                   /db_xref="InterPro:IPR039175"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q94EH2"
FT                   /protein_id="CAB79522.1"
FT                   /translation="MAANDSSNAIDIDGNLDSDSNLNTDGDEATDNDSSKALVTIPAPA
FT                   VCLFRFAGDAAGGAVMGSIFGYGLFKKKGFKGSFADAGQSAKTFAVLSGVHSLVVCLLK
FT                   QIRGKDDAINVGVAGCCTGLALSFPGAPQALLQSCLTFGAFSFILEGLNKRQTALAHSV
FT                   SLRHQTGLFQDHHRALPLSLALPIPEEIKGAFSSFCKSLAKPRKF"
FT   exon            149432..149633
FT                   /number=1
FT   intron          149634..150028
FT                   /number=1
FT   exon            150029..150087
FT                   /number=2
FT   intron          150088..150167
FT                   /number=2
FT   exon            150168..150240
FT                   /number=3
FT   intron          150241..150341
FT                   /number=3
FT   exon            150342..150395
FT                   /number=4
FT   intron          150396..150515
FT                   /number=4
FT   exon            150516..150754
FT                   /number=5
FT   tRNA            151732..151804
FT                   /note="Ala-tRNA_(AGC)"
FT   gene            152028..153593
FT                   /gene="AT4g26680"
FT   CDS_pept        152028..153593
FT                   /gene="AT4g26680"
FT                   /product="putative protein"
FT                   /note="similarity to other putative proteins from
FT                   Arabidopsis"
FT                   /note="contains EST gb:AA395033, Z34229"
FT                   /db_xref="GOA:Q9SZ10"
FT                   /db_xref="InterPro:IPR002885"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9SZ10"
FT                   /protein_id="CAB79523.1"
FT                   /translation="MIRISIGVNRRLRYQFSSFAGYSGSENPRLFKTLGAANTPIPHRR
FT                   NPEPKGQDLDFVNVAHSHLIQSDWDKLNKLSDHLDSFRVKNVLLKIQKDYLLSLEFFNW
FT                   AKTRNPGSHSLETHAIVLHTLTKNRKFKSAESILRDVLVNGGVDLPAKVFDALLYSYRE
FT                   CDSTPRVFDSLFKTFAHLKKFRNATDTFMQMKDYGFLPTVESCNAYMSSLLGQGRVDIA
FT                   LRFYREMRRCKISPNPYTLNMVMSGYCRSGKLDKGIELLQDMERLGFRATDVSYNTLIA
FT                   GHCEKGLLSSALKLKNMMGKSGLQPNVVTFNTLIHGFCRAMKLQEASKVFGEMKAVNVA
FT                   PNTVTYNTLINGYSQQGDHEMAFRFYEDMVCNGIQRDILTYNALIFGLCKQAKTRKAAQ
FT                   FVKELDKENLVPNSSTFSALIMGQCVRKNADRGFELYKSMIRSGCHPNEQTFNMLVSAF
FT                   CRNEDFDGASQVLREMVRRSIPLDSRTVHQVCNGLKHQGKDQLVKKLLQEMEGKKFLQE
FT                   SFNN"
FT   exon            152028..153593
FT                   /number=1
FT   gene            153968..157731
FT                   /gene="AT4g26690"
FT   CDS_pept        complement(join(153968..154263,154346..154829,
FT                   154930..155072,155273..155557,155650..155688,
FT                   155784..156401,156477..156770,156945..157076,
FT                   157710..157731))
FT                   /gene="AT4g26690"
FT                   /product="putative protein"
FT                   /note="weak similarity to hypothetical protein PFB0835c -
FT                   malaria, PID:g3845289"
FT                   /note="contains EST gb:AI994396.1, T42321, R65259,
FT                   AA720169, R64793"
FT                   /db_xref="GOA:Q9SZ11"
FT                   /db_xref="InterPro:IPR017946"
FT                   /db_xref="InterPro:IPR030395"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9SZ11"
FT                   /protein_id="CAB79524.1"
FT                   /translation="MNANACKDNPTMRGLLRASSLLLCGVILIQLLAAQIHAQSKKPKS
FT                   PWPTLTGDPPLVIARGGFSGLFPDSSYDAYNFAILTSVPDAVLWCDVQLTKDALGICFP
FT                   DLTMRNSSSIEAVYPTRQKSYPVNGVPTSGWFTIDFSLKDLKDVNLIRGILSRSEKFDG
FT                   NSNPIMTVQSVSTQMKPSFFWLNVQHDAFYAQHNLSMSSFLVAASKTVLIDFISSPEVN
FT                   FFKKIAGRFGRNGPSLVFRFLGQDEFEPTTNRTYGSILSNLTFVKTFASGILVPKSYIL
FT                   PLDDQQYLLPHTSLVQDAHKAGLEVFVSGFANDIDIAHDYSFDPVSEYLSFVDNGNFSV
FT                   DGVLSDFPITASASLDCFSHVGRNATKQVDFLVITKDGASGDYPGCTDLAYKKAIKDGA
FT                   DVIDCSVQLSSDGTPFCLSSIDLGNSTTVSLTAFRNRSTTVPELGSLGAIYTFSLTWAE
FT                   IQTLTPAISNPYRVTSLFRNPKQKNAGKLFSLSDFLSLAKNSTSLSGVLISVENAAYLR
FT                   EEQGLDVVKAVLDTLTQTGYSNSTATKVMIQSTNSSVLVDFKKQSQYETVYKVEENIRD
FT                   ILDSAIEDIKKFADAVVIQKLSVFPVAQSFITTQTNVVEKLQKSQLPVYVELFQNEFLS
FT                   QPYDFFADATVEINSYITGAGINGTITEFPFTAARYKRNLCLGRKETIPYMAPAQPGAL
FT                   LTLVSPTAFPPAEAPNPVFTDADVTEPPLPPVTAKAPTSSPGTPSTNAQAPSGQTRITL
FT                   SLLLSVFAMVLASLLLL"
FT   exon            complement(153968..154263)
FT                   /number=1
FT   intron          complement(154264..154345)
FT                   /number=1
FT   exon            complement(154346..154829)
FT                   /number=2
FT   intron          complement(154830..154929)
FT                   /number=2
FT   exon            complement(154930..155072)
FT                   /number=3
FT   intron          complement(155073..155272)
FT                   /number=3
FT   exon            complement(155273..155557)
FT                   /number=4
FT   intron          complement(155558..155649)
FT                   /number=4
FT   exon            complement(155650..155688)
FT                   /number=5
FT   intron          complement(155689..155783)
FT                   /number=5
FT   exon            complement(155784..156401)
FT                   /number=6
FT   intron          complement(156402..156476)
FT                   /number=6
FT   exon            complement(156477..156770)
FT                   /number=7
FT   intron          complement(156771..156944)
FT                   /number=7
FT   exon            complement(156945..157076)
FT                   /number=8
FT   intron          complement(157077..157709)
FT                   /number=8
FT   exon            complement(157710..157731)
FT                   /number=9
FT   gene            160935..164601
FT                   /gene="AT4g26700"
FT   CDS_pept        join(160935..161021,161095..161265,161365..161606,
FT                   161692..161863,161976..162014,162096..162164,
FT                   162245..162361,162649..162860,163134..163286,
FT                   163428..163627,163726..163883,163983..164079,
FT                   164174..164265,164347..164601)
FT                   /gene="AT4g26700"
FT                   /product="fimbrin-like protein (ATFIM1)"
FT                   /note="one AA substitution to fimbrin-like protein -
FT                   Arabidopsis thaliana, PID:g2905893"
FT                   /note="nearly identical with fimbrin 1, PID:g2811230,
FT                   partial CDS"
FT                   /note="contains EST gb:Z29761, Z29762"
FT                   /db_xref="GOA:Q7G188"
FT                   /db_xref="InterPro:IPR001589"
FT                   /db_xref="InterPro:IPR001715"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="InterPro:IPR036872"
FT                   /db_xref="InterPro:IPR039959"
FT                   /db_xref="PDB:1PXY"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7G188"
FT                   /protein_id="CAB79525.1"
FT                   /translation="MSGYVGVVVSDPWLQSQFTQVELRTLNSKYVSVKNQNGKVTIEDL
FT                   PPLFAKLKALSATFKEDEIKGMLGELGSDTSTDVSFEEFLKIYLNLLSKAAEKSGGHHK
FT                   NSSSFLKACTTTLLHTIYQSEKGPFVQHINRYLGDDPFLKQFLPLDPHSNQLYELVKDG
FT                   VLLCKLINVAVPGTIDERAINTKRVLNPWERNENHTLCLNSAKAVGCSVVNIGTQDLAE
FT                   GRPHLVLGLISQLIKIQVLADLNLKKTPQLVELLEDSDDVEELLRLPPEKVLLKWMNFH
FT                   LKKGGYKKTVSNFSADLKDAQAYAFLLNVLAPEHCDPATLDAKDPLERAELVLSHAERM
FT                   NCKRYLTAEEIVEGSSTLNLAFVAQIFHERNGLNKDGKYAFAEMMTEDVETCRDERCYR
FT                   LWINSLGIDSYVNNVFEDVRNGWILLEVLDKVSPSSVNWKHASKPPIKMPFRKVENCNQ
FT                   VIKIGKQLKFSLVNVAGNDIVQGNKKLILGLLWQLMRFHMLQLLKSLRSRTLGKEMTDA
FT                   DILSWANRKVRTMGRKLQIESFKDKSLSSGLFFLNLLWAVEPRVVNWNLVTKGETDDEK
FT                   RLNATYIVSVARKLGCSVFLLPEDIVEVNQKMILILTASIMYWSLQRHSRESSDSSSTQ
FT                   STTTTCTSTASSPAPSVTEEEEVSSLSGEVTSLAVGDAVSEITTVSEEASIE"
FT   exon            160935..161021
FT                   /number=1
FT   intron          161022..161094
FT                   /number=1
FT   exon            161095..161265
FT                   /number=2
FT   intron          161266..161364
FT                   /number=2
FT   exon            161365..161606
FT                   /number=3
FT   intron          161607..161691
FT                   /number=3
FT   exon            161692..161863
FT                   /number=4
FT   intron          161864..161975
FT                   /number=4
FT   exon            161976..162014
FT                   /number=5
FT   intron          162015..162095
FT                   /number=5
FT   exon            162096..162164
FT                   /number=6
FT   intron          162165..162244
FT                   /number=6
FT   exon            162245..162361
FT                   /number=7
FT   intron          162362..162648
FT                   /number=7
FT   exon            162649..162860
FT                   /number=8
FT   intron          162861..163133
FT                   /number=8
FT   exon            163134..163286
FT                   /number=9
FT   intron          163287..163427
FT                   /number=9
FT   exon            163428..163627
FT                   /number=10
FT   intron          163628..163725
FT                   /number=10
FT   exon            163726..163883
FT                   /number=11
FT   intron          163884..163982
FT                   /number=11
FT   exon            163983..164079
FT                   /number=12
FT   intron          164080..164173
FT                   /number=12
FT   exon            164174..164265
FT                   /number=13
FT   intron          164266..164346
FT                   /number=13
FT   exon            164347..164601
FT                   /number=14
FT   gene            165880..166843
FT                   /gene="AT4g26710"
FT   CDS_pept        join(165880..165977,166328..166375,166777..166843)
FT                   /gene="AT4g26710"
FT                   /product="putative protein"
FT                   /note="EST Z35392 covers intron in 5' untranslated region"
FT                   /note="contains EST gb:AI997240.1, Z25573, T44952, Z35392,
FT                   Z17955"
FT                   /db_xref="GOA:Q9SZ13"
FT                   /db_xref="InterPro:IPR008389"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9SZ13"
FT                   /protein_id="CAB79526.1"
FT                   /translation="MAFVVTSLIFAVVGIIASICTRICFNKGPSTNLLHLTLVITATVC
FT                   CWMMWAIVYIAQMNPLIVPILSEVE"
FT   exon            165880..165977
FT                   /number=1
FT   intron          165978..166327
FT                   /number=1
FT   exon            166328..166375
FT                   /number=2
FT   intron          166376..166776
FT                   /number=2
FT   exon            166777..166843
FT                   /number=3
FT   gene            167572..169329
FT                   /gene="AT4g26720"
FT   CDS_pept        complement(join(167572..167622,167705..167783,
FT                   167874..168142,168226..168301,168390..168475,
FT                   168554..168616,168727..168879,169189..169329))
FT                   /gene="AT4g26720"
FT                   /product="phosphoprotein phosphatase (PPX-1)"
FT                   /note="Contains Serine/threonine specific protein
FT                   phosphatases signature AA108-113"
FT                   /note="contains EST gb:H77057, N37575, T44811, AI992913.1,
FT                   T43788, H77152, AW004364.1, AI996959.1, R29983, R29984,
FT                   H36585, N37622, T42314, T41959, T41565, AA042143"
FT                   /db_xref="GOA:P48529"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR006186"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/Swiss-Prot:P48529"
FT                   /protein_id="CAB79527.1"
FT                   /translation="MSDLDRQIGQLKRCEPLSESEVKALCLKAMEILVEESNVQRVDAP
FT                   VTLCGDIHGQFYDMMELFKVGGDCPKTNYLFMGDFVDRGYYSVETFLLLLALKVRYPDR
FT                   ITLIRGNHESRQITQVYGFYDECLRKYGSSNVWRYCTDIFDYMSLSAVVENKIFCVHGG
FT                   LSPAIMTLDQIRTIDRKQEVPHDGAMCDLLWSDPEDIVDGWGLSPRGAGFLFGGSVVTS
FT                   FNHSNNIDYIARAHQLVMEGYKWMFDSQIVTVWSAPNYCYRCGNVASILELDENLNKEF
FT                   RVFDAAQQDSRGPPAKKPAPDYFL"
FT   exon            complement(167572..167622)
FT                   /number=1
FT   intron          complement(167623..167704)
FT                   /number=1
FT   exon            complement(167705..167783)
FT                   /number=2
FT   intron          complement(167784..167873)
FT                   /number=2
FT   exon            complement(167874..168142)
FT                   /number=3
FT   intron          complement(168143..168225)
FT                   /number=3
FT   exon            complement(168226..168301)
FT                   /number=4
FT   intron          complement(168302..168389)
FT                   /number=4
FT   exon            complement(168390..168475)
FT                   /number=5
FT   intron          complement(168476..168553)
FT                   /number=5
FT   exon            complement(168554..168616)
FT                   /number=6
FT   intron          complement(168617..168726)
FT                   /number=6
FT   exon            complement(168727..168879)
FT                   /number=7
FT   intron          complement(168880..169188)
FT                   /number=7
FT   exon            complement(169189..169329)
FT                   /number=8
FT   gene            169754..170484
FT                   /gene="AT4g26730"
FT   CDS_pept        join(169754..169825,169930..170484)
FT                   /gene="AT4g26730"
FT                   /product="putative protein"
FT                   /note="similarity to H+-transporting ATP synthase, (EC
FT                   3.6.1.34) chain a - Synechocystis, GB:AB001339"
FT                   /db_xref="GOA:Q9SZ14"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q9SZ14"
FT                   /protein_id="CAB79528.1"
FT                   /translation="MERNVEKMLNRVSVVFLSIGTVLMHLPLPKKNARIWFSGAWKSRL
FT                   SSFSTYFLRFRDLGFIQNHTKALCLSDGAGHAPMALSQIGLSDVTAVELVDSIPLVKRA
FT                   DPHNLPFFDRVFDFVFTAHLAEALFPWRFVEEMERTVRRGGFCVVAVDECSGDDVRDIA
FT                   RFFHNSKIVDVANVTLERVKRTSILFKLQDSKRTSILFKVQDSLS"
FT   exon            169754..169825
FT                   /number=1
FT   intron          169826..169929
FT                   /number=1
FT   exon            169930..170484
FT                   /number=2
FT   gene            170966..172453
FT                   /gene="AT4g26740"
FT   CDS_pept        complement(join(170966..171128,171255..171380,
FT                   171471..171565,171690..171775,171865..172014,
FT                   172336..172453))
FT                   /gene="AT4g26740"
FT                   /product="embryo-specific protein 1 (ATS1)"
FT                   /note="contains EST gb:Z27053, Z29900"
FT                   /db_xref="GOA:O81270"
FT                   /db_xref="InterPro:IPR007736"
FT                   /db_xref="UniProtKB/Swiss-Prot:O81270"
FT                   /protein_id="CAB79529.1"
FT                   /translation="MGSKTEMMERDAMATVAPYAPVTYHRRARVDLDDRLPKPYMPRAL
FT                   QAPDREHPYGTPGHKNYGLSVLQQHVSFFDIDDNGIIYPWETYSGLRMLGFNIIGSLII
FT                   AAVINLTLSYATLPGWLPSPFFPIYIHNIHKSKHGSDSKTYDNEGRFMPVNLELIFSKY
FT                   AKTLPDKLSLGELWEMTEGNRDAWDIFGWIAGKIEWGLLYLLARDEEGFLSKEAIRRCF
FT                   DGSLFEYCAKIYAGISEDKTAYY"
FT   exon            complement(170966..171128)
FT                   /number=1
FT   intron          complement(171129..171254)
FT                   /number=1
FT   exon            complement(171255..171380)
FT                   /number=2
FT   intron          complement(171381..171470)
FT                   /number=2
FT   exon            complement(171471..171565)
FT                   /number=3
FT   intron          complement(171566..171689)
FT                   /number=3
FT   exon            complement(171690..171775)
FT                   /number=4
FT   intron          complement(171776..171864)
FT                   /number=4
FT   exon            complement(171865..172014)
FT                   /number=5
FT   intron          complement(172015..172335)
FT                   /number=5
FT   exon            complement(172336..172453)
FT                   /number=6
FT   gene            173023..175557
FT                   /gene="AT4g26750"
FT   CDS_pept        complement(join(173023..173763,174034..174177,
FT                   174278..174353,174869..174978,175278..175378,
FT                   175464..175557))
FT                   /gene="AT4g26750"
FT                   /product="putative protein"
FT                   /note="similarity to extensin precursor - tomato,
FT                   Pir2:S25299"
FT                   /note="contains EST gb:AI994725.1, N37698, T46339,
FT                   AA404836"
FT                   /db_xref="GOA:Q9SZ15"
FT                   /db_xref="InterPro:IPR023175"
FT                   /db_xref="InterPro:IPR039431"
FT                   /db_xref="InterPro:IPR041212"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9SZ15"
FT                   /protein_id="CAB79530.1"
FT                   /translation="MSNPNEPARALLPYLQRADELQKHEPLVAYYCRLYAMERGLKIPQ
FT                   SERTKTTNSILMSLINQLEKDKKSLTLSPDDNMHVEGFALSVFAKADKQDRAGRADLGT
FT                   AKTFYAASIFFEILSQFGPVPPDIEQKHKYAAWKAADIRKAIKEGRKPTPGDPVDDDTD
FT                   LSIPSSGPSGSYDHSASDTNTTSHHRTELDPPHDSNDDSSHHQFPEVPQHPLPPRFYDN
FT                   PTNDYPADVPPPPPSSYPSNDHLPPPTGPSDSPYPHPYSHQPYHQDPPKHMPPPQNYSS
FT                   HEPSPNSLPNFQSYPSFSESSLPSTSPHYPSHYQNPEPYYSSPHSAPAPSSTSFSSAPP
FT                   PPPYSSNGRINIAPVLDPAPSSAQKYHYDSSYQPGPEKVAEALKAARFAVGALAFDEVS
FT                   TAVEHLKKSLELLTNPSAGAGH"
FT   exon            complement(173023..173763)
FT                   /number=1
FT   intron          complement(173764..174033)
FT                   /number=1
FT   exon            complement(174034..174177)
FT                   /number=2
FT   intron          complement(174178..174277)
FT                   /number=2
FT   exon            complement(174278..174353)
FT                   /number=3
FT   intron          complement(174354..174868)
FT                   /number=3
FT   exon            complement(174869..174978)
FT                   /number=4
FT   intron          complement(174979..175277)
FT                   /number=4
FT   exon            complement(175278..175378)
FT                   /number=5
FT   intron          complement(175379..175463)
FT                   /number=5
FT   exon            complement(175464..175557)
FT                   /number=6
FT   gene            176519..178475
FT                   /gene="AT4g26760"
FT   CDS_pept        complement(join(176519..176704,176798..177109,
FT                   177187..177342,177505..177720,177797..178072,
FT                   178127..178330,178404..178475))
FT                   /gene="AT4g26760"
FT                   /product="putative protein"
FT                   /note="similarity to hypothetical protein, Arabidopsis
FT                   thaliana chromosome II BAC T6A23, PID:g3786000"
FT                   /note="contains EST gb:AI992936.1, T41951, R30266"
FT                   /db_xref="GOA:Q8LEG3"
FT                   /db_xref="InterPro:IPR007145"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8LEG3"
FT                   /protein_id="CAB79531.1"
FT                   /translation="MAVTEAENPLLGEITCGTLLQKLQEIWDEVGESDEERDKLLLQIE
FT                   EECLNVYKKKVELAAKSRAELLQTLSDATVELSNLTTALGEKSYIDICDSMSLFPLQPD
FT                   KTSGTIKEQLSAIAPALEQLWQQKEERVRAFSDVQSQIQKICEEIAGGLNNGPHVVDET
FT                   DLSLKRLDDFQRKLQELQKEKSDRLQKVLEFVSTVHDLCAVLRLDFLSTVTEVHPSLDE
FT                   ANGVQTKSISNETLARLAKTVLTLKEDKMQRLKKLQELATQLTDLWNLMDTSDEERELF
FT                   DHVTSNISASVHEVTASGALALDLIEQAEVEVDRLDQLKSSRMKEIAFKKQSELEEIYA
FT                   RAHIEIKPEVVRERIMSLIDAGNTEPTELLADMDSQIAKAKEEAFSRKEILDRVEKWMS
FT                   ACEEESWLEDYNRDQNRYSASRGAHLNLKRAEKARILVSKITGKNFQKSLLVITTHRIK
FT                   LRLKNISYFVCASYG"
FT   exon            complement(176519..176704)
FT                   /number=1
FT   intron          complement(176705..176797)
FT                   /number=1
FT   exon            complement(176798..177109)
FT                   /number=2
FT   intron          complement(177110..177186)
FT                   /number=2
FT   exon            complement(177187..177342)
FT                   /number=3
FT   intron          complement(177343..177504)
FT                   /number=3
FT   exon            complement(177505..177720)
FT                   /number=4
FT   intron          complement(177721..177796)
FT                   /number=4
FT   exon            complement(177797..178072)
FT                   /number=5
FT   intron          complement(178073..178126)
FT                   /number=5
FT   exon            complement(178127..178330)
FT                   /number=6
FT   intron          complement(178331..178403)
FT                   /number=6
FT   exon            complement(178404..178475)
FT                   /number=7
FT   gene            179842..181872
FT                   /gene="AT4g26770"
FT   CDS_pept        join(179842..179961,180046..180448,180524..180665,
FT                   180740..180896,180988..181035,181113..181199,
FT                   181288..181416,181500..181556,181632..181715,
FT                   181783..181872)
FT                   /gene="AT4g26770"
FT                   /product="putative CDP-diacylglycerol synthetase"
FT                   /note="strong similarity to CDP-diacylglycerol synthetase -
FT                   Solanum tuberosum, PID:e205265"
FT                   /note="Contains Eukaryotic RNA polymerase II heptapeptide
FT                   repeat AA23-29"
FT                   /note="contains EST gb:AI993168.1, T45653, N97146,
FT                   AI996764.1"
FT                   /db_xref="GOA:Q1PE48"
FT                   /db_xref="InterPro:IPR000374"
FT                   /db_xref="InterPro:IPR016720"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1PE48"
FT                   /protein_id="CAB79532.1"
FT                   /translation="MNTNNQRDNHYPNIPNSPRDYNYTPSSPTARIRHRRRSSEVNRSN
FT                   VSRVSNLLLGDKNKYRSMWIRTCSSLWMLGGVVFIIYMGHLYIWAMVVVIQIFMAKELF
FT                   FLRRRAHEERRLPGFWLLNWHFFFTAMLFVYGRIIQQQLVNTVSSDRFIYKLVSGLIKY
FT                   QMVICYFLYIAGLIWFILTLKNKMYKYQFGQYAWTHMILIVVFTQSSFTVANIFEGIFW
FT                   FLLPAALIAMNDVAAYFFGFYFGKTPLIKLSPKKTWEGFIGASVATIISAFIFANVLGQ
FT                   FQWLTCPRKDFSTGWLHCDPGPLFRPEYYPFPSWITPFSPWKGISTLPVQWHAFSLGLF
FT                   ASIMAPFGGFFASGFKRAFKIKDFGDSIPGHGGFTDRMDCQMVMAVFAYIYIQSFIVNR
FT                   DYSVEMILDQISRSLGHEEQKMLYEKLGDILQHKLQGRF"
FT   exon            179842..179961
FT                   /number=1
FT   intron          179962..180045
FT                   /number=1
FT   exon            180046..180448
FT                   /number=2
FT   intron          180449..180523
FT                   /number=2
FT   exon            180524..180665
FT                   /number=3
FT   intron          180666..180739
FT                   /number=3
FT   exon            180740..180896
FT                   /number=4
FT   intron          180897..180987
FT                   /number=4
FT   exon            180988..181035
FT                   /number=5
FT   intron          181036..181112
FT                   /number=5
FT   exon            181113..181199
FT                   /number=6
FT   intron          181200..181287
FT                   /number=6
FT   exon            181288..181416
FT                   /number=7
FT   intron          181417..181499
FT                   /number=7
FT   exon            181500..181556
FT                   /number=8
FT   intron          181557..181631
FT                   /number=8
FT   exon            181632..181715
FT                   /number=9
FT   intron          181716..181782
FT                   /number=9
FT   exon            181783..181872
FT                   /number=10
FT   gene            182241..183735
FT                   /gene="AT4g26780"
FT   CDS_pept        complement(join(182241..182339,182435..182563,
FT                   182643..182810,182895..183338,183640..183735))
FT                   /gene="AT4g26780"
FT                   /product="grpE like protein"
FT                   /note="gDNA differs from cDNA AR192 (PID:g1669597) at two
FT                   positions but gDNAwas confirmed with a 10 fold coverage"
FT                   /note="nearly identical to cDNA AR192, that complements
FT                   pheromone receptorent mutant of Sizosaccharomyces pombe"
FT                   /note="Contains grpE protein signature AA253-296"
FT                   /note="contains EST gb:AI996540.1"
FT                   /db_xref="GOA:Q8LB47"
FT                   /db_xref="InterPro:IPR000740"
FT                   /db_xref="InterPro:IPR009012"
FT                   /db_xref="InterPro:IPR013805"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8LB47"
FT                   /protein_id="CAB79533.1"
FT                   /translation="MLVLRILSRVTRNAGIRSSLSAVTLPARNQTPLVPAQMSMMDSFA
FT                   LQRFNFSSSTSPESDEKKTHTEASKTSEEKPTAEANQPGLDSESKDSVTDSAKRKRKGA
FT                   KGAASSSSESDSESDDDELSADDLVKLVAEKEELLSEKEEEIKQLKDKVLRTYAEMENV
FT                   MDRTRRDAENTKKYAVQNFAKSLLDVADNLGRASSVVKESFSKLDTSEDSAGAAPLLKT
FT                   LLEGVEMTEKQLAEVFKKFGMEKYDPINEPFDPNRHNAVFQVPDASKPEGTVAHVLKSG
FT                   YTLYDRVIRPAEVGVTQGGENQEEKKESDA"
FT   exon            complement(182241..182339)
FT                   /number=1
FT   intron          complement(182340..182434)
FT                   /number=1
FT   exon            complement(182435..182563)
FT                   /number=2
FT   intron          complement(182564..182642)
FT                   /number=2
FT   exon            complement(182643..182810)
FT                   /number=3
FT   intron          complement(182811..182894)
FT                   /number=3
FT   exon            complement(182895..183338)
FT                   /number=4
FT   intron          complement(183339..183639)
FT                   /number=4
FT   exon            complement(183640..183735)
FT                   /number=5
FT   gene            185034..186324
FT                   /gene="AT4g26790"
FT   CDS_pept        join(185034..185405,185466..185997,186131..186324)
FT                   /gene="AT4g26790"
FT                   /product="putative APG protein"
FT                   /note="similarity to proline-rich protein APG - Arabidopsis
FT                   thaliana, EMBL:X60377"
FT                   /note="Contains Aminotransferases class-V
FT                   pyridoxal-phosphate attachment site AA216-234"
FT                   /note="contains EST gb:T04213, T46442, T42101, AI992441.1,
FT                   H36224, H77179, T42929, N97259"
FT                   /db_xref="GOA:Q8VY93"
FT                   /db_xref="InterPro:IPR001087"
FT                   /db_xref="InterPro:IPR035669"
FT                   /db_xref="InterPro:IPR036514"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8VY93"
FT                   /protein_id="CAB79534.1"
FT                   /translation="MQRNRVLAFLLLAAQLLVKIPETCAKFPALIVFGDSTVDSGNNNQ
FT                   ISTVLKSNFQPYGRDYFDGKATGRFSNGRIAPDFISEGLGLKNAVPAYLDPAYNIADFA
FT                   TGVCFASAGTGLDNATSAVLISDMLSLNCHRFLKSVMPLWKEVEYYKEYQTRLRSYLGE
FT                   EKANEIISESLYLISIGTNDFLENYYLLPRKLRKYSVNEYQYFLIGIAADFVTDIYRLG
FT                   ARKMSLSGLSPFGCLPLERTTQLFYGSKCIEEYNIVARDFNIKMEEKVFQLNRDLNGIQ
FT                   LVFSNPYDLVSEIIYHPEAFGFENVRSACCGTGYYEMSYLCDKMNPFTCSDASKYVFWD
FT                   SFHPTEKTNAIVANHVLKYDLSRFQ"
FT   exon            185034..185405
FT                   /number=1
FT   intron          185406..185465
FT                   /number=1
FT   exon            185466..185997
FT                   /number=2
FT   intron          185998..186130
FT                   /number=2
FT   exon            186131..186324
FT                   /number=3
FT   gene            187314..188633
FT                   /gene="AT4g26800"
FT   CDS_pept        187314..188633
FT                   /gene="AT4g26800"
FT                   /product="putative protein"
FT                   /note="similarity to other Arabidopsis putative proteins"
FT                   /note="contains EST gb:AA728420"
FT                   /db_xref="InterPro:IPR002885"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9SZ20"
FT                   /protein_id="CAB79535.1"
FT                   /translation="MAYSYPLPSIVEFNKVLTAIAKMQMYDVVINLWKRIENAEGIEIS
FT                   PDLYTCNILVNCFCRCFQPSSALSYLGKMMKLGIEPDIVTASSLVNGFCLSNSIKDAVY
FT                   VAGQMEKMGIKRDVVVDTILIDTLCKNRLVVPALEVLKRMKDRGISPNVVTYSSLITGL
FT                   CKSGRLADAERRLHEMDSKKINPNVITFSALIDAYAKRGKLSKVDSVYKMMIQMSIDPN
FT                   VFTYSSLIYGLCMHNRVDEAIKMLDLMISKGCTPNVVTYSTLANGFFKSSRVDDGIKLL
FT                   DDMPQRGVAANTVSCNTLIKGYFQAGKIDLALGVFGYMTSNGLIPNIRSYNIVLAGLFA
FT                   NGEVEKALSRFEHMQKTRNDLDIITYTIMIHGMCKACMVKEAYDLFYKLKFKRVEPDFK
FT                   AYTIMIAELNRAGMRTEADALNRFYQKHVRQNESAPAEVS"
FT   exon            187314..188633
FT                   /number=1
FT   gene            189422..189824
FT                   /gene="AT4g26810"
FT   CDS_pept        complement(join(189422..189568,189651..189824))
FT                   /gene="AT4g26810"
FT                   /product="putative protein"
FT                   /note="similarity to other Arabidopsis hypothetical
FT                   proteins"
FT                   /note="contains EST gb:AA713223"
FT                   /db_xref="InterPro:IPR003121"
FT                   /db_xref="InterPro:IPR019835"
FT                   /db_xref="InterPro:IPR036885"
FT                   /db_xref="UniProtKB/TrEMBL:Q9SZ21"
FT                   /protein_id="CAB79536.1"
FT                   /translation="MLPQRLKKAITDNPKKLGNLIDLVNLPSTLRNFVGQSQISRLGCF
FT                   MRVWSYIKTNNLQDPKNKNVVICDEKLKSILLGKQRVELVDLPSLIKLHFPKEQKKNSQ
FT                   KI"
FT   exon            complement(189422..189568)
FT                   /number=1
FT   intron          complement(189569..189650)
FT                   /number=1
FT   exon            complement(189651..189824)
FT                   /number=2
FT   gene            190628..191356
FT                   /gene="AT4g26820"
FT   CDS_pept        complement(190628..191356)
FT                   /gene="AT4g26820"
FT                   /product="hypothetical protein"
FT                   /note="Contains Prokaryotic membrane lipoprotein lipid
FT                   attachment site AA53-63"
FT                   /db_xref="GOA:Q9SZ22"
FT                   /db_xref="UniProtKB/TrEMBL:Q9SZ22"
FT                   /protein_id="CAB79537.1"
FT                   /translation="MDDEQNLVEEMNQQLLITVIDTEKVPELRPISSRSHQESEPANIS
FT                   HWSLLFKLFLAITIMGACVAGVTFVILITPTPPTVHVQSMHISFANHNLPVWSATFSIK
FT                   NPNEKLHVTYENPSVWLVHRGKLVSTARADSFWQKGGEKNEVIVKRNETKVIDEEAAWE
FT                   MEDEVAVTGGVVGLDMVFSGRVGFYPGTSALWGEQYMSAVCENVSAKLYNVDDEIYGTN
FT                   RSVLSFDGRLVCSVRLPKYP"
FT   exon            complement(190628..191356)
FT                   /number=1
FT   gene            192216..193662
FT                   /gene="AT4g26830"
FT   CDS_pept        complement(join(192216..193501,193602..193662))
FT                   /gene="AT4g26830"
FT                   /product="putative beta-1, 3-glucanase"
FT                   /note="strong similarity to beta-1, 3-glucanase precursor -
FT                   Oryza sativa, PID:g4097948"
FT                   /note="Contains Glycosyl hydrolases family 17 signature
FT                   AA256-269"
FT                   /note="contains EST gb:AI997480.1, AI998957.1"
FT                   /db_xref="GOA:Q9SZ23"
FT                   /db_xref="InterPro:IPR000490"
FT                   /db_xref="InterPro:IPR012946"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:Q9SZ23"
FT                   /protein_id="CAB79538.1"
FT                   /translation="MAVSFLPYFLILSFLSAIDAHSGMVGVNYGRIANNLPSPEKVVNL
FT                   LKSQGINRIKIFDTDKNVLTALANSKIKVIVALPNELLSSAASHQSFADNWIKTHIMPY
FT                   FPATEIEAIAVGNEVFVDPTITPYLVNAMKNIHTSLVKYKLDKAIKISSPIALSALANS
FT                   YPPSSGSFKPELIEPVVKPMLALLQQTSSYLMVNAYPFFAYAANADKISLDYALFKENA
FT                   GNIDSGTGLKYNSLFDAQIDAVYAALSAVGFKGVKVMVTETGWPSVGDENEIGASESNA
FT                   AAYNAGLVKRVLTGKGTPLRPTEPLNVYLFALFNENQKPGPTSERNYGLFYPNEGKVYN
FT                   VPFTKKSTTPVNGNRGKVPVTHEGHTWCVSNGEVAKEKLQEALDYACGEGGADCRPIQP
FT                   GATCYHPESLEAHASYAFNSYYQKNSRRVGTCFFGGAAHVVTQPPRTLI"
FT   exon            complement(192216..193501)
FT                   /number=1
FT   intron          complement(193502..193601)
FT                   /number=1
FT   exon            complement(193602..193662)
FT                   /number=2
FT   gene            194641..195633
FT                   /gene="AT4g26840"
FT   CDS_pept        join(194641..194715,195325..195474,195556..195633)
FT                   /gene="AT4g26840"
FT                   /product="ubiquitin-like protein"
FT                   /note="strong similarity to ubiquitin-like protein -
FT                   Arabidopsis thaliana (thale cress), PID:e259962"
FT                   /note="Contains Inorganic pyrophosphatase signature
FT                   AA80-86"
FT                   /note="contains EST gb:AI993416.1, N97261, AI100083,
FT                   T76809, H76365, Z17481, AW004209.1, F15343"
FT                   /db_xref="GOA:P55852"
FT                   /db_xref="InterPro:IPR000626"
FT                   /db_xref="InterPro:IPR022617"
FT                   /db_xref="InterPro:IPR029071"
FT                   /db_xref="UniProtKB/Swiss-Prot:P55852"
FT                   /protein_id="CAB79539.1"
FT                   /translation="MSANQEEDKKPGDGGAHINLKVKGQDGNEVFFRIKRSTQLKKLMN
FT                   AYCDRQSVDMNSIAFLFDGRRLRAEQTPDELDMEDGDEIDAMLHQTGGSGGGATA"
FT   exon            194641..194715
FT                   /number=1
FT   intron          194716..195324
FT                   /number=1
FT   exon            195325..195474
FT                   /number=2
FT   intron          195475..195555
FT                   /number=2
FT   exon            195556..195633
FT                   /number=3
FT   gene            196437..198320
FT                   /gene="AT4g26850"
FT   CDS_pept        complement(join(196437..196796,196880..197128,
FT                   197224..197404,197478..197746,197860..197919,
FT                   198002..198113,198172..198320))
FT                   /gene="AT4g26850"
FT                   /product="putative protein"
FT                   /note="contains EST gb:AI997404.1, H36924, AA598191,
FT                   AA404925, R90050, N96762, N96025, AA651325, AA605436,
FT                   AI993313.1"
FT                   /db_xref="GOA:Q8RWE8"
FT                   /db_xref="InterPro:IPR026506"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8RWE8"
FT                   /protein_id="CAB79540.1"
FT                   /translation="MLKIKRVPTVVSNYQKDDGAEDPVGCGRNCLGACCLNGTFWKPES
FT                   SFLIMLPLYACKNLVKSGEKLVISHEAIEPPVAFLESLVLGEWEDRFQRGLFRYDVTAC
FT                   ETKVIPGKYGFVAQLNEGRHLKKRPTEFRVDKVLQSFDGSKFNFTKVGQEELLFQFEAG
FT                   EDAQVQFFPCMPIDPENSPSVVAINVKTLVQRACPIEYGHVLLIPRVLDCLPQRIDHKS
FT                   LLLAVHMAAEAANPYFRLGYNSLGAFATINHLHFQAYYLAMPFPLEKAPTKKITTTVSG
FT                   VKISELLSYPVRSLLFEGGSSMQELSDTVSDCCVCLQNNNIPFNILISDCGRQIFLMPQ
FT                   CYAEKQALGEVSPEVLETQVNPAVWEISGHMVLKRKEDYEGASEDNAWRLLAEASLSEE
FT                   RFKEVTALAFEAIGCSNQEEDLEGTIVHQQNSSGNVNQKSNRTHGGPITNGTAAECLVL
FT                   Q"
FT   exon            complement(196437..196796)
FT                   /number=1
FT   intron          complement(196797..196879)
FT                   /number=1
FT   exon            complement(196880..197128)
FT                   /number=2
FT   intron          complement(197129..197223)
FT                   /number=2
FT   exon            complement(197224..197404)
FT                   /number=3
FT   intron          complement(197405..197477)
FT                   /number=3
FT   exon            complement(197478..197746)
FT                   /number=4
FT   intron          complement(197747..197859)
FT                   /number=4
FT   exon            complement(197860..197919)
FT                   /number=5
FT   intron          complement(197920..198001)
FT                   /number=5
FT   exon            complement(198002..198113)
FT                   /number=6
FT   intron          complement(198114..198171)
FT                   /number=6
FT   exon            complement(198172..198320)
FT                   /number=7
XX
SQ   Sequence 198320 BP; 62446 A; 38030 C; 37638 G; 60206 T; 0 other;
     atcatttaca actttagagt ccaaggagac agtattctta gcataaaagc ctctatatcc        60
     accctgaaaa agtctcaagc atgtgaaaat gaaacaaatg aataccgtgt ttgttttggt       120
     aagaaggaga ttacaatcac agaaacttac atctattccc agtattctct tcactccata       180
     catataagat agactgctca ctatttctct aatcacggta ttaaggccag gacaaagacc       240
     tccacaggta actatgcaag catgcacttc atcagattcg aagtatacct gcagagaact       300
     aagtcaacaa cagaccctat tgaaatggaa aaaggacttt aaagcaattc gataaaacga       360
     cgaaaaacct tctgacgtgg cccggctcgt ctaaaatgaa tcccccttgg accatccttg       420
     tgaacaacga tctaaaacaa caaaaagaag agtcagtaag acaaaacatg agctccaaat       480
     tctcaggatg ccctgatatt atagaaagaa cccaaccaaa tatatacctt ttgaggaaca       540
     ctgtcatcag catcaacaaa gtattgcctg aaaatttcca aaaataaaaa actaatgtaa       600
     caactgcagg ctaatgattg aatcaccata ggacacaatt aggaacctta gtcaccaaaa       660
     catctgtgag aaaggactta cttaaccact gagtaagctg gattgtcttg caatggatta       720
     ggataagtct acaataacat aaaaccaaaa gaaaattgac cattaatcaa aacttaacca       780
     tcattcgatc ccaaaaataa catggtaaaa ggacaaaaac tcttaaacca tgctacagat       840
     tttgatccag gttcataatt cttgagaccc aaatacaaaa gacccctttt tctttaccct       900
     gggctatctt atactaatca gaatctggga aattcatttc atctatctca aattccaaac       960
     aaaaaaacta aacagtcctc agctgaaaaa attgatatat aaatatctat caacatagat      1020
     caaagtttca accttttgca acagttaaag ctcaaaagca aaagctttaa tcaaatcaga      1080
     ttaaaaaaag agagaggtaa acatacagga agaccaggaa ggtaatcgga gagatgcggt      1140
     acatcttcta gaacataacc acaagagcca ttgatgatct tcggtttgct actctccaca      1200
     gtactcataa cgaacgctcg aaacagagga acaacaattt caggggaaaa gtcttataat      1260
     ataataaaaa acgatttttt tttctggtat agagactttt gaactggtca actacaaatt      1320
     gaatacgaaa gcaggaagaa aggtaaaaag aaagatgaat caaatccgtt gatcaaaaac      1380
     aaggcgaccc atttttatag gagtagagaa attttgacca ttgtagtcgg taaacaaatt      1440
     acaaagccag gtagagatag agagagagag gaaaccatta aaggtcttag ctatgtgcgg      1500
     aaatggtggt tttggtcact gctttgtaga ttatttgaca gtaacgacga ctagtacaag      1560
     tacttgcaga gaaagatcga tatttttcta gaattgatat ttgtttattg gttttctatt      1620
     ttgttacctt ttattgattt tttccaactg ttgggcttgg ttatcaagtc aaggtcaagc      1680
     catgcattaa tacggtccga ccgataaccg aaataaccga tccggtttat tatttctcag      1740
     aattttgaaa ccatgaacct ttacatgatc aaaggataca ggtacttatt gttacaatgc      1800
     atttcaaagg aaaacaaaac acaaacaaca cataaacatc actaattcag aattttaaaa      1860
     ccatgcacct taacatcaga agggtcactt attaattatt acaatgcatt ttcaaaccaa      1920
     acctcggaat aatctttgag tttctccttc atgatcatgt cgattttgct acccatttcc      1980
     ggagttagat gattcttcca gtcaccaact atccctttgc ggaaatggtt cttgtactct      2040
     atgccattga ttgactttcc ggtcttgtta acctccaaac tgctcaggtt aggcagagaa      2100
     cacatctcca agatcttatt tagagatccg ttcttttctt cttccttaga aaatggacaa      2160
     cccaaaaact ctgcgagttt cttgagctga ccatgaggat ctgtttttat ctcatcatac      2220
     ctcatgaaaa gcacttgctt tggcttttcc aagctagctt tccagtaact caggatatga      2280
     tcccaaaacg gaccaaacaa gcagactccg ctgcaaaagg actcaaacat agactcaaga      2340
     atggttctgt cctcttcttt attcagactc ctgcaaacga tatgccaacg tgacaccagc      2400
     gaatctttcg cgtccctgca gatgtaaacc accttgcaag gagagtcctt gacagctact      2460
     tgcagcgtgt ggaaaggcgt gtgagtagag aacaaccttg gagatgatga tgagagctag      2520
     gtcaagtccg gtgtttgggt atcccggtaa agattcatct caaggacagg tacgaggttg      2580
     tgaggattgt tggatagaag aggatggctc ataggatcat catgagaagg gttctttgtt      2640
     ctctcaaaaa gcgcgacagt gagtgccttg agccacaggg tgccggattt tgggtacgat      2700
     gcgacgataa tatcagtgtc ttgaggctta aaacctctct ggaaattgag aacaccttgg      2760
     agaaagttgt agtaatacca agagccttgg tacttgcaga ggtttcgacc gaggtaccct      2820
     ttctctgaag aaagtgaaga gattagagtc tttgtttctt ccgttaagtc ttcgtctctc      2880
     aagttcatcc acttctccat ttttcttttg tttttacttt tagcgactta ttttgaatgc      2940
     tgtgtttgct tcaaacccct agtatcacta tttatattaa aatgttaaaa tatatgatcc      3000
     aataaaacgt ttacacatca cttttaaaaa tatttatttt attttattac gaacatgtat      3060
     ctcaaaaatc gagaggcaat agtgacgtac aaaaacaaaa agagagataa cgtggtaggg      3120
     gattatgaaa ttatgaatca gaaattatag tgcatgtatt tttatactag aagtgtaata      3180
     catacaaaaa aaagttcttt tactcgtgaa aagtatgtct tcctataact agcatacgat      3240
     aactataaac ttgatatttt taaaagtaaa aattctgtct tctttgtcta tgagataata      3300
     ggacattaaa atccaaagat tccaaaatta tcttttctgc tgccaaggat tccattcact      3360
     ttccaactgg tatctaccat cgatttttat ctatttgtac ctcagcctgc ccgaatggtc      3420
     atttgatgat tcaataatat acaatgtcct gacctataca tatcacttag ggcatcactt      3480
     attcacttta atcgagagtg tttatattgg aaacgtacat gacatcgcaa tgtcagcatt      3540
     aattatttaa atattttaat atattcctat cgcaagataa tgtctaagtt agattatagg      3600
     ttcaacattc tgcaactttc atatattttt tttttaagct ggttaacagg ttagtttaag      3660
     tgtttgacgt aaccataaga gaattgattc attttagctt gtgtgtaata gttggcggga      3720
     agggtaattt tgttggcata ctcttctctg ctatttaacc agggcttgaa taacaaatat      3780
     ggatgtgaca ttgacacagt tcataagcaa atatacaaaa ttgagggagc aaatttacgt      3840
     aacattttgt aaaatttacg tgtatatata atttatcatt agcttacaat ttttatactc      3900
     gtagaattgc acaacaccat aattaatgca taaaatctcc atttataatt caaaccatca      3960
     tttagaaatt aagagatgac catatgtaac atgttagggt agatgtgatt atggtgctaa      4020
     actaaagaag aagactagat tgttggaacg aaattagaac tcacggaaca cgttggcatg      4080
     tccaggagaa tagttattta catgacatca ttgatagcat aaaaaacatg gataaagtta      4140
     ataacgttca aatggtcacc ataattacaa caatttcctt taaagcattc acaacaattt      4200
     ctgatctaga atggttatat ctactcgaat ttgaatggaa aaaaaataaa aataaaaata      4260
     agataaaaga gtcaacctta tgtccaattc aagataattg ttaaaaaaac aatccaaaat      4320
     tcgatttcag tcgttcataa tttatattca attgggattt gggatcaaga taaaagagtc      4380
     aaccttatgt ttttatgaga ggctagagaa aaaatagatt atgattaata aatttgatag      4440
     aagaaacaga gtaaaacgtt atccacaggc cacagcttgc acgtaagtaa tacctataca      4500
     ttatcgttta ttcgttatcc ttttttctct tactaaaccg tatctcttcg cttatctaca      4560
     tgtgtaatcc tctacctccc tctatatata tacaaaacac aacttttatc aaaaaaaaaa      4620
     aaaaaaacta gaacagaaca caaacatctc gacaagaact ctctgttctt tcttatcaaa      4680
     aaaaaaaaga actctctgtt ctgttcttat tgatcaagaa accttttctt gtccttttgg      4740
     ttaagacttc aaaagaaaga tcaaatcaga atctaaacat aattgacaaa agaagaagag      4800
     atgaacattc gcgatggtaa tcttatttcg actacaaaag aagaagaggg tgttattgga      4860
     gtttcaggat cctctgcaaa agtttcatct tcatcttcta tctctatgtg ttcatctgat      4920
     ttaacagagg atgcttcttc ttcttcttct tcttcttctt cttcttcaaa tgggcctttc      4980
     gacgatcttt cggacctcat ctctcagctc cctatcatgt aatgacacta aatctctggg      5040
     tgaaatatta tctcacagtc cttattctct ttgatcgttc catcttgtct ccatagacag      5100
     tgttaagaat ttgttttctt attgtctttg ttttttttct tacagtcagg tcaagaaagg      5160
     aggactttca aagtattata aaggcaaatc tcaatcattc acatctctag caaatgtcac      5220
     aagtctacag gatcttgtga agagaggatc aagaacgaag tcatgctgca aaagggatta      5280
     tttctatgga ccaaaggcaa caatctccat gaaagccacg agaacatcct caaaacattc      5340
     aaattcaaga ttaaccttta aaccatttca tgattcaccc aaatcagttc aatgacatga      5400
     caaaacaacc ttctgggttc agtttaacat tgtattcatt tgtatacaag tttgccccaa      5460
     gctaaatgag aacagagaga atttagggcc aaataacgcc ttttacacta attgtgcaga      5520
     aaaattgtca aaacgaatta aaaacatttt cctttgggtc gtttacttgt gatgtgatca      5580
     aatcttgtaa accggagtga ttccaagaag gtggaagcat ttccgcatga ctatggccgt      5640
     tgcttcacaa agtaggagac ggcttgtctc ctctggtgaa ccattgacct gtaaaagatc      5700
     atgttttaag tgagatcaac attatagtgg ttgattatgc agctatgcag tctaatatca      5760
     caatatcaaa tgagaaatgt agagtcttgt gaattgcaca cctgacaatt ggagtagaat      5820
     ctggtaaagt gttcagataa attgtagagg tactcgcaca gaacactcgg taataagttg      5880
     gtacaagctt cctccaccgt ctgcaaattg ttcacacatg agtttcaagt tcatcttgtt      5940
     gccgagaaaa agaagccaaa tatgaaagaa gtatctaaag agagcatgtg ttacctcagc      6000
     aaatcgaagc aagtgaagcc ccagtgctcg ttcatctgca tgatccaatg ctaattttcc      6060
     tgtctgcaat gaataagatg ttgaaacata agaattactc tttattgtac tgcgtatggt      6120
     aggaactaat aacagacttc gtaggtgttc gacgatccat atcttatgaa aatgtgaaag      6180
     atagcacaac caagaaacta aaaaggacaa aaaggcccag ggtgtataca aaatgaatct      6240
     tgagactcca aaaaattaaa tgctcactat agacactggc attaacttaa aagtttaaac      6300
     acttctgaaa attgtttaag ctttcaattt caaactaaat agtttataac gtcgcatttc      6360
     cttgatagag acaatgggaa agtttcaggg gcagccaaga ggaacaaaga ataaaattca      6420
     gcgattcatg ttcatgcagc taaagtacct ttttcagctc atctatgtct ttgccagact      6480
     ttctgatgat tgaacagatc cgagcatggg cgtaaagaag gtaaacggct gtatttccct      6540
     gctcatgaca tatgatcaat aaggttgtgt aggtgactgc aaaatgcaaa tttgtaaact      6600
     aggtggcaaa tttcagtacc ttgtcattaa gcatttgatc aaagctgaaa gtataatttg      6660
     ttaatctgtt gttcttcagg tcagcatacc ttgaaagaat attaaacaaa accgcacatt      6720
     agcttgtagc catgaatata aaccaactgt caaaacatct ggcaaatcat tcatcataat      6780
     tgagcagcct taattataaa acgtcaccga aaaccggaag atactgaata gaattcacta      6840
     ttatcagcag tagaatagag atgatactta cttgaccgca ccatatccaa ctgcctcagc      6900
     tgtttggtcc agttcttccg gtgtccattc tttgtcctta cctaaacaga gaaaaaacat      6960
     gtaaggatta atagaccaaa taataactca acaagtgatg gttcaacatt tcaaaacgta      7020
     gagagtttta agacaaagtt agataccgcg ctcaataagg gcaagtttac tgcgagtctt      7080
     ggcctcatct agcaaatcaa ctaggcggac tacatctgtt gcccgagttc taaatcgctt      7140
     gccatcttcc ccaaggacga gaccaaaacc aacatggtta actctagggt aagttttatc      7200
     attgtctgga agccaacctg cttttctggc agcctaattc acagtaacat gataaccaca      7260
     gttacgactg acagtttcag tcaatagaaa atatttcaca agacgtcaaa aacaataaaa      7320
     tattcatcaa acctactttg aagaacatat taaagtgctg ctgctggcca acatcggtca      7380
     catatatgat ccactcagct ttctcttcat tgagccggta cctgggccag gcaaaattta      7440
     gcaccagcag acaatccatt gaacaatatg caagttcaga tcaaacttca gtaagtacag      7500
     acacggaaag tcataacatg tgagatctat tttcaaaaga tcactactaa aatccggatt      7560
     tcatgaaata actaacgtaa agataaccca ccaaagagca gtcagatctg ttgaggcata      7620
     gttaaaacca ccatcactct ttacaaccat gagtgggatg tcgaagcctt caaggaaaat      7680
     cacacgagca ccttcacttt cttcaaccaa ccccttgcta ttcaattcct caattacttt      7740
     agcaatatga gggttgtaaa agctttctcc ctgtcatgaa ttaaatcaat gcatttttca      7800
     ttacccatcc atgtatctct ttttccatta tatctcaaat aatgttgtac aggtccagct      7860
     attactttac cttttcttca agctcaactc gaaggcgttg gtaaaccttg gcaaactcag      7920
     ttcggctgat gtcacagatc ttagcccaag ccttacggta aacaggatca ccaccctgcg      7980
     ccatagaaag gaatatatta agacttgtga gtaatttaga tcttgcaacc aaaggcagct      8040
     gcaaattgag acactgcaaa acagaataac acactagtga ttatttacct gtagacggac      8100
     cacagcctgt tgtgcttttt ccttaaaggc ctcgtccaga tcaaatttat gttttgatgc      8160
     cttgtaaaac acctatcaaa cgacatctct aaggttagaa actatattgc tttggttctt      8220
     cacatgcaag catattatgc caatattgct acataataaa actgtaaagc ttgagagggc      8280
     atattataga aggcagctga cctgaagatc tccaattgct gtctcggtca cactatctgt      8340
     atcaggaaat ttctcaaaga ggtactcaat tagcatgcca aactgcagaa taaaagcagc      8400
     ttttatttcg ctgataaata ttggaacaca acaattacaa aaaaagaacc aaggtcaaaa      8460
     aaccatttga agagcagaaa agtagctacc tgtgttcccc agtcaccaac atggtttctg      8520
     cgtagaactt caacatgtga gtactcgagc atgcgagcta gagtgtcacc aatgatagtt      8580
     gatcttagat gaccaacatg catttctttt gcaatgttgg gagaggaaaa atcaactaca      8640
     gctctcttaa ccgaaagagt aggtgcccat gtgtcaactc catcgatgag catattttca      8700
     atactctgca aatagattaa aaaacaatta tgctaaacac acattttatt tacatgagca      8760
     ctagaaaagg actacacaat tacaacagga gcaccttagc catccactta gctgatagta      8820
     caacattaat aaagccaggt ccagctacag agcatgattc taccatctca gaagtaggga      8880
     gactcttaac aagggcctat gtgaaaaaag gatcagaata aaagttaaag aacataccaa      8940
     aagccacgaa attataaaga ccaaacaaac gaacctgtcc aacagctgga ggacccttga      9000
     actgagtacc ctttccttta attatggacc atagtcccat tgcgttgtta ctgcagacaa      9060
     caatatgatg taagaatata atttgacaaa gagaaaacaa cttaattaga actataattt      9120
     cactgaacca agtgagaggg ggagcaccat tggtaatctc caaattttcc aagagcggag      9180
     gcagccacca agggctcaac actaggttca tcaggaaccg ttaattttag agaaacatca      9240
     aagagcttcg cgagttgacg tttcagattt cccgtaaatt cttcattctg tcaaaaagaa      9300
     attagtcatg aaacagggaa ataagaatgt tataaacttt ctcctggatt ttaaaaaaaa      9360
     actgctgact tacagctgcc attgctacca cggacttagc tctggatgag aaagcaaatc      9420
     tccaagccgt tgctctcaat ttttctgtct aggttacaaa accccaaagc gaaatcagta      9480
     catccaaatt gcaattaaaa aaaacaaaca atgaaacttt gattgtaagc agtagattgc      9540
     tcttctttat tggagttaca tcaaatcatt gatacagtgc acacaaaccg tgttgaaata      9600
     taaacaaaaa tgaacactta ccctcttcag catttctata gaaactaaaa cgaaaaccac      9660
     gcaaacacaa tatcatttcg caaagttcca acagttagaa aaaaaatgag cttagccaag      9720
     aataagaatc taatctcaac aaatggggag aatgtagtcg agcagagata aaccacaagt      9780
     agagagaaaa atggagataa gaagagctcg gagagaggat tttaccagtt ggagaagaag      9840
     aagagaaata agcaaagtga tgatgggaac gagaaaaacg attcaaggag aagagacaag      9900
     acggcggtgg tgttgctgtg accggaaaga gggttaggct tattattgcc atttccaatt      9960
     ttctgtctct ctctttaatt tgtttccctt tttttatttt tttattttat cttctttttt     10020
     tttttaattg ttcaggtaat tttcgtgttg ggccgaaaaa atattaggcc cattatgcca     10080
     ttaggttact gtgtttatta atgcgatccg attcgttgaa catttaggct aaagttgaac     10140
     aaatcaacgg cgaatttgag gaagattaaa taaataagaa gggatggaga atcataccac     10200
     ggtggtaaaa gtcagatgat cggcggagaa acggagcttt gtcgttaaag tttctcttct     10260
     gttttcgtct tttgggaaaa tgaacatatg atgatgaatt ttaagggttc ttttgattat     10320
     ttatttcctt gttaattcgt tgaatatgtc tcttaaccac cggggtaata gacattttga     10380
     tcgacccgaa cctgcaaact taattaaacc gggctggact attcggatag accaactaaa     10440
     gcgcggttta cgtcaaattg gctattcaga atctggtttt cgtctgaaca gatgaagcaa     10500
     atatactctc agaatcaagc ttatattatt gatactgaag aggcaactgc atatagatgc     10560
     aagataaaca ccaagtgaca ttaaggtaag aaagtagcac ctgaaggatt agacctttac     10620
     tttcatcatc agcaagagga gatgaggaaa aactcatcac tgactcaagg atggagtttc     10680
     taatgtaaat ttgagcatcg tcttctaata tcagttgatc tacctttttc cctctggatg     10740
     actcaaaatc gtctggataa gcgagaatat ataggaaagt ccttgctttc catgttgaag     10800
     ctttcatgcc tcaagaagct cagcaaagtt gggtgagctc tggacataaa tctgaaaagt     10860
     acgaccaaca caacactgtc cgttgatacg gttgaaggac acggcggtag tgtttgaagg     10920
     cattaatagg tgttgggccg aaaaattaat aaatcataaa aattaacctt tatgattctg     10980
     aaatctttgt acacaacgga agtcttcttc atatagaact tgtgacaatc gacacaagtc     11040
     tcagaagctc cgagattatg agaactggaa taataatagc aatagcttca taaacactaa     11100
     acccctaatc tttctatcaa acgtttctca acatatccga tgtatcctcc ataggagaag     11160
     tattaaacga ctacgcaata gtttcatttg ttgtccctgt aatgagcgaa agcaagaaga     11220
     ggactaacgt gagcaaagcc catatcaaca acaatgaaca gagtaatgaa tcaaagagtt     11280
     gacttaataa tacctcttaa caaaagagtc atcctcagtg tttatcacaa tcttttcacc     11340
     tgcctcgaga taagatggta cctgaggtat tcaaggtgga accaagagtt attttggtat     11400
     ttagatgaac cagactagtt cctgttacat gaaatttgaa gatcaaacaa tactaatagc     11460
     tccaacttcc tagaacgaca tcttacctga atagtggaac cattatccag gagagctctc     11520
     ttgtacctgc attttaagaa ataaggcgtt ttctcataac ttataaacga ttgattcatg     11580
     gtgttaagga aacaaaatgg tacatgtgtt aaacaaaatg gtacatgtgt taatcaataa     11640
     tatgttaaac gcttataccg tatagagaaa aagcgttcct gacttttgag aaaaaggaca     11700
     taccgaggag ctgatgttag gcctttcatt ggaagttgtg tttctacaac tgtgcatgtg     11760
     atatgcttag ggatagatgc agataaagct cttccatcat acagctgcaa ctgaactttc     11820
     atttcctctg tcaatcacga ggaaagaagg gacaaagaga tacatgacaa atatgttagt     11880
     atttctagca catgcactca acttgctcaa caatgactgt ctgcactcaa gagtatccat     11940
     attgttgttg agacaaccat caacaaagga aataagtatg acatgcacca cgaaagatat     12000
     catcttgcta ccaacctttt aaatatacag cagcttttcc aaatatgtcc aatggcactt     12060
     caacttgctc aaacgtatta ggcctgttgg atttacataa tcaaggaaat caactttagc     12120
     aacacaagat cctacagtgt ttaagttgat ataaaacagg taatgagatt acacaaaaaa     12180
     atatggactc actcaatcag atatgcagta tctccctctg catacaaaca cgtgaaagat     12240
     ttctcttcaa caaaaacttc tgcagtaaat tgatgcaatc aatcaatatc acaaaaaaag     12300
     taatcgacct atcctacgat gctaatacca aaatggttag agaacccaaa aaaaacaact     12360
     tttagtaggt aactgatgaa ttaacactaa gctatggaat aagcaacata ctctcaaccg     12420
     actcctcaga tccaaaacgc aagttaagct tattcccagt gtcaacatca cgaagctcaa     12480
     cctgttttcc acagagaaga gagtttaggc taagagacgg aatatcaaca acagaaaaat     12540
     atgaaataat cgatcaaaac attagactgt tgattaaaga gtttcaggta tgcatacctg     12600
     tatggaagct cctcctctac cttgttgctt atgctctgct tctacaacct acaacatcaa     12660
     acaaaaagat aattagcgtt tctcaatacc tggaactaaa aaaaactgaa ggtataaaac     12720
     caaacgtcca aatgactaac ccgaaaagta cgccctgaat gtgcaatggt ccatcaaaat     12780
     tttgttaaat catactcatc caaaaacgtt cagatgtaag gagaaaactt caaaaagcta     12840
     acctgttcgc tcaattacat ttcctgccct tagctgaaat taacaaacca agaaatcaga     12900
     gtgcgaacat ggacacagat catctttact cgtgtgagct caaaaaggtt caataatagt     12960
     ttattcgcta gtcaaatgag taagaaactt taatctctgc agttaaactt tacctgaatc     13020
     gcgttaacct taacaccgcg gcgttgcaga gcagaccacg gagaatgaag cggaggcgtt     13080
     tctcggcagc atccaccggc ggcgtacggg gttgatgaca acaacgacct gctcaaagaa     13140
     taaagagacc tcctagtcgt tactgcccca ggagaagtgg cattagagaa ggagaagaga     13200
     gatcgagaga ttgagattct cttgaaatgg tgcagccctc tcatctccgt ttaacccttg     13260
     caatcggaaa actgattctc gctcgctact ccattgatcg agaaaagaat tgaaaaaaac     13320
     aacaaaacaa cacggcgtcg tttgctatgc tgacgtcgca aggacgccgt taagacagaa     13380
     ctaatggtta cggcgccgtt ttcgatgctg atgatccgga gctaatgggt tcgtttcacg     13440
     agcggaaaga cggacaaggc cttctaatta taatgggcct taaaaagtag cccattaaac     13500
     ttgttatact ttcttcaaat acttgagatg aaagcaactg tcatgaacaa aaaaaaaatt     13560
     caatacattc ttgaagttca aattctattt atacagatta tattaatact acttttctta     13620
     gaagatgtca tgattgtaaa gcttacaagt tgtttgcttg ttgtccccct cccactataa     13680
     tgctttgaga ttaagatttc aactagttta atttttattt aatcaccaaa ctattgaaat     13740
     aatatgatta ctactaacag caactaatga tttctcaaag gggaaaaatg ttatttaata     13800
     cttgaacttt caaaaaatgg ccaaattaat cgtgcattct tgaaatggtc gttttatacc     13860
     tcaacaaaaa gttgacttct aatttaacct ataatttatc gttgatttct aatttaacct     13920
     ataatttatt gttgacccgg ccaaatcgac tcaccgttaa cactccttaa cagcgctcct     13980
     aacagccgtt acaaaacatg gcctaacagc tgttatcgtt ggtttaagga cgaaaacagt     14040
     tgttagttat gctgttagga gagctgttaa gaagttttaa cggtgagtcg atttggctgg     14100
     gtcaatcata acttataggt taaattagaa gtcaactttt tgttgaggta taaaacggcc     14160
     atttcaaaaa ttcacggtaa atttaaatat tttttgaaag ttcaggtatt aaataacatt     14220
     tttccctttc tcaaactaca ttcttttttt taaatgattt tgtcaaagct acgctgaata     14280
     aaaaaaaagt gaccgagata attttattga ttcaaatgtg gaaaatctta gaacagtaca     14340
     taagaatgaa aaccgaaata aaaaaacaag aatatgattt ttataacatt aaaaagacaa     14400
     aaacaaattt gtctagaaga gaaacccaaa ggccaaagtg gctaccgagg cgaagaaagc     14460
     ggggatggcc aaggaagcat cggaggtagg actcggagct ggagcctcca ccgcggcagc     14520
     ctgttgcacc gcagagaaag ccatcgctgc caccaaaacc gccacaaaga gtctcatctt     14580
     cattgcctcc attgggttat ctctaggtgg ttcttgagaa agcacgaaga gactatatgt     14640
     ttagtgtttt gtggtgtgtt ttgatgtgtt gtgacttgtg gtttatatat acacatagat     14700
     gcatgtaagg ccaactgtgt aattatcact ttacagtttg attaacacat caacacaatt     14760
     aatcattttc gaattgtttt aattctttgt atttggtgaa caaaaacttt attagcacat     14820
     caatctctgt aaagccaact gagatcttag ttgaaaaaga aagaaaaaat aaacagttgg     14880
     aaagagtact gcagctgatt ttagttatgt catcgccttt tgttttttat tgtagaaatg     14940
     aatataatat gttttagttc tttgtatttt ttaactaata cagttcatag taggaacgtt     15000
     ttctctctga taataagagt gaaagaaata ggaaactgtt tttttttttc tgtgacggtc     15060
     gtgaaatgaa tagaaaatag ataagagaag caatgagctg tttggaattt gattgatggt     15120
     tccatgtgct ctctggtata taattggctc aatccatttc tcccccaatt attgctcaat     15180
     attcgatgaa acaagaactt ataaacgtaa gtctccattt tataagagaa cataaagatg     15240
     aattaggtat tttctaacaa aagtatttat cattttttgt acttctacat tttgaaattt     15300
     atctgttatt ctttaagttt tagaactacg aagtgctatc atttaatcat aaatagtttc     15360
     gtcacgctat caaacttagt tccactatat ttctctgatt agcaggtaca agctcatgtt     15420
     attgcctatt gcccatacac agtactggcc atacaagact ttcattcaaa ccaaaagaaa     15480
     taaagaaatg aagaaccgtg aaactctccc atttacacta gccttttttc ttggaagaca     15540
     agaaaccaaa aactcaccac accaaaccta gagacccaag aaagttagct taaaaacaaa     15600
     caccgtcctt gatcttagag ttgattatat ctggatacaa atccataacg attgagactt     15660
     gctattaaat gaaaaatgaa gatatctgtc tctcgcagag cgctcaagga gtacagacat     15720
     tttaacacca ataccgaggt agctactttc aataccactt aaaccggatg attaactcaa     15780
     aacctcttga tctttactca tttttttccc cagaagttat gaacgaacac aaaacaaatc     15840
     taagacagca acatttgtct taaacatctc gaggtaaaac cgaaatgatg gtctaatcat     15900
     caatgactat acttcaaaaa aaaaaaaaaa aatctagaca tattcacatg gatacaaact     15960
     gtaatcaaga aacgagattc aattttcggc aaatcgcaag aactacatta agaacagaga     16020
     gaaaaaagag gaattttaca aaaggaaaaa aaaatgaaaa actttacaat gaagataaca     16080
     ttatcgagtt tgatgatttt gatcactcaa aatgcagacg aaagtgatgc tgatatgtag     16140
     cgatggaaga agaagaggaa ccataaacat aaacgtgatc acgatcgtct tccgcagttt     16200
     caggatagag caaacctgga gaaggaagac atagacaagt caagagacat aaagccaatc     16260
     gacctaattg ctggagcgga aagaagcaga ctagctcaag catctctcgg ctgcttatac     16320
     gatcggacgg tgggatcaat cgtaaacgct gccaaatctc agccgacaaa tgggctacag     16380
     acataaccgt ctggccgttg aacaccatgt tcatacacac acagaaaaaa aaactgtaac     16440
     tgaatgatga ttccgtgatt ttcgttcaat ttgtctgtgt atgtgtatac aatgtacaga     16500
     ggtcgggggc ttttctagat cttgccacgt tgacttccat gtttagtcat catcattgat     16560
     cgaatagttc ctaatccatt tttaaaagta ttttattgat taaacaacta ggaaataatc     16620
     aaatatgaag ccttttttga gttagtattt gaacaaaatt aaaggattct acactatatt     16680
     tcgtttcgat tcttcaacaa taagaattct tgcaaattat tagaagtaaa cctaccggag     16740
     atctgttaat attagttcct ttttaatgta tttttgggtt atgttcttta gtgaattgat     16800
     gaaatattat gttaacttct agttgaagtg agaatgatga gactcgcaag ctaatgtgtc     16860
     tatagaattc accttaaccc attgagctac attctctata ggtttcacct aaattgcaag     16920
     ttaccactct ttgttctaag taaaactcta caaaggaaca ttcctaagct acttattgat     16980
     cctaacaatt tgttatagcg ttgatgataa aagttaagct atacataaca aatggagaca     17040
     tctttcaaaa caggcctact gttagaggaa ttagacgatc tagctattaa caagtttaga     17100
     cctaaaagtg agaatgatgt ggctcgcgag cctatgtctt gttgagtttg tcacaatgat     17160
     tgattatata ttattaatat aagcttgagt ttgaattagt tataagagtg tgagtgattt     17220
     gtagcagcaa tatgtgtcaa actagatctt tctccggccg tataacatca atggaacgac     17280
     ttcttggttg gatctttctt gctcttacat tactacttca ctcatcaatt caagcaacaa     17340
     catcaatttc tcatgtaaat cactaatcat taatcctgtg catgaatata ccttttcatt     17400
     tgcagaattt ctttatgttt ggatttggca tgtcttccag gtttacgttg tatatttagg     17460
     tgctaaccgg ctaaaaaacg ctgctttggc ttcaagccac caccttcatc ttctttctaa     17520
     agtcttcaca aggttacctt cttcaaaact catctcttct acagtccttt ttttcttgtc     17580
     agtcaatgat ctcgtccatg aatttttgga gatgtcgttg tagcaaagac gatgcggaac     17640
     aatccatgtt gtacagttac aacaatggct tcttaggctt ctcagcaaaa ctcaactcaa     17700
     cacaagctgc ttctttagca agtaatactt ccatctttat attttggcgg caatatagtt     17760
     ctcatcatta aagaaatcgg tttggttttg gttatccttg aataacgaac tttttatcgg     17820
     aaccaataaa catgtaatct aatcgaacca gttccatttc gttcagttac actaagaccg     17880
     gtttggttaa ccgggaaact attgtagaat tgaaccaggt cataacggtt ttcaagagca     17940
     aaagcttgaa gttgcacaca acaaggagct gggatttctt aggtctcgcc gttgacaatg     18000
     cccgtcgtac tcctccgccg cagctcgcct atggatccga cattgtcgtc ggaatcttcg     18060
     atactggtct cttgtttatt cccgactctt ctttgtttca gggctctcat tttgagcatt     18120
     tcattgaaac ttttgttact ttcaatttta ggaatctggc cggaatcgga gagtttcagg     18180
     gaaacgccgg aggcgaaacc tataccttcg tcatggaacg gaaaatgcgt cggaggggaa     18240
     gactttgatc catctgtaca ttgcaatcgt aaattgatcg gtgctcgatt ttacctcaga     18300
     ggattcgaag agacgtacgg aacaattgac tttacgcgag atcctgaata ccgatcgccg     18360
     cgagattacc tcggtcacgg cacacacaca gcttccaccg ccgtcggatc cgttgttcgc     18420
     aatgtctccg gcttcttcgg tcttggacgc ggcactgctc gcggcggagc tccattggct     18480
     aggctagctg tgttcaagac gtgttggggg aaggatctgg aaggtgtttg cacggaggct     18540
     gatatcttag cagcttttga cgacgccatc cacgacggcg tccacgtgat ttcggcctct     18600
     tttggctatt cgccgccgtt atctccgttt ttcgagtcga gcgcagacat cggggctttt     18660
     cacgcagcgg agagaggaat cagcgtggtg ttctctaccg gaaacgatgg ccctgatcct     18720
     ggtgttgttc agaatgtcgc tccttgggcg gtttctgtcg cagcttcgac agttgatcgg     18780
     agttttccca ccagaattgt tatcgacggt agtttcactc tcacggtact ccccttaaat     18840
     cctgtagtca gagtcaaatt actgaaagat tgattcttgt tagcctcaga attagaaaga     18900
     acaaaacttt gaataattca atctttcagg gtcagagctt gatttctcag gagatcactg     18960
     gtacattagc tcttgcaaca acgtatttca atggagggta attgctcaaa aatcttctaa     19020
     aatgttgtat tcgaattcaa ttcgtgtcac tttctataca tttttagaag acacttgcaa     19080
     atccgtagct tattagcagc attggtgtat aactgtaagg actgatatgt gcagggtttg     19140
     caaatgggaa aactggatga agaaattggc caatgagaca ataattctgt gcttttctac     19200
     tttgggtccg gttcagttca ttgaagaagc acaagctgct gctattagag cgaacgcatt     19260
     agcgctaata tttgcagcct caccaaccag acagctcgct gaagaagtag acatgatccc     19320
     aacagttcgt gttgatattc ttcatgggac taggattagg aactatcttg ctcgttcgcc     19380
     tacgtaagcc acattattcg gttatacatt ttgtttccat gcgctgagct aaaaaacggt     19440
     tagagaaaag aaactcataa gaattctttt ggtaaaaatg aagagtgcca atggtgaaaa     19500
     ttggaccgag caaaacggtt atcggagaga ctacagcacc ctccgttgca tatttctctt     19560
     caagaggacc tagctcacta tcacctgata ttctcaaggt acaatcatct actttttggt     19620
     tcattcagtc tgttgcatca agttgtatgt ttgagaatgc aattgtgttg aagtatttga     19680
     gatatagtga gtttaaacca gaaccaaatt tgtcacttta ctgaatattg tttttttggt     19740
     gtatcgatgg tttatgcagc cagatattac agctcctggc attgggatat tagcagcatg     19800
     gcctcctaga actccaccta ctctgttacc aggagaccac cgatctattg agtggaattt     19860
     ccagtcggga acttcaatgt catgtcccca tgtggctgga gttatggcgc ttctccagtc     19920
     agctcaccct gactggtcac cttctgctat cagaagcgct atcatgacca caggttctat     19980
     ttctaatagg ccctcctcat atgttgttct tacaaaccca agtctgatat tgttatatct     20040
     tatttccgtt tccagcgtat acaagagaca caagctatga cttgatcctc tctggtggtt     20100
     cgatgaagtc cactgacccg tttgatattg gtgccgggca tataaaccct ttgaaagcca     20160
     tggacccagg tctggtttac aataccagaa ccgacgacta tgtgctcttc atgtgcaaca     20220
     ttggctacac ggaccaagaa attaagtcca tggttctcca cccagagcct tcgacaacat     20280
     gtcttccgtc tcactcgtac cgaacaaatg cagatttcaa ctatccgtct attaccatac     20340
     cgagcttgag attaaccagg acaataaaac gtactgtaag caacgtcggt ccaaacaaaa     20400
     acacagttta tttcgtggac atcattagac ccgtgggagt ggaagttttg atctggccgc     20460
     ggattctggt gttctcgaag tgccaacaag aacactcata ttatgttaca ttcaagccca     20520
     ctgagatttt ctctggtcgg tatgtatttg gggaaatcat gtggacaaat gggttacatc     20580
     gagttagaag tccggtggtt gtgttcttga gcaacgctgg ttttcttgca agcagttaaa     20640
     ttagacggaa agtcactacc gtagggctca agttgaaaga gctatggttt gtttcttttg     20700
     tttgagattt cccgggcaca ctttataaat aggaactata aaaaattgcc acaactggtg     20760
     aaacttgttt agtgtattta agcattttta ccaagcacaa tttacgatta atgatgatct     20820
     ttagtcttct ttaccatcaa taatccaaag cctaatgtta attacagtga caacggtttg     20880
     gtttccgttt aagtttggtg ttggttcccc ctgaagaatt tgggtcggtt tatttctggt     20940
     tccgaatcaa attggttctc gtcaaatcaa catgttttat gataatctag gattctaggg     21000
     tttcttggct cctctgttaa atcctctcat gaaaattgaa gattggagtt tgtacgactt     21060
     ggccaaaatc ttatgattaa aacagttcaa cgagtcagct tctgaatcat ctggtctcat     21120
     ccaggaagca ctaaggaacg agctacgacg gtaactcccg aacaaatcaa cttgtataag     21180
     tttttgtgat aactataaat gtaagctttt gttttgtttt atgaacttct ttaggttctc     21240
     taatccaatc gtagacttgt cctttggcca ctagctgaaa gtttgggaat cgagagcatt     21300
     ggttcacatg gaccgtatta gtcaactttc ggatgatttg ctcttgcaaa tattgtcgtt     21360
     tattccggga aaagatgttg tggccacaag tcttttgtcc aaaaggtggc agtctctttg     21420
     gatgttagtt tcggaacttg agtacgatga tagctaccac actggtgatt ataagagctt     21480
     ctctcagttt gtttacaggt ctttgctatc aaacaatgca cctgttataa aacatttgca     21540
     tctgaatctt ggccctgact gtcccgctat agatattgga ctatggattg gttttgctct     21600
     tactcgccgt ctgcgccagc tgaaaattaa tattcgtact tcttccaacg atgcgtcttt     21660
     cagtttgccg agtagcctat atacctctga tacattagag accttgagac tcatcaattt     21720
     cgttctattg gatgttcctt cttcagtttg tctcccgtct ctcaaagttc tacaccttaa     21780
     gactgttgat tacgaagacg acgcatctct tccaagtctt ttatttggtt gtccaaatct     21840
     tgaagagttg tttgtggagc gacatgatca agacttagaa atggatgtca ctttcgtggt     21900
     gccttcctta cgacggttat ccatgatcga caaaaattat ggacaatgtg atcgatatgt     21960
     gatagatgtc ccttctttga agtaccttaa cattacagat gacgcagttt acgacgtccg     22020
     tcaaattgag aacatgcctg agttggtcga ggcacatgtt gacattactc aaggagttac     22080
     tcacaagttt ctgagggctc ttacttctgt ccgacaactt tctctatgtt tatcactctc     22140
     agaggtaata ttattgaatc tgttttacat attattattc ctctcaatat ttactttgtg     22200
     ttgttgttgt gtatattaaa aaaaacaggt tatgtgtcct tctggtataa tcttcagtca     22260
     gcttgttcat ctgaacttgt ctacagttgt taaaggttgg tgggatcttc ttacttctat     22320
     gctccaagat tcccccaaac tccaatctct caaactcatc gatgtatgtg atctctataa     22380
     tatgctttta tctggtttag tttcccaata taatttgact tataactctg tctgatatgt     22440
     tggtcttaga aacaacatga gtcgggtctt tgtgggatag aaaccccaat tggttggaag     22500
     ctgccgagtt ctgttcccga gtgtttgttg tttagtctag aggcatttga gtggattgga     22560
     tacaaaggga ggcgaggaga tagagaggtg gcaacatatg tcctaaagaa tgctgcttgt     22620
     ttgaggacag caaagttctc tccagagtct actgatgtgg gagagaagta tcatatgctc     22680
     aaggagttgg catcagtacc tacagcttca acttcgtcta agcttctatt cgactgagaa     22740
     tagtaatatt taggtttctt ggtatctctc gtttatgatt tgtgtttagt ttttgccaag     22800
     actggtttaa caaaaaaaaa cgcttgatga accatgtcaa acccagtttg cttctcttat     22860
     gtaactcaaa actcaaaaag tgtgacttgg cgtctaatag ttttggtaat gtatatctca     22920
     aacgaggcat gaccatctct gtttttagat tgtgtcaatg acacacagct tctgatctga     22980
     ttccctgaaa cattgcacag ctttaccatc ttctcatcta tgtttgaccc agcatattaa     23040
     cgttcgcaaa tgattggtga cttcaaaatt agcacaatct gtatgtaact taattacaaa     23100
     atggtaattt ggcattgcac caacacagta ttttgcccct atatctctga ttagggtttt     23160
     acttttcact gaaacaggcc tattccttat aaacggcgaa agaaagagag gttttcgacc     23220
     agggtggaca cgaaacgaat attcgggatt ttggtagtat ttgtggtcca atttgctacg     23280
     tccgaatagt taattttctg ttttgtattt gcttcgaaag taaccgaata tcctgctgcc     23340
     cagctatccg ttaaaatctg agctatttgt cggatattcg attttttata tttcattaat     23400
     atatatatat taaaaaatat taaaagaaat cataaattta atccaaaata agtaatattt     23460
     cattgatttt ttattttatt ttaaaaacta aaagtttaat ttgatgaaaa taaacttata     23520
     tataaaaagt gtaacattat taatatatat atgtaattat ctataaacat atatatattt     23580
     ataatggatc ggagcggata tccacctatt taaattttat tatttgttat ttgctctgct     23640
     tttaacgaat attacttttc aatatttaat ttacctcata cacttacgga tatccagatt     23700
     tttcgaatca aatcgaaccg aataacggat caaatcgaaa ctaacaaata ttttgccaag     23760
     cacgaatctt tagttcgcga atttaagctc ctggttactt tcttctaggg ttttctataa     23820
     ttatgattcc tctcgtctat tctagtcctt aattagtcgc cgacgacaaa aagaaaaaaa     23880
     aaaacctaga aagcttgaca aacaaggaac gacgcatatc tccaaacaat cagtgtaatt     23940
     tctgtgattc tctgtttcct tttgttgtgt ctttgattcg gatatttgtt tatcctcaag     24000
     tctttcatcg tttggttttg tagtgttgac atggacatca tcagtcaatg tccggatcac     24060
     ttgctcttgc gaatactgtc atttattccg acaaaagatg tcatcgtcac gagtcttttg     24120
     tccaaaagat ggggatctct ttggagatgg gtgccaaaac ttgaatatga ttttacaaga     24180
     caaaacatga gattcgtgaa gtttgtttac aggtctttgc tacagaataa cgctccagtt     24240
     ctcgagagct tgcatctcaa gaatattatc ctttatgctg aatgtcgtac cgtagatatt     24300
     ggaggatgga ttgatattgc agttagtcgg cgtgtgcgtg agctggaaat ttctattaat     24360
     tgttcggatg aaaaattcag attgcctagt agcctatata catgtggaac gcttgagagc     24420
     ttcatactca ccattaaaca ttgccatctt gtggatgttc ctttagcggt ctgtctccct     24480
     tccctcaaaa aactacacct taggtgtatt ggttgggcat acaacgcaac tcttcttagg     24540
     cttatatccg gttgcactaa tcttgaagag ttgcgtttag cacgacctga tgatgatggc     24600
     gactatatta tgatacatga ggcaggcagt actatagatt atatgtccat ctttgaaaga     24660
     aggtatatgt ttgagtttat gtttgatcaa atgtttggaa agggtagtag taatgggatc     24720
     aatgctcctt tgaaatactt ttctatttct aataattatc gtatccacaa cttccgtggg     24780
     attgagaaaa tgcctgactg ggtcgaggca cgtattgcgg ttactggtgg aagtcacaag     24840
     tatctgaaag agattactta tgccaaaggc ctttatgtat gcttatcagt ctcagaggta     24900
     ataacaaatc ttgtgattta tttacatata tatatattac tgttcctcag taataatatg     24960
     actgatgttg aaacaggtta tgaatcctta cgacatgatc ttccacatgc ttgttgacct     25020
     tacgatatgt acatgtactc aaggttggtg ggatcttctt actcatatgc tccaaggttc     25080
     ccccaaacta cggtttctca cactcaccaa tgtatgtatt ctttttattt acttttagtt     25140
     tggaaaatat gattttgaga aatgataact aagtctaagt tgttcttaat tggtattagg     25200
     accattgccg agaacttcct agtttagaga ccccggcctg ctggaaacgg ccgagttctg     25260
     ttcccgcgtg tttgttgtcc agtcttcaag ctttcacgtg gagtgggtat aaagggagac     25320
     aaggagataa agaagtggta aaatatgtcc tgaggaatgc tactggcttg aagaaaagga     25380
     ttttcatttc aaaatcaaat gattttggag agaagttttg tatgctccag gagttagcat     25440
     ccgtaccaac gccttcgcca tcatgtcagc ttctgttcga ccgaatattt tagtctggag     25500
     atcagagatc ttgttgattc ttagatattt gctttcttgc tctccaaaac caagtattaa     25560
     agaatgatta taatggctcg gtttacttgt ggtttggttc aatttgtgtg tttttaacct     25620
     ataacatttt agttcggctt actaattcaa acttgtttgg cctgagttat ctgagaatcg     25680
     ataatacaat cagatatctg atcagtagat aatgttttca gatggagatc atcagtcaac     25740
     tgccggatga tttgctcttc cgaacatctt gtctttctct actagaagta tagaagagac     25800
     cttttttttt tttttttgct aaaaatgtta attttcatta tatgaataag aggcttttac     25860
     aaaaacgaaa ggcctataca agagtagccg aggcaaaaaa taaaacaagg ctacaataga     25920
     gattttggga agatataagg ttagcgaatc caaagcacca tgaggttgcg ccatctcttt     25980
     ctgtggtaac gagaggagat gatgttacga atctcgcggt cgacaatctt gaagatgata     26040
     agaggtgcga tcctaagatt gttatggagg acattgttgc gctgacgcca aatgttgtag     26100
     atgatagcat gggctgagac ttttctgagg agggaaggcg ccgaagtaga ggaagaacgc     26160
     atccaagaga ggagctctgc ccaagagcaa aacagcctct gtcgcggaca taagcgagaa     26220
     aacgctaatc tccaaacctg agccgcaaat tcacaggaaa aaaggagatg gtctctggac     26280
     tcagtctcaa tagtgcataa gcaacaatcg aaagactgga tatggcccca agaggcaagc     26340
     ctttgacgag ttgggagtct atccaactga ctaatccaca tgttgaaggc atgcttagga     26400
     acagcaccct tgaaccaaac agcctttgcc cagtccaatt ccggtgctct tggtctaata     26460
     gcatcccaag tccttgccga agagaacctt gacaaacaac accgccaaca acccaatcaa     26520
     aggagtcttc aattgtagca ggagaggggg tcatgatggt agagatgtgt tcatggatgg     26580
     cttgagctgg agcagaccga gataggggga gcttccagcc attaacacca agagcctcaa     26640
     ccaccctagc gttaagaggg atgcgaagtg atctggagcc ataatcaccc ataaccttta     26700
     tcagcgggcc aagggaagtc caactgtcat gccagaagtg agctatgcgg ccattaccca     26760
     agttgcattt aacaaactgc tccgccaaag gtctaaggaa caagagcata cgccaagacc     26820
     atggatctga tggggaagga gccacatccc aaaaagacct gcttctaaga tggtgatgag     26880
     agtgccaaga aacccaaagc gaaccttgat gattaaagag aagccaaata agacgcaaac     26940
     aaagcgtttt gttccactcg gagaatcttc taaggccaag cccaccttca ttttttggga     27000
     ggcaaagagc agaccaagag acctttgctc ctctactacc atcaatgttt cccgctcaaa     27060
     ggaacctagc acaaaggctt tcaatcttct taatgcaacc ctttggcagc aagaaagtgg     27120
     acatccaaaa gttgacgata ccatagataa cggaagcaat aagttgaact ctacctgcgt     27180
     aagataaaca atttgttgcc catgatctga attttttgga gatttttcca ggagaggctc     27240
     atattcagcg atgcgcaact tcctacacat aagcggaagc ccaagatacc ggatagggag     27300
     gcagccttgc ggaaaaccat aggccgccaa agagtttctc tcagcctgct ctagaccagc     27360
     acaaaaaaaa tgacttttgt cgttgttcac ctttagtcca gaccaagaag caaagtcctc     27420
     aagagtctca caaataccgt gcaaggaaga actaccacca tcaaagaata tcataacatc     27480
     gtcggcgaac atcaaatgag agatggagag atcagaagct ttcgggtggt agcgaatgta     27540
     acctgagtca aaccgagaat tgagcaactt tgagaagact tccattgcaa gaacgaaaag     27600
     gtagggagaa agagggtcac cctgtcgcag ccctttagca ctcttgaaaa aaccaccaca     27660
     acaaccattt acagagacag tgaaagttgg tgtggaaatg cattggtgaa tccaattaat     27720
     gaacttagta gggaccccaa gagcaagcaa agctgcaatg ataaattccc aacgcaccga     27780
     atcaaaagct tttcgaagat ctacctttaa catacctctc agagagatgt tcctccaatt     27840
     gtatccgtga accatctcag tggcaagcaa gacattctca gcgaggagcc ttccagggag     27900
     aaaagctgat tgagaaggag agataacaca agagagcagc ttctgaagac gatctgtgag     27960
     aagcctagca atgactttgt acagggtatt catgcaagag ataggtctaa aatctgaagt     28020
     acaagaggca ttaggaaact tgggaatgag aacaatggta gttgcattcc attgcttaag     28080
     caagttaccc gaaataaaaa attctctcac agcagcggtg acctaagcac caatgcaact     28140
     ccaagctgcc ttaaagaact caaccggaaa gccatccggg ccacaagctt tgttactagg     28200
     gagaccaaag aaagcagcct tgatatcttc atcagagaac atggcttcca aatcagccac     28260
     ctgagaatag ggacatctgt aagtaagcag caaattcatg tcatcttgct ccaacgaata     28320
     agggtcgtta tcatcactca ggagattttc aaaataaaga gcacagtggt cagcgatgcc     28380
     ttgttgcgag tcaatttggg tccctgaatc atccaccaaa gtagtgatag tgttaacaga     28440
     tttcctggaa tcagccattc tgtgaaaata acgtgtgttg ccatcaccct ccgcaaacca     28500
     agtcactcgg gaacgttgac gaaaaaagct ctcttcagca gtggcaagga tctgccattt     28560
     acgttgagcc tctaattcat gagcagcatt ttccagggag ggattatcaa gagtaagatt     28620
     ttgaaaactc aaaagagtct catgagcctc ctcagttctt ttttcaaggt ttgaataatt     28680
     cagcctacta aagtctttga ttggtttctt cagagcctta agcttctttg acacccggaa     28740
     catagacgat cccaccacat tagtcgagta ccaaacatcc cacaccaaat ttaaaaactc     28800
     cgggtttttc aacaaaaagt taaagaactt gaagggccgc ttcgctttga tcgggtctaa     28860
     ttccagcaca acaccacaag atgcatgatc tgaaaaatct ggcggaccaa acaaaccaaa     28920
     agaggatggg aataagttgg accagctctc attgactaag atgcgatcaa tcttctttgc     28980
     aaccggtcta gttttacttt tattccacca agtgaaagag ctgcctttgt aaacaagatc     29040
     agacagttca gcatccaaca aacattctct aaagtctctt atcctcctat ccacattgag     29100
     tgaaacatgc ctagagtgct catgaggatg aagaacctgg ttaaaatctc ctagcaagat     29160
     ccaaggtcta ttaaaagtga ccggagaagc taccaaagca gtgatctctc tccataactc     29220
     ttttctctta tcatcttcgt tggccgcata taccacagag ataacaatcc aagtgcgaga     29280
     attagggaaa agaacctcgc aagtgatcat ctgcaacgat ttggcaacaa taacaacctc     29340
     aacagatggg tcccataaca cccatatctt ccctaaatct gagaaaccat agttctcatc     29400
     aaaaaaccaa ccaggcagca gagcattaat aaacttcttg tcctttggtt gcttcacgtg     29460
     cttctctatg acgcctccaa aaataggcct attgacctta aaccattttt taaagccgtt     29520
     acgatgacta ggaatgttaa aaccacagga cattccaaca aaaaatttgt gtacacatat     29580
     taatgacctt aaaccattct ttatagaaga gaccttgatt ttacttactc ttgctccaag     29640
     attcaccaaa actacacttt ctcaatacta gtcattttat actcattaaa gaactttccc     29700
     gactaagatt gtctgtttgg tcaatctatt tagatgattg gattccacga catatgtacc     29760
     agcgagtgat gctctttttt tggtacctgg tggttctatt tacttccggt tatgttaaga     29820
     attttgtgaa ctaatcatgt tttttttggg ttagctcgcc tctgccgtgc tcgaagtctg     29880
     actggtttgg ctagagttac tgaaacagag tttatttgct attgtttaaa atgtttaggc     29940
     tcatctaaga ttaatttagg ttgaactaat atatcctgga gagtttatgg atgaactaat     30000
     ttaataatga gtatcaaata tgagttggta gataaacagt agaaaactaa ggcctcagag     30060
     atcttggtgg taaaccaatc atcaactgaa agaacaaagt tcttcatcaa gagtagcaaa     30120
     tatttttatt acatcactgg cctcattcaa aaacaattca aaagtggaac ttattttggg     30180
     aaatctatat cgatgatggt aaaatcagaa gtagctggtt tgtgatcaca tctttcccga     30240
     gggaattcaa agggaatccg aacgattttt ttcgtcatct tttaccatca aaaaaattta     30300
     tcaaagaaaa tgtcataaaa gacctcaaaa aacgttttct aaatcggcga aaaacaaaaa     30360
     aggtgttatg atgatgatga tgagtcagaa gtagctgatt atataatcac atgtttcccg     30420
     gaggaattca aagggaatcc gaatgatttt ttcgtcatcc tcaccatcaa tatcaatact     30480
     gctccacaaa agttccaata ttcaaccaaa aaataaacac aaaacattca aatctacgac     30540
     taagaagaaa actacagata aggctttgct aatgagatca ctaaaatcga atttcgcaga     30600
     aaagataaga gatctaagaa agaaaacgct aatctagaaa agagagaacg aataagccgt     30660
     gaagttgttt gataaatcaa gaagaagaga gaaaaaagtt atatatatac gccgcgacga     30720
     agaggtttga ctacgagaag aagccctaat aatctctatg cttgacgaaa cgctgccgta     30780
     tcctcattag ctctcttggg ctttttgttt ttttggatgg gcccattact ttatttattc     30840
     cacttttctc ttattagtac cgtgaggggg caaaacaacc ctgttcatga attggaacca     30900
     taagcggaaa aaaacatcta tacgaaaaac ctgattatac agctttgttt gttctcaaat     30960
     atgggacaca agtgaaggag gaggatacaa agacagaaac atgaaaacta ctacataaat     31020
     taatactatc ttatgggcaa tatattaata cagacatgag tatgctgtgt tcttagcaat     31080
     aatcatgttg acctgcaatg gatagattca gtctcaggta tcaaaagctt cggaccagaa     31140
     gcggtctgtc aagacagaga gcgactttgt cgaatatata agatcatcgg atcaacactt     31200
     tgcctactag cgacttccga cgaccaacat cttgaggttg cctgcctcct aacgaagatg     31260
     cgggttttgt tctaatttaa accgacactt cttgcttcaa ttctaaagct tgaggtgttg     31320
     atgttgttgc tctatccttg acaaatgtcc ttaggcatcc gttgattatg cgtggtgctg     31380
     atccatcgca gaaccgtttt gcaagatcaa cagcctttta tcacatcata gttgttagtt     31440
     agttcactac acaatcaagg tcatcatatt gcaaagctga ccgaagatgg atctacattt     31500
     aaagaagaca gatacctcgt taatgacaat cgggtgtcgg gtttcaagga ctgccacttc     31560
     agacattgcc aagtgaagaa tcgaaaactc caatattctt ccagctggtg cactctgtga     31620
     atagatccag caacatctat aaggcattta ttgatagtaa gagatgaaaa aatatgtaga     31680
     caatcacaca gccaaaataa gaagctgctt ctagaaactc aagctaattc taaagcaact     31740
     gttgagctca ggctgcaaac agctaatatt aatgagagac aatggaagaa actgatcagc     31800
     attgaggctt tgagtttggt ggttcattat ttttcaacta tccagtattt gaccggagtt     31860
     gaagttcaaa tgttcaattt ataccttcca atctggcggg gaaattttct cgatgataac     31920
     gacatgacta tcccatttat caactaccgc agccaagagt ttctttgcaa acctttggaa     31980
     aaacacatag tgggaataag gtggtattca caatttattt ccgaatagca gcaattacta     32040
     cacattatat attttataga ttaccgtaaa acaagtttgc tgtacaccag ctttggggga     32100
     gctgaaagca cttcggcttc tgcaggaaaa ggagaataaa caacagttca catgttacaa     32160
     gatgggaaat tcccatgagc ccatccaaac aagagtctct ttgccatata tgagtaaagc     32220
     agaagagaaa acttatttta agaataagag acctaccgat tttcgattct ttttcatcat     32280
     ggcgcacaag ctcatcttct tcttcttttg tttctgtttt aactgggggt cctccaaagc     32340
     tcatgtggtt gtattccaac aaagaactct tgtcaaactc gtatccaggc tctgtacaaa     32400
     ccgaacaata tgcattgaag ttatatcaca agcagttaaa tcacgaagaa tcaagcaaat     32460
     gatccacaga agttacaatg agattcctac attcatgact gtgttgcaga tggaaacaga     32520
     acatgataac aaaaaatacg tttggttgat acttacctct tcttgcgttt attctcttct     32580
     caaagagacg aattgggtca gagccttcta agcatgcggc ataaagtatt acactgtcaa     32640
     tatcatccag caacatgatc agagagggta gatacatcat tcatattgat aggagataat     32700
     catatcaaag ttcaattttt tggctgaaat caagtaaaaa gagagaacta atggcttaat     32760
     acttctaccc tcgagaaaaa ttgactgttg agtgaggcaa ggttctgggt ttagggtttt     32820
     aggttaaacc ttaaaaccca gacaatggaa cactaagttg agacttattc ttgtcacacc     32880
     aagccgcata gatgactgaa tcgtttccaa ttctagtaaa ggcgaatttt catttgcagc     32940
     taaaatttcc aatttttttc aaatcaacga aacgattacg atttcagaaa cgcttaaagt     33000
     gagaaaacga agcttacaga gcgagctcgc gtgcggctcg aggactgctt aatcggccgc     33060
     tcttatcaat cttcggcatc gggacatctt tcacctcctc cgcggaaata gtcggcgtac     33120
     ggagagcgct tctagtcgga gagagaaata gccgtagtga agacgatgac gaacgtttat     33180
     ttcccgttcg cagggaaacc aagttcgttg gccggagcga atcaaccaat gtaaatccta     33240
     tagaacggtg agaatctggt gaaacattac tggagaagta acagaggttc gaagaagaac     33300
     gtaagcaaag cggcgagaag gttccctcca tttttgtttc gagctctttt tctgcttcgc     33360
     cgtgttagtg tgagaagcag ataacgatat ccgtaaaatt gaaaaaaaaa acaaaatatc     33420
     tccggaaaaa aggattaaaa aaaaaaaaaa aaaaaaaaag aagctgaaac acacgacaac     33480
     gttttagtct gatcaaaatg aaagccaaaa aatgtggcct atacagggat cgaacctgtg     33540
     accttcgcgt tattagcacg acgctctaac caactgagct aataggccac tacgtttcta     33600
     agtggtgcac ttagatattt ctctcggaat ttcgtagatt gtgattctgt gacagttttc     33660
     tttcaagaca agtatcaagt gcaacaaaaa aacatcggat atgggactcg tactcgtgtt     33720
     catgaagata ataaactctc atataactac ttgactaaaa cgatatattc gtatgcatta     33780
     gaaaaaacaa ttgtatataa ctaataaaca tcacatgatt aagttttaac tgcaaataac     33840
     gattttgtta ccactgttaa cgctcgttaa ttcggatgtc tgattttgtc aaaaaaaata     33900
     aaaaataaaa atatttaaaa gacataaaaa ctaatttagg tattttggac aaatttagta     33960
     gcacggatat taaataggca aattaaaatt aaatggagat ttttcagctt ttttcccata     34020
     aaccgaccta aataactcga atataaattg tcatgacctt ttaacatcgt ttaggtttct     34080
     aatctttaaa tccttcattg actttgcgct cgcctgtaaa ctttaagatg atctcatgct     34140
     tttggtttta gtaatcatct caaattaagc attacaccaa gacaaaatcc acaagctacg     34200
     ggaacaatat tatagaactc aaaagttgat atatgcgatt gaacaaatat caagtattcc     34260
     tccacttgga agattattgt ttaatgttta ctaaagaacc gttttaaaat taacacttgt     34320
     cgcgtattag tcacgaaact gctgtaattc tacacattgt ggttgttgaa agtggttttg     34380
     atttggtctt tcgttagatg aagtcaatgt ctactgttaa ctaattattt caaacctttg     34440
     ttgagctgtt tctttaccac ataatcagat tccatgatct ttaatatcac tagcagaaat     34500
     cgacatgcaa aagtgtttgt ttgacgattt ctctacttta ccgctggttc actgtaactg     34560
     cttgatcaaa catattagta ttatcctttg ttaatgatat atattaccat ttcgttaatc     34620
     ataacttctt caataaaaat gtgaaaggtg cacaggccga cctaacggta atatacgtat     34680
     gagcttaatt aatgtagtct agaaactcga aaaatataaa ttgttaatta gaggatcttt     34740
     atctctaaaa atcgatcatt gacttttcgt tcgaacgacg tgactaaatt gtaatgccgt     34800
     actgcttcaa ttatttccag ttatgtataa taaagaaaga cccgcaagct acgttcggta     34860
     aaaaaataga cctatgtcac actatgtgga aaaccctaag tttaacgttc atgacgctat     34920
     caaaattcag agtttatcgt ttaaatgatt tgaccaaaac taaaaacagt acacgatcat     34980
     taataaggca atcctgtttt cgaataaaat atgaaataag ataggcccac cttgcctcac     35040
     atctgatgct aaatttctag tcgttatata attgagatat tattatctct ctataaattg     35100
     atggcttgac ttagtattcg gacagctttg aggttttgtc acgtgatccg acaagctacg     35160
     agttctatat atacatacag agagcagtaa gtttcttata ctcaaaataa tcatctctca     35220
     taccactcat caatattcaa acaatccctt tctctatgga ttccgagtcg gagctcatga     35280
     tatctcttat ttctcaactg ttatctatct taggcggtgg ggaagacaca catacaccac     35340
     agctgaagtc aaagttgata gcacttactt gtcaactaat ctctctggtc aactctctgg     35400
     atttggattc gcagccggag ccggagtcga agctcaaatc actaattaag cagataattt     35460
     atgtcagcaa ctctgtttca gaaccaggac cagagtcgca gtcggtatca gtggtgacta     35520
     aaatgatctc tatcatcggc tctatagatt ttgatctcaa ggagtcagag ccggagctca     35580
     tgtcactcac ttctcaaata ttcgctctca tcatggcaat ggacgaggaa tcggagctct     35640
     tttcactcct ttctgaggtg gccagtctcg tccagacgga ggaacagaag ctcatcaata     35700
     accaacaagt gccgcctctc accaccgaag aagaagaaaa agatgatctt atctacggct     35760
     atacagatga tatgaattgg gagtcggagc tcatgttcta tatcatttct aaaatgatat     35820
     ctacattaag aggtgaggat atgtgtcaag aggtggcaag agatttcata gcatacgcta     35880
     atcaacttat tcctctcatc gaatcactgg atatggattc gaattcagag ccgaagcagg     35940
     agccgaagat cacatcactc gttaggcaaa taatctctct cagcaaggtt gtttctggac     36000
     cagagtcaca gttggtatca ctcgtgactc gaattatctc tatcaccagc tctacagact     36060
     tggatcccac ggagtcacaa tggaggctca cgtcagtcac ttataaaata tctcgtatcc     36120
     tcaaggaaat aaaggattcg gaggattcgg agatggcatc actcattaat caaatacacg     36180
     acctcgttga cgcagaggag ggacgaaagc cagagtcaag gctcatatca agcatcactc     36240
     aactaatgtc tcacatcaac tcttggagtt tttattcagg aatggacccc aagatcatat     36300
     ctctcattat tcgaatcatc tatctggtca gatcaatgga tttggattcg cagacaaagc     36360
     ccaagtcgga gctaatgtca ctcgttactc aaactatcgc tgtctacaac tctatggatt     36420
     tggattctca gccgcggccg ctaaggaagg tcgtatcagt tttttctcag tatggttttg     36480
     acgtaaattc tacagtttcg gattcagaat cggattcaag tgagaattac gtgtcacaca     36540
     ttaaagattc attaaaactt gagccggagc ccgagcttat ttccttcatc catcgaatag     36600
     gctccctcgt catctctatg aatccaaact gggagaagct tatttccttt tgccctcaat     36660
     ttgaagtaat actgagcgat gatggaaagt ttcaagtgga agaaggacgt ctaagcaaaa     36720
     atcagttatc cgacgatatc ccaatgaagt ggaattgtct ccaggtaaac tggaatttat     36780
     tgaagttaca tgcaggagaa aaagacttta ctcattttcg ctgtcgaggt tgcaatggtg     36840
     acaaccataa agaaaatgaa aaggctccac ttgaagtcaa acaccctctt catcctaaac     36900
     atcctcttca gcttgttttg tcgcaatctt ctggtggtag aacgagggaa tgctattgtt     36960
     gtgatgaaga tttgctgcat atattctatt gttgcttggc ttgcaatttt tctatgaatg     37020
     tagcttgtac taagaagcca gctgtcttat atagaaacca tccgaggtgg cacgagcata     37080
     cacttgctct gtttccaagg caggcttcct taacttgcaa cctttgtgcc ttggccgatt     37140
     caagctcccc gatctatatg tgtccccctt gcgactttgt cgtccatctt agatgtaccg     37200
     gcttaccacg tgtcataaag atatcccgcc atctccaccg tatatcattt acattttctt     37260
     ttgaccgagg agatttgtct tgtagtgttt gtcgcagaaa aatagacgaa gattacgggg     37320
     gctatacttg catcaaggac ggctgttcgt atgcggctca ttcgaaatgt gcaacacaaa     37380
     aaaatgtgtg ggatggcatc gaacttgagg gagagcctga agaagttgaa gaagaagtag     37440
     ttgacccgtt tgtgacaata agcgacggag tcatacaaca tttcggtcac ccacaacatc     37500
     atttgagact tgacgagaac acgagcagag attacgacga ggataagttg tgtcaagctt     37560
     gcgtcatgcc aatctatttt ggtaacttct actcctgtac gcaatgcaat tatatactcc     37620
     acgaagcatg tgccaatttc tctcgcaaaa tgcatcatcc ggtacatcca catgtgctca     37680
     ctttagtgaa ctctgacggt gctatcaacg ttagaaaaga atgtgcagct tgtccttgga     37740
     tgtgcacaac tggtttcttc tatgaatgca gtaaagaaga ttttcagcta catgtgcagt     37800
     gcgccaacct gtctgagcca ctagtccatg aaagtcatat gcatccttta ttcctaacat     37860
     ccaaaccagg agagaggaga ttatgttccg cttgcaaaga gtcgtatttt agtgtgacaa     37920
     gagaaacatt caactgcata gagtgtgatt ttgctttgtg ctttagatgt gctactttac     37980
     ctcaaaaggt gaggtataag cacgacaaac atatgctcac tctttcgtat ggggaagaaa     38040
     caagtaccat gacatattgg tgtgaagttt gcgagagaaa tttaaatcca aaggagcgat     38100
     tttataagtg tgatgagtac tgctctatca cgctacacat tgaatgtatg ttgggggtgg     38160
     ctttatacat caggcctggt tcatcgtgga tctgcttcaa caataaaaag atgtatgttc     38220
     tacccaacaa tcatcatatg tctcgacctc gttgcttcat gtgtaagaag cgttgtccac     38280
     agaaaatagt tttcaagtac gacgaagtaa tattttgtac ccaaaagtgt agggggaaat     38340
     atagatacta gaagagtgag caagtagctt gatggtcatt gctaacatgt tttagtgagt     38400
     attcctttgc attgagataa ttgtgcaaag ataaagtgaa agtatatgac ctgtaaaatc     38460
     tgtctgttat aaacactgca aagattggta tcgaatagaa acggaatttt aactttttaa     38520
     gagtcaaatc tctttttgca tcacatttct ccttgttctg taaaatgtat acacatggaa     38580
     tgtgtgttta atcttctaaa acttttagaa aatcatcgct ctctctctct ctatgacgtt     38640
     ttagtttgat caaaatgaaa gccaaaaaag tggcctatac agggatcgaa cctgtgacct     38700
     tcgcgttatt agcacgacgc tctaaccaac tgagctaata ggccactgcg gttataaacg     38760
     gtacattaaa tatttctcgc ggaattgcct agattgtgat tctgtgacag ttttctttca     38820
     agacaagtaa gtatcaagtg ctacaaattg gcaagtataa tttattcaag agttgaaaat     38880
     atcaagtgtt cagaaaattt tcagattttt tttttgggtt tattcgattt atattttgtt     38940
     ttctttttat tctacaaaat cttagaaaat actagattga tattttcctt cttccacaaa     39000
     taataaaaac gaaaataatt gttgttcata gtataaaagt atttattttc ctaataaaat     39060
     cttaatgatt tactctacat ttatttttgt atgttaagtg tatttatttt cattattggt     39120
     tatctcaact cacagaatta attaattact taacacaatt cttcatttta gtccccaagt     39180
     aatttgttgc agcaacctgc gtttaggttt tgcatctgca ccaccaccac caaccaaagg     39240
     ccttgcattt ccacatcaaa cgttacgaag agatttgtct ctgccttgtc ctcttaacca     39300
     gatctctctg acgcagtatc tgatcacact ccgtgatcgt cttttgttat cattttgtgt     39360
     atcgagatct gttagtctac tgcgatggct atggaacaga ggcctaagac gaagatcgtg     39420
     tgcacactcg ggccggcgtc cagatctgtc ccaatggtcg agaagcttct tatggcgggg     39480
     atgagcgtgg ctcgcttcaa cttttctcat ggatcttacg aatatcacca ggagactctc     39540
     gacaatcttc gtcaggccat gcttaacact ggcatgctat gtgctgtcat gctcgacacc     39600
     aaggtcaatc ttataaaact tgtcatatgt gcatttttat gtctgtataa caatgccatc     39660
     gaggcgtttt cttttgattt gggctctgtt cacgcatgat tctgatcgtt tctctatcat     39720
     tttacaagtg attcatgtct tatctgattg gttattcccc tgctgatctg aggacactcg     39780
     ttttggctat gtttaagtcc tgtgaacttt ggtataattt gtggcatggt acgttgtttc     39840
     cagttcgagc atgaattaga caatatctgt ggtacatgtt tgctggttac agaaaccaaa     39900
     tggagaactg atgttgtttg ttagaccaga atattaatac aaagttgatg catcatggat     39960
     gattagactc ttacctttgt cgtcttgaaa atgaagatta caatctcatt aaagtatttg     40020
     cttcaaattc tcactctctg gtctgttact tggctttctg gtaatgaaag ttaataaaaa     40080
     tgtggaatgt ataatgtggc ttaaagttag ctgagacact cttcttagtg gtcttattgc     40140
     taataatctc atgaacgtga tagatttata tgttttgggg gacccttttg gtttctgaat     40200
     aattatggga atgatttttg tatttgtctg gcagggacca gagattcgaa ccgggttctt     40260
     aaaggatggg aaacctatcc agctcaaaca aggccaagaa atcaccattt caactgacta     40320
     tgacttgaag ggtgatgaga aaactatttg catgagctac aagaagttgg cgcaagatgt     40380
     gaatccaggc atggtcatac tctgtgccga tggtaccatc tcgttaaagg tcctttcttg     40440
     tgacaaagaa aagggcactg tccgttgtcg ttgtgagaac acttcaatgc ttggtgaaag     40500
     aaagaacgtt aatctccctg gtgttgtggt tgatctccca actctaactg aaaaagacaa     40560
     gcaagacatt cttgaatggg gagttcccaa tcaaatcgac atgattgctc tgtcttttgt     40620
     cagaaaaggt tcggacttgg tacaagttag gaagctactt ggaaaacatg ctaaaaccat     40680
     acttctcatg tcaaaggtac atatatacat acatcactca aactaatata aatcacatat     40740
     ccatactcag attcttatga tatgttactt ttgatattgt caggttgaaa accaagaagg     40800
     tgtagcgaat tttgatgata tcttgataaa ctcggatgcg tttatgatcg caagaggtga     40860
     ccttggaatg gagattccaa ttgagaagat attcttagct cagaaagtga tgatctacaa     40920
     gtgcaatttc atggggaagc cagtggttac agcgactcag atgcttgagt ctatgatcaa     40980
     atccccacga ccaacaagag cagaagctac tgatgttgca aatgctgtcc tcgatggcac     41040
     agactgtgtc atgcttagtg gtgaaaccgc agctggagca tacccagagc ttgctgttcg     41100
     tacaatggcc aagatatgtg tggaagcaga gagcacactt gactatggag acatcttcaa     41160
     gaggataatg cttcacgctg cggtccctat gagcccgatg gagtcacttg cttcatctgc     41220
     ggtcagaacc gctacttcct caagagccac tcttatgatg gtcttgacca gaggaggcag     41280
     cacggcgagg ctggtggcta agtatagacc agggataccc attttgtccg tggtggttcc     41340
     tgaaatcacg tctgactctt ttgattgggc gtgtagcaac gaggcaccgg caagacacag     41400
     tctcatctac cgtggtttag tcccggtgct gtatgctgga tcggctagag cctcgatcga     41460
     cgagtcaaca gaagaaactc tcgagttcgc gtcagagtat ggtaaaaaga agcaactctg     41520
     caagaccgga gactctgttg tggctctctt ccgtacaggt aacgctattg ttatcaagat     41580
     cttgaccgtc aagtgatccc atttgcgttt gagttttgcc ggtgtttctt agcgttttgg     41640
     atgtttattc atcatggtga ctaatcttga gatgaaactc aaagtctctt ttgtttcttt     41700
     ttttgtgtgt ggctcccaca cactacataa tgttcttgga tcatactctg gttacaagta     41760
     cattagtttg gtacgagtgc aattgcataa acaaagacta ttttttgaat atattttaca     41820
     aaaatgtgtg atcacatttg gctcgtgatc acacaacttt gggattcgta tttggagata     41880
     atgcgattca tgcagtcaac aaccatactc acagtcacat gcctctccct ctcaacataa     41940
     atacctgtgt tcatcttttt atattttact aaattaaaag ggatactttt aacggaaacc     42000
     caaatgatca tcagatatta taatacaaat aaagaaaaga ttccattcct cgaaagtgtt     42060
     tatttgttat gcagtattca acaatctgag tgaacaagat tttatgtact ataagctgag     42120
     gaatagcagt ttacgagttc tcaccgagat gagatgaccc cgaggccgat gcggatgacg     42180
     aagaggatga agagaataat ccgctgaacg gccatggaaa agagaacctt ctctcgctca     42240
     cattactgtt ccttgcatca tcttccacat tctcattact tacgttgatc tctagagttc     42300
     ttgttctcgg tcttacagga ttaaccttgg tctcatcatc aggagggagt tcatatcggc     42360
     acacgggaca tgaactgtga agctcgagcc acggtactat acaccggatg tgaaacttgt     42420
     gcttacacgg catctcttta gcttcacttc ctttgtcaaa atcatccaaa caaatcgagc     42480
     actgcaatga ttcacttatc ttaaccgttg ggagattatc cacaacttct ttacgtgctg     42540
     gaagactccc gtgcctgatt gaatcattat cagctagatg ttcaagcaaa tggtctaaac     42600
     tggatccaac aaagtaatct ccaattgcag aaagagaagt attgttccgg ttttgattca     42660
     aactcgttga accctgaaca acagctgatt gatttaacag gtctcgatcc gagctctcat     42720
     actcagaagc aatccctgca cgaataccct gaagcaactg caatatagta gctgagcttc     42780
     tccgtctcct cctaaggata gactcaaact ctctgtctaa atcaatctct ctaccttgtt     42840
     gcctgtggcg atgacgacga tgatgatgtc gatcaatatc gacgctgtca tttccatcaa     42900
     catcatcaga tacattgacc tcatcattat ccacaccaaa ctctgtcctc ctaaaccttc     42960
     tacgtctacg aggattactc atcattccaa gcaagattgg accccataga gacaatgcac     43020
     ggtctgtacc aaaatcaatc tcagggtctt gaacctccct tagactgcta ctgctgccgc     43080
     cattaatctc acggctcatt tcctcgacaa acccgctttg gcaaaagggg catttgatct     43140
     cggcaccaat aactggattc accatttgtg aacacatgtg acaccaatac ctagctgaca     43200
     ttgcctcttc ctccttcttt ccttccccac ccaaacctct cgtttctgaa acaaccagaa     43260
     gaacaacaaa aaaaaaaaca tgaagaagca aacctataaa gtttcgacct ttgtttcatc     43320
     agatctaaat aaagagaatg gtattcccaa aagtttcact aaaaagagga taatatcatc     43380
     ttcaccaaca tcattagctc aagtttcaga caacaaaacg caagctttct atgcaaatgc     43440
     gaataaacag atcaaccaaa atttgcctct ataaagagat aacaatagaa atcagggcta     43500
     atccatgaaa agaaaactct caattctcat ggagtaatta aaacaaaaca aatacaaaaa     43560
     caaaccttgt aaatgttctt acttttggag atccagaggg aagaaatgtc ttcctccttc     43620
     ttttagatct ccacgaagat aaatgagagc ttttttattt gtcttcttct gcagaaatgg     43680
     tgggagacga agaaaagagg aatgaaggag gaaaggaaga cgaagatgaa gacgaagaaa     43740
     agggaatgta atgtatagtt cgcagaccca atcttaaagc ccattaaccg caaactgata     43800
     tataaaggag ccgggtctat cttaaccatt taaaaccaac ttctaatttg gaatcaaatt     43860
     gaaccgaatc gaaccggttg aagttgaaag aaggagaaaa ggcgttgtct ccgtgcgaga     43920
     aaggcaaatc ggagacgatg agcgaaaccg aagcaaccgg cgttaccgat gattcggctc     43980
     cagcgattga gactgaaact gtttctgatg cgatggagca tacagcgatc ggagtggttg     44040
     aatcggtgga aggagccata gaaggagcag agaaatgggt gggtgatttg caacggacgg     44100
     tgaaggaatc gaaggatacc gcaatgcgtt ctgctcgttc cctccgtgaa aattctacct     44160
     ctcagttccg ctctatacag gttagttaat ctctcttttg ttcaccaaac aatttttgcg     44220
     aatcgagatt gtttaccaaa aaacattttc aggatttcaa accatggata tggtggaatt     44280
     tagtatctcg taagctataa tttctagaaa tgagctcgat tcagaacaga tatttctcca     44340
     attagcagtt ttatgtattg aatggtgcta gtttttgttc atatgggtaa aatcttgttg     44400
     aatcatacca ttataactta ttggcaatga tcttagtctc ttcctgggtt ctgattctgc     44460
     ttcaaatggt tgtttagaag actgtaatgt atcgctgagg cattcttgat tattctctaa     44520
     acaatgtttt tatatgatat cagatattca tgtagcttaa tgatgtgtga tatggagtag     44580
     accctatctg gctgaaatca cagttccatt agatgtatgt atatgtcttc gtcttctctc     44640
     atacaatctt acatttgatt ctgaaattgc aggatttcat tccacatgct ttgactcagt     44700
     ataagaccta tgagaatgct ttcttcagta aagttacagg tatcttgcag ccaattttcg     44760
     tgaaaaagtt atactggtag actactgtaa tgcttaggaa cgagtatttt agatcaaact     44820
     gagatataac agatagctgc cacaaaactt ttatatatac ttgtagtgca tcttatagtg     44880
     ttctgaaact agaatcttca tgtcattccg attaatcaat cctcgtatcc tctgctgctt     44940
     ttgttatcct cgcagacgaa ttgatatacg caaaagagca tccggctgct gctattggga     45000
     ttggtgtcgc tgctagtctc gttctgatgc gaggtataac ctctactctc ttatcacttt     45060
     tacaacttac aagattcctt cccgtaggag catccaaatg gtattacatc tgttttactt     45120
     atatgtgtct tgtatgaatt tggttttcta ttgttcgact tacaggccca agaagattct     45180
     tgtttcgtaa tacactaggc cgatttcaga gcgaagaggt atatactata ccagcttcaa     45240
     atttatttct taacgttgtt atgcttagtt gccctggtct gtgtcccttc ccttattttt     45300
     acatccactt caaaatcatc gtcgcttcag gcacaattct tgaaagctga gaagcatgtt     45360
     caggagttaa acatgtctgt agacttgatg aaaaaggaga gcaggaaatt gcttgagagg     45420
     acggctttag cagagaagga tatgaaacgt ggtctctctg agctcatgta tgccccaaca     45480
     tggacgctcc cacttctttt attaagttat tgacatcatt tatgttaata tgggtactac     45540
     tgttatatct ataggaactc tggaaacgat atacatcgtc ttgctaagtc cgtccacaaa     45600
     gctgaatgtg aagctgctgg taatcttgaa caagatttat ttttactcac ttctcccttc     45660
     tcccttcaaa tggtatcttt gataatgcca ctacgtcaga tttcaactta cacaaagagt     45720
     tctattcgct gcagatttga tggacggact tcggcaaatt cctggaaggg atgctatcaa     45780
     gcttagagct gaagtgagtc tgactttttt cttctcgccc attgtttgag cttcattgct     45840
     atgaacgtct cattaaattc ttttgtcgta aatcattagg tggcttccat gacttcgctt     45900
     ttgagacaga agaggattgc attgaacaaa aggatcatgg gtatgtcgga cctaggagtt     45960
     tccgtctgat atatccaaca caaatccaca atttcttggg ttttcgcaac caaagtttgt     46020
     taggtatttt ccaattgaat cgcagtgtac tctcgtccat cgaacatcca actctgtctg     46080
     aaaccaaaat ctgagcttga gacagaactt gtatactgtg tttttgcctg cttcctaaga     46140
     tttctcgctc agagagaatt aattgagtca caaaaatgtg tgtgcttggt ttggaaatcc     46200
     ttaattatgt agtctagaag atttatgaga aacatagaaa gttactgaat caatcagtaa     46260
     tgaaaattta tagataacat gaaggttttt aatgggctag ttttgcatcg taagtctatg     46320
     ggagacgggc tgtgggccat ccacccatgc gactaggcga cccaactgct ccgattggtc     46380
     tagtaatgtt aaaccctcca gacgagcaag aagcttcagt cgtcggaccg gtccgaccat     46440
     taacgtccag agtccgttct ctcctcctta gacgctccct cttgagcaga gtccctaact     46500
     tatcttttcc cgattttccc ttgtccggaa caggtatcat ctccagaccc atcagctttg     46560
     caacaacccc cgtcttgcac cataccacac tctctccggc cactgtccgt ggcaggcgtt     46620
     ttgtctccaa gctcatctgg ctcgatctct ttgatgtccg ttgatccccg cagtgggatc     46680
     tccgcccacc ctgtatcgtc atgtcagcac tggtgccaag atggcgccgg aaggatgacc     46740
     ggtacatagc gtccttaccg tccagtgaga aacgtgggta ctgattcaac gcgttccttg     46800
     ctgaccttaa cggcagacaa acagaagttg atattagtat tgatcatagt atcatacaca     46860
     ataaaattat ttctgtttct tccggtaatt ccttaaatat cactacagat ttcaccagta     46920
     tacgaaatct agaaaattca aaaaaaaaaa aaaaaaaaaa cactttaaaa tgtagtcata     46980
     taacttgttt cgtacattca aatctacacc ggtgaatatc atattatcaa tcatgaaacc     47040
     aacgttattt ctcctcttga atacgttata ttcattattc aatattcatc ttaattacta     47100
     acgtggcatg tcaaaaaaag ttaactatat gtaagagctc atgagtccct aatgagaata     47160
     tttacttaag tacatataaa aataagcatg acgcacctca aaatatcgga actgttaacg     47220
     catgacatcc gggcgggctg atgatataac ttatcatcat caacatcatt atggtcatca     47280
     caattatcgt aagtaccgta gtaagattca cggagtctcg ctcttcgaac aatatcttct     47340
     tcaacctcta gctgaagtat catctcctct agagttctcg gagatcctcc accgaaagga     47400
     gtgttttcag gtgtaacaga aggccccaca tcgttctttt gatgttggtt tagtgtcaaa     47460
     gttgagccat caccaccaca agagctagca aagccgctac gtggacctcg tcctcgcatt     47520
     ctcgaggcga gggagtattt tttgaggaag aagaaagaaa gatctttcat tgtcttgttt     47580
     aggataatac tgtcttaaag atttgaaatt gatagtgaat gagaagaagc catatggtgt     47640
     tgtgtgttgt gagaggaatg aatacagggg tggtggggag ttagtttcct caagtttaat     47700
     tgggttgtaa aaagttttta agtttatatt gacgttttaa tgagtgtcac gtgggaaagt     47760
     gtcattggtg gtcacgaggt tctctttttc tcatatttca cgtactgtgt gatattgtaa     47820
     atggtttgtt tcacttttcc gatcaattct ttgaataatt ttcttttctc aaatattatt     47880
     gttttatcca gttcaataaa taggagaaag gtgtaagatt tcaaaagtta tgggaaacac     47940
     aataatttta tctgaaatat aagaaaccta gtgtgataaa tgataattac ttattttacc     48000
     atgcatcaaa ccatttcgtc gtcgaaatac tttttataat actacgcatg ttatgtacat     48060
     atatcgataa cattaaaccc taacgctgaa acagcgatca tatgatagaa acagttgttg     48120
     agaatttctt tgtcggcagc tgctctaact gcgtaccgtt tgaagagctt atgagttagg     48180
     tcaggaccaa gataggcctg aacgatcggc tttaaaccgg cttgagcata gttagcccta     48240
     tctcgaccgt acgaatccgg atctttcatc aactcttcct gcttaccatt catgtggtca     48300
     gctattatca gattctccgt tttctctatc ttaaaaccac cacaacgatc aatcgccgcc     48360
     gcaatctctt cggtggttct aaagtacacc ggaatgttga aaccatctct cttctcctct     48420
     tctattaaac ccttttacaa gctcaccaat ataaaaaggg acgttttgtc aattccataa     48480
     ataaatgtaa catcatgacg taattacaag agattatacc tcatctacta gatcttgcca     48540
     agcttgatcc atcaaagttg tgaaagggtg tttgagactc gaatcaggat caccgatttg     48600
     gttcacggag ccagaaggtc gaccacccat cagcataaac aacactcctc ctaccacaat     48660
     ctcctctttg cgacatttca agaactcgac taagtccttg tctgcttgct ccgcgtatgc     48720
     ctccacgact tctttttctg ctccttcaat ccacacccct cccttgttcc atgacttcga     48780
     tcctttctcc atcacttttt caggtaccta tcatatccaa tacaaagaaa tgaaacattt     48840
     aaaaaacaaa aaacgtaaat tgaaacattt ctgtacccat aagatatata tacattaaaa     48900
     caataatcag ttatataaat taagttggtt cggtcatgga acaaaaatgt ttttgaagaa     48960
     tatcataata gaactttata aattttttga catattgttc attaacatta gaagaaacga     49020
     taatttaact ttttgtttag ttttactagt ctagtaatct tcaaatcatt ttttggccga     49080
     tacaaattaa attatatagt caaatgttca tcaccttcaa gtttataaag taaacttcat     49140
     tcaaaagata ttgaattaat taatggatga tacatttata cctgagagag ccattgtaaa     49200
     gcagacatag tcacaacgac atggagctct cctttcggaa acagacgctt atagaacgag     49260
     ccgggaacgc cagccgcgaa gtactttcgg ctcgaaccgt tcactttctc atccaacgac     49320
     cgaaacaacg cgttgaaatc gttggaagac aagtcagaga agaagacctc gaactccatc     49380
     tccggctcgg ttccaccgtc aatcacggct agcttcttcc ctaacacctc aaccaccgtt     49440
     tccaccgtgg aaaacgtgtt gtctccgatt gcgcaaccta aatcggctat tttcaggtga     49500
     gaggagcaac cttcggtgag ctttatggag ttgatggctg tcgtcagcat tggtttgctc     49560
     aaggctaaac gtgccgctgg accgtaacag tttttgacgt agctcgcgtc atcctcgcca     49620
     ccttgcatgg agagcacgtg ctcgaggctc cgtgacgact ccatatatag ttgtaaatgt     49680
     gtaagaaaag gtgtgaacgt tatactaaga ataagtaaat taaagaagga ttgatttggt     49740
     tttagacctt gatggctcaa cgaggatcaa atgtctctat atatacactc ggtaacagtg     49800
     tgcagtcaaa ggctagtgcg tcgtcgtttt aacttcagtt taacatgttt acatgtcctt     49860
     caaataactt agaatacaat ttatgaaaga tcctacaaaa atattataac ttttgtataa     49920
     aaaaaaatta ccaccaaaat cctaaaattc tagctggaat ttccacatat aacttaatta     49980
     gttgtttgtg tcattaatag agtttcgaaa ctcttcctaa aaccgaaaat agaagagaat     50040
     ctgttaattg gtagtggtaa ccattgaaac ttgcacaagt gtggatcaag ttggatatta     50100
     agttacttga attagtgaaa ctgctgagct gagattttcc atattttgct gtccattggt     50160
     ttttaataat gttagtctcc atggagaatt agttaattgg tatatgatta tacttatatg     50220
     ggttatagcg tgaaaaaaag aaacatctac tttaagcaac agcagaaagc attaaagaat     50280
     agataacccc aatttccgag aggaacgtta ggagaaagtt tttgaaaatt tacaaaactt     50340
     tctgttagta gatgcttaat ttcatcagtg ttttccaagc aattttgaat taaggattaa     50400
     taaaattgtt atgtatatta tgaaataatg aagatatttc gctatctcta gagtctaaag     50460
     agattagcag ttggtgcctt ggtggttgac aaaagaaaag aagaagagat tagcagttgc     50520
     gtttaacatt ggttttatct agaaagatga actgatggtt acatataaaa ctagtcgttg     50580
     tctgtcagtg tccactaaag actattttct tcttttgata tacatttcta aatatacaac     50640
     aatatcattt ctccgaggtt tgtgaattgt ttaggtataa aatagttttc tacaataact     50700
     tttgctatcg ggtgcaaaga cattctacca tagaacgagt ttagtatagt gtcatttcgt     50760
     agattcttta ttcggattgg tttttcaata tcaacaaaat tctggttcat tttcttccct     50820
     cctataaacg aaggtaaaaa gaatgaagaa aaaagaaaag aaagaatatt ttgttaatgc     50880
     attatctaac gtgttaatgt gtcactttca tttttcttaa tcgtttgttg aaaacttttt     50940
     gcagttgatt tcaggaaaac ggaacacaca tatatatata tatatgtctt ttattttcaa     51000
     tacggaccaa atccatcatt tgctaatcag tgagaaaact aaatcgtggt ctactagttt     51060
     atataaattg aaaaaagaat cataaataat atgtcacata tccaacctaa agatttatgt     51120
     ctatacatgt aaaaatgtaa atgagcatat tcccaaattt cccacaagta tatagcacta     51180
     cctacactca cgcttcttca aagtgaaggc gatggtggaa aaaagcgtag acgatgactt     51240
     gataagattg actgaagaaa agaaaaaaag ttatcataag tcaaaaagca tgtcgttaga     51300
     gtttgacgag atcccatgca tgattatatt gtcggataca attgtttgaa caatacggtt     51360
     ggaaaaatct accgtaatat gaagacttga atgacataac taaagattgt accttgcaag     51420
     ccagcaatgt gttaatgata tgagtaaggg tgcagaggct gcggctggtg gctactggct     51480
     agtgataagc aatttacgat gtaatgacag atatatcata ggagactagg agttatatat     51540
     ggtatatata gaatctaaaa taacatattt atcaatttac tatattaagt tttatggttc     51600
     caaactcaaa actaattgtt tatgagtaga tttggtttat atactgtata ttactcatat     51660
     tctatttcca cttttaatgt gggatttctc ataaactata tacagttata tttttaatta     51720
     atgaaataac aataatacag atttaaatgt agccttaact atttttatga aatttaaatg     51780
     aaatttaatt taaaagattg cattcagaat acaaaactgt aatattctgt aaaatattga     51840
     taggtactac ttacaacata ggaaacatat ttaaagatat gttatataaa ctaaaaatag     51900
     tttaaaatat caatatatat atatatatat atatatatta cgaaaagaag aattaaaaca     51960
     gactacacac ataataaaat tttaatagta acacttacaa acatatccaa taatattaaa     52020
     taaaattaat tcattatgat ctttatgtta tttctatata ctcaaaccaa aaaaaaagaa     52080
     gtaaatgatt caaaatccaa tcataattat ttttcaaatt cattaaaata caagaaattt     52140
     catattaaaa aaatagatat ttctttcaaa gatttatatt caaattataa atatatacta     52200
     aaacgctaaa aaattaagta catgctataa tcttttccat tatttttcta acaaaagaaa     52260
     gttatatatg ggctaaactt agaaggaaag cccaagaggc caagactata taaagattca     52320
     tgacccgagt ttaagatccg atttcagaat ttgggactaa aggaggacaa cgacaagcgc     52380
     cgggaaaaaa tcgagagcga caacaatggc gccttcttcg tcgagcggtc tcacgttcaa     52440
     gctacatcct ctggtgatgc ttaacatatc cgatcacttc actagggtta aaactcagct     52500
     taatcctccc gccgcttctt gcgccaccgg gaatggctcc aacaacgccg acgcgatgtt     52560
     actgcaaaac cctagggttt atggctgcgt catcggtctc cagagaggtc gtacggttga     52620
     gatcttcaac agtttcgagc tgatattcga tcctgctctt gatactctcg acagatcctt     52680
     cctcgagaag aagcaagaac tctgtaagtt tacttacact cgctcacttt tgttgtcgat     52740
     tgtttgatac tcttgctaat ttgtgagttt tgttattttt tagataagaa ggtgttccct     52800
     gacttctacg tattgggatg gtattctacg ggaagtgacg ctaccgaatc tgatatgcat     52860
     atccacaaag ctgtgagtag tgtagcttta atgtttaata taaatttaat tgaatttagg     52920
     attctcattg tactgatttg ttgaggtttt catctacagc tgatggacat taatgaatct     52980
     cctgtgtatg ttcttttaaa tcctgctatc aatcatgcac agaaggatct tcctgtgact     53040
     atctacgaaa gcggtaaaaa ttggttattt gcatcactga ttgtcttatt gttttataga     53100
     ttataatctt gctaatcctg tctttttgat tgttttcaaa atttgaagaa tttcatgtca     53160
     ttgatggaat tcctcagtcg attttcgtgc ataccagcta cacaattgag gtatgtgttt     53220
     aggccacttg atctgtaatc tatctatgtg atatgagagt ggactttcaa taacattgca     53280
     atgattgtaa acgcgtgcag acagttgaag ctgaaagaat atctgttgat catgttgcac     53340
     atcttaagcc atctgatgga ggctcagctg cgactcagtg taagctttat tatcacttca     53400
     tatttatcat aatctgttct ttctttttca tctgcatgga attttaggtt gattcctcga     53460
     ttttgtgcag tggctgctca tcttactgga atacatagtg ccatcaagat gcttaatagc     53520
     agaatcagag tgctatacca gcatattgtc gctatgcaga aaggtatatt cttgctcaag     53580
     tccccactct cggtccctct tcaatttgtt aatcaagctt ttgtgacctg tcccttgatc     53640
     ttagaatatt tctatgtgtt ttcctacggg gaagaaagaa ttaaaagggt gttagaagat     53700
     gattttgagc aagagtaatg tggtactaat gacttatgtg attctgcatc taggtgataa     53760
     accttgtgag aactcagttc tgagacaagt atctagtctg ctcagaagtt tgcctgccgc     53820
     agaatcagag aagttcaatg aaaatttctt gatggtaagt agtaccttac ctttttctag     53880
     caatgttggt taaataaagt ggccttcgaa tctcttaaat tcttaatgta gcttgttgtt     53940
     gtgaatgata tctttataaa tatgatgttc tcttcttttg caggagtaca acgacaaatt     54000
     gctgatgtct tacctagcaa tgatcacgaa ttgtaccagg tatgtgctcg acacgctatt     54060
     ccatttaact atttgaataa aagaatgatg gacatgcatg caaatctttt gcttgataca     54120
     atgcaatgtt ttacgatacc aagacagatg aaatcaccag tacttggttg aggctgacat     54180
     tgagatagtt tgttttattt agattaagaa ctaaatctag gaccttgctc aattatcctt     54240
     gttataatta agatactgag cctgtagtag ctaagggaat ataagcttct ttttaaaaaa     54300
     aaaatctaat cttgtgctac accttgacca atccatatgt caatttcatt ccaacgaaat     54360
     gtcctgaaag aatcctttgt atatttgatc tcttactctc ctttttcccc ccaaaatgca     54420
     gcaacatgaa cgaggtggtt gacaaattca acactgcata cgacaaacac agccgaagag     54480
     gtggtaggac tgcgttcatg taaagattag tttcaatgta aaaaaacctt ttctttcttt     54540
     tggtggtctg gtccctaagt gaaaatttag aactctttta aggcatttca cttttcggaa     54600
     ccaaacaaac agctaggaag cttttcttct gtttaagctt tgtctagaca gaagctaagt     54660
     ttaggcctaa ctaaattttg cgacaagact gtaaaaacaa aacagctttt accttctctc     54720
     aatttttcat ttattcaaaa atttgagcaa tcagtgaaca aagagatttg tttcatatct     54780
     gtcgtaatct actcaacatc tctctgcata tcaatgagct cgctgacaaa tcaagtccct     54840
     gttgtggtga cactggttcc accttcggct gtgctgctaa ctgcaacatt aggccagttg     54900
     gatccccaat gtcaggcgcc tgcaggctgg taagcttctc ttgcccaata gttagaccag     54960
     gcattgaaag atcagaaagc tcagattggc ctatgtaaac ggagaaacct gtaggatgcc     55020
     tcaggtgtga ctggaagtca aatagagatg agttggctgt ggccagtccc tcagatctac     55080
     tgtgtggcat tggatagtgc acattgtggt tgtgggtctg agtcgctaaa ctgccttgga     55140
     gagtccctga actgcctgca ccgacgtggc tgctgttgcg tgctgctggt acaacgtggg     55200
     tgtgcttgcc tatataagtt gttagtacgc tcttgaagtc atcagaggct ctctctacat     55260
     gcttcgttac ggtacatcca ttagctgtgc atttatagta gctcctgaaa acatagaaaa     55320
     ctgattttat taaattcaac aaagggatag cagcagaaca gagcatttgg atacaagaac     55380
     cttggattcg ggtttccttt aacgactttt tgcccatact tgcgccagcg ataaccatca     55440
     tcgaggatgt caatgtcact tgtggtctgc accacaactc ttggctcacg gctggctctg     55500
     gttgatccac tcgtttctgt tgcataagct tctagtttcc tgatacggga atgccatcag     55560
     agctcagaag tcagaacgtc ttgtctttct aagtattata atggttacta gagcaacttt     55620
     ttataccttc tctttgattc ggactcttct acctctccat cgtaagtcag ggaaacactc     55680
     atgtgggacg tgcgatcatc ttcgttttca tctctatata aggcatcagc tgctgcatca     55740
     ccatacccga actgatgagt cccgttttga acctgcattg atcctgaatg gcttccgtat     55800
     tcgagctctg cagatacagg tgatgtccat tctatgttct cattggttcc agcaaaacct     55860
     tcgtattcgg ttgcatctat ttgcatgtct tggccagtac cggatgatcc aatccctgac     55920
     cggcggttag gtggaggttt gctgtgtata tgatctcctg tgtatatgat ctctataata     55980
     tgaccttccc gagaccgttc aaccttcttc ttggcctcac aattcgggtg cgtgcacttg     56040
     taatagctcc gcggatactc acttccttta actagctttt gtccatattt tctccagttg     56100
     tatccatcat ctgcaggtgc acaacaagcc atcgagtctc ctaaaccgcc gagctgtctt     56160
     tcttcatagt cttgggaatc atcgggttct aaagcgatgt tagtaggatc aaggccactt     56220
     cctgaaatgg tttggaaggc taaggatgtg gtaatgtcgt caaataactc agctttagcc     56280
     ttatcagaag gtactgatga gagcttcccg gttgttggag atagctgagc ttacaaatga     56340
     taagagattt tagagcactg attcacgaaa gagagagacc ataatgaaat gttgaaaaga     56400
     aaaagttacc aaagggtttg agaggaaaac aggagactct aacagagttg caggactaag     56460
     accaggagaa gagatggtta aagatttcga ctgaagaata tcctcagtgt ttaaccacgg     56520
     tgcattaaac ccggatctcg cagcaatcct ttcacgaaga gctcctcgtg aactttcttg     56580
     aaaggtggtt tgcaaagaat cctcattctt gatgtaattt aaagaaaact ctctaccaag     56640
     ttccgctttc gatctcttcc tgtggttagt agtactacag tcgaaccatt ctcccattac     56700
     agcagcttta ttatcaatac cagccattgc aaacccaagt ttcagcttta acttgggctc     56760
     aagctgaaac gtgattaggt gttacatata tgacacagag cagttaacat ggaactaaaa     56820
     tcttaaaaaa ttattgtaat taaaatggaa acagagcagt tttttttata tgcaataagt     56880
     cttttgatgg agatacaaga gtgattaata ccttataaca atgaagataa aagagtgctt     56940
     aatacctgat ttactaatat acatgcaata agtgacaccc atcagacttt ttatttcgcc     57000
     gtttagacag taagagagat cgaaacatcg aaacatggac ttgtctatgt ctctctgttt     57060
     ttatgggttg atcacacaaa atgatcaata taataaatct tctgtagtag aaatctcttg     57120
     ctcttgctct ctctctctct cgttcttgat tatcgtttac cctcaacaca atgaaaatgt     57180
     atatcggcag aaaaactaca agagatttac acagcttggt tagataaaat ttctccttaa     57240
     ctctctaaca aacaaaaaag tttcaatttg ttttctccaa ttgtgttaat taatcagttc     57300
     cacaaaaatc accaacagtt taactatttt tagaaataga gttttgtgca aaacaacctt     57360
     caactttata aacgttttca aattattttt tatttttatt tttttggtaa aagtagacag     57420
     tgctgtgccc aatgacgtaa atgttgaagt tacaaaaata gatgattttg aagatatttt     57480
     tacacaaaac ccttagaaat atacattata ctttcttttc tctaaacaga cacctataag     57540
     atatgaaata ccatttattt gtgtttagtc ttcttatgta tatggtaagc tatatctttc     57600
     atatagtcta atcagtgcat gtccatcaat aataccatgc atgagccttc ctccaactat     57660
     tcacaacagg agctgaatat taaactggca aattgatgtt ctaccatata tacctattat     57720
     atcacaacca gcatagtcta tagtggtttt actatagcta atgtaattag tactaattaa     57780
     agctagttgt tagaaaaaca tgagcaaaaa atctaatttg caaactatat ttagtatata     57840
     agtgattaag ttacaataat caattaatag aaatactttt ttcaataata ttccaaccac     57900
     agaaaaaacc aatttctatc attttggcag ataaacttgg tttcgctagt ttgttaaacg     57960
     aactagcagt atagcttatt tgtttttgtt tatatataga agaaactcaa gccagttggg     58020
     ttacctatct tgtttatgaa ttttcgttaa tgtttgcaat atttctgatt ttttgtgaaa     58080
     gactaaattg tagaattgta tccacatttt attctttccg ttcatgtcgt agatttttag     58140
     tttatgtttc ggtcaacaag tcgtggagtt aaaatatact atacaataaa ctgaaagttc     58200
     aaatggaatg gggttcacca actttttaat ttacttattc ttgtggtcac tttctttcaa     58260
     aatgtactaa ataattttat atattctcat aatgtctaaa tataaacaat aaatatgaat     58320
     atgaaaataa acataaatat gaaaataatt tttcttttat aaaagaatta ataaactaac     58380
     gataagtgat tataaaaaat atatgtcttt ggaaaccaaa caaaatagtt taggcttcaa     58440
     tcccattaaa ttctcatcta aaattgatgc atgtagcatg tagatatgat catgacaaaa     58500
     cgatgattta caaattttta tttttcattt gttcgtcata aatatttgat cgtttatgat     58560
     aatattatta ttagacatga ctgattgtta ttgcacaaat aatttacatt gtatatagaa     58620
     tttgcatcgc atttttattt gcgtatcaat ggctgacact gagatttatg aggccacaaa     58680
     caatttcggt tttgggggct tcatgatcta tatataaatt ttttttaccg tttgggcctc     58740
     aaaagctata catactactt gttaaaattt gggatccaac accgatgttc cactaggata     58800
     tgatcagtta cggattattt attgtaactc ttgacaatat tgcacaaaaa atttcttgat     58860
     tgtaaacatt cgggttgcaa cgtcagacca tctcactttc tatcctcaaa ataaaacatt     58920
     tccaacatgc catttttaaa attctaatct cataagcatg atattatttg gacatgaagt     58980
     gtatacagtt atagtgtaca agcaggagag tagaagtcac gcgtcttaca gatgaactta     59040
     gtgctagttt accaaagaag ctgacgtggc gttttcatgc tttccgtctt tgtgctaata     59100
     atatatggta gaaaaaactt ttgagacgca aataaaaatg cgaaaacccc aaaatcgtaa     59160
     tcagcagcga tcgagatttt cgccgctgaa atctggagac tgattattac aaacttgttc     59220
     gtcgtgttct tcatcggaga gacactagat cggaaaattt aacctcgatt tgattgccgt     59280
     tgccgtaaca tttgactgtt gttttgtggt ggggaattct agggttcttg tttgatgaag     59340
     aagaactgaa gtgaaaatga ccattaaaat ctcccatgag atgattgtgt ccgttcattc     59400
     ttcgaaatcg gacaacggaa tcgaatgatc gtcatattct gtaagagaga aggttagatc     59460
     ttcaccgaat ctggaactcg agatccatcg ttttgttcga ttttctattc tttcgcacaa     59520
     ggattggtct gagaagaaca agttcaagtt agaagctgtt gtgttctgtc cggtgaaact     59580
     tatttgagct gctgcaaaaa cttcaaaagt tgttactttt tctgaaataa cttaagcttc     59640
     ttggtatttt gagactaaat ggtttcacta ctcttgtgaa ttcctggaaa tcagaactgt     59700
     tattagtttt ttttgtatat ttagggacaa agatgcatgc taggcaacgc aatgttggga     59760
     atgggtacag atctggttct attgggatgg gtatgtctgg ttctagaatt tctcctgagc     59820
     gtcctatgag aggacatggg ttctatggtt ctgaacacca acaccgtggc tttaaccgtg     59880
     gatatggacg tggaagggga cgctctaaat cataccacaa tcagctgcct ccgcctctgc     59940
     ctcctccacc ggtgcagcgt agaagcagtg gcggtgacgt tttcatggag gcaggtcgtc     60000
     tagcaacaga gtacttggtt tctcaaggtg ttctaccaca aactgtgctt tccagtaaat     60060
     ggcagaatgg taattttagg aagcaagctg gagagtttca gagttccagg tctcaagaag     60120
     aagcccgaat ggatgtttca gctccagctg cagagaaaag gaggtatatt gatggctata     60180
     gctcagctgg atccaggaat agcttgaaag gaaggagatc ccaccgttat gactcggatt     60240
     ttgggaggag cggatcttgg tcagagagaa gtaaagcttt tgagactgag actggtgacg     60300
     actctgtgtc tgggcatcaa gaagagcagc cgcttgctga agatattgct agctcggttc     60360
     agcggtcagc ctctggtgaa tttatgagaa aatgtgaagg agcaggtgat tccgagtctg     60420
     tgttggacaa gtacaatctc caggatgagg cacagtctaa gacaggttcc tcgagtgccg     60480
     ggaaagatat agtacaggat tgtgaaatct ctaaagtatc cgaaggctct tctagcttga     60540
     gtgctggatc aggagagatg aaaggtaggt ctggtggtaa tggtggagag gatgagaacc     60600
     agactgctat cgaagatgga tctatccatc aacgttgtga agatgcatct attgatcaac     60660
     agtgtggggc tgatgaatca ttcaccaaga gtggtattga tttggcaacg ctgtgtaaat     60720
     ttgagaaggt gcctacgagg acacgctctt ctctgactgc aaaaggccca aagctttatt     60780
     tgagtcataa tatcaaggat acctctcata attctggact tgaagaagaa gatcaaaccg     60840
     aaaatcgatg tgagactcga ggccaatcat ctggaaaggc cgatagtact ggtgatgaaa     60900
     atgaccaagt tgaagatttt gctcttgttc aatatattga gaacagtaaa tgtcataggt     60960
     ctaattcttt tcccagtagc attctcaggg ataacagtga gaaagaatca ggattagaat     61020
     tgcctaatct gcacagatca cattcggtgg ggaaagtagg tgagaaaagg cctggtgaag     61080
     gcagtgactt ggaggaggga tcaaaaagac agagagattg ggtggcagtt tctgaagcta     61140
     atgaacgctt caacatgttt aaaacaagcg gaaaccaatg cgatccggaa gaagaaggaa     61200
     agacaagctc gttcaacaaa agactgattg acggtgctgc tggaaaaagg gtcagccatg     61260
     aaagtctggt taataactct acatacaata ggacacacac tggcagaaca ggtccagggt     61320
     atgctgaaga acatcagctg tttcctgctt cgtttaagat gtgtgaccta aatctagggg     61380
     gagcgtcgga tgtgaatgat gggataaagg aatctcgtca agctgttgat tttgatctct     61440
     caatcagcag ttctagtaag tctctcgagt ttggtacgag tactcggatg agcaatggta     61500
     aagagataga agtgattaat ttggatgatg atcaagaagt ggtaaagtcc agcaatgatc     61560
     caggaagaaa gtacggccaa gtcctactct taacacttat atatacacac acctattaca     61620
     ttttggctaa tgggttttca tatctaacag gcaagaagct gctccatata tgggcatcga     61680
     tgacgtccca gactacaatg aaagactcat gatggtagag tatcttgatt cctttactcc     61740
     aataaaccag ggaaccagta gtgtcccaca gaataacaac acagttagcc ttcaagaccg     61800
     agaggtacct actctacttg tcaagtttta tgtcacatag aatgtttgtt gttgctaaca     61860
     gatcctgaaa acgtctcagg gagctattgg aaatgaccaa gtaccaaata atacagacga     61920
     tgattcgatc ttcatgtcac tcggagaaat accattgagt aagaccaata tcaaattctt     61980
     tctcttttct attttagctt cttaaagagc tgagattcat tatgtctttg caattgtgca     62040
     gcattcttgc aagcttggga ccaacctcca gctcgaggct acgagaagcc tttctgattc     62100
     tctttttttt tgttatgttt cttcagtctg tgtaatgagt gtgtagtagc ccaatttcgt     62160
     ttgtgctaat ctcaatcctc tcagatgatg taagaatgtg acttgtggtg ttttatggtt     62220
     gtatgtaccc tttgtaattc tctgtttatt ctcacactgt ccccatgttt taggtcagtt     62280
     caacaatttt ctgaaattgt aataaccaaa atgataatta ttaacggtat atatatgtcg     62340
     tgtccaatct cacggtcaaa aatgaagaag gtgatgctga gaggtcaggc gattccgaca     62400
     cgtgttatat tccaaccacc cacacgtaat tttcaaaaag gaacaaaatt gatcatgagg     62460
     gaaaaaagaa taaacttttt cccacaaaga aactttccac attgaacgag agaattatag     62520
     atctgcgaat ccgatcattg gattagggtt ttcacttttc accctccttt ttccatctct     62580
     ctgctgtata cccttccttt ctccaaaaag accaaaactt tgcgattcaa ttcgaaatct     62640
     gtgttcttcc attgagctgg attttcattt ttggaatcat ttcttctctt ctttgatccg     62700
     atagatggtg gcatggtagg aaattttaga cctttatatt tctatttaac cgtcaaggaa     62760
     ccaatgaatt tgtatagctt gttgagttga ctttttgatt gtgtatgatc gaatttggga     62820
     tcctcatttc gggttttggg ttattgatct gagctcctgt tacttctgaa accgatgtga     62880
     atttggtggg ggatagattt ttttgtggag tcaatggatt tggagagtga aagctctgca     62940
     cttgagtctg ttgatgataa tgttttgatt caacaaagtg ccagcaacgt ttgtgatgat     63000
     ggtaggagtt tggataacgg gtcttgctct gatgagagtg tgaaactgct ttcgacttct     63060
     aattctgttg aactcggtaa acctatgagt tttgattcac caggtgatgg tggtggtgct     63120
     tattctccgg ttttgaaagg acaaggcttg agaaaatgga ggaggattag gagagatctt     63180
     gttaaggaca cgtctgcgaa tatggagaat agtaaagctc tgaagagagg gttgtcaggt     63240
     gttgctcatt cacatggtaa acagatgcag tttcagtcac cggaagttga acaagagagt     63300
     cagggatctg ttgggtctgt taatatgttg aaaagtagcg gtgatggttt tgatatactt     63360
     gggagtagtg gttacgattc taggtttgtg gcaggggttg gtttttcagc tggtatggat     63420
     ttagagatag atgatgatcg gagtagtaag tcttccacgg ttgcaagagc tcccaaggtt     63480
     attaggtatg agaagccaat gattagttca ggtcagggag gaaacattcg tgtagagaat     63540
     agtaagaaac atagaggaga aagtgtcgat ttcgagaagg aaaactctta ttccagcttg     63600
     gaatctgact caagaaagca gagtggaaga atgatggact acaatggtga aaatggggaa     63660
     acgtcaatga gaaaagatga tgcgggagga gaaggcggag agtcgataaa cacggacaat     63720
     cgttactcag atgaaatgga tccattaaca gaggccatca acggtttctt ggccttgcaa     63780
     gatgctcttg aaaaaggtag ccattctgat tatttttttg ctgcggattg tatctaaact     63840
     tgcattattt ttactgctgt tacataacta tttcttgtta tgagcctgca ttatcatgtt     63900
     ggaatcaact aataacatca catgaacaat gattatgatg tttaatgtga ctctttatga     63960
     aatttcattt gcagaggttc agcaattcca ggagatcggg aatgaaccaa tgccacagca     64020
     tcatgaacaa gtcagcgaag caaattcacc tcaccccgag attgtaaccc tggtaaacaa     64080
     tgttgaacaa ctggagaaca tgctagaaga aacaaggtcc atgcttgagg tgaaagaatc     64140
     acacatccgt gaccttgaat ccaccacgaa ccaaagcaaa cactcgtggg gaggaacaga     64200
     gattgtggtt gaagacatct tccggcagaa gattgaggcc gagattgaat atctgatata     64260
     ttcaagatct atcgataact taaacagtca gatgaagtta attgatgaac aagagtcatt     64320
     ggcagaagag caaacccatg agacgctgaa taagctagga agagtacaaa cgaaggctgc     64380
     aaattttaca aacagagctc aagacctgca aaacgattgc atagaaatca ccgggaccat     64440
     caagaagaga gcatgtaaga tcacttcata cgttcttata cagttagtat tgctgtcaac     64500
     agtagttttg ttgctcctgt ctcaattgtt gccggagcca gatactgttg tacccacatg     64560
     acttttgatt tttgatgtaa actgagtttt gttttggctt ttggcttttc ttgttaacaa     64620
     ttcggctata agttttgcct ctggtaataa aattaatcaa gtaagtctcg cttcttcttt     64680
     tgtttatttt ggaggtcaag tattctttac acttggacac ttggtcagta acagaacaat     64740
     ttgataattc tatctagttt gttagctaat atggtatcaa aatgtaatca ctctttggct     64800
     ctttcaattt cctttgattg atcaagtcaa cactaacaaa gcaaaaacag cggttgcagc     64860
     agagatcaac agcgagataa aacgaggagt cgaatcagca gttgaggcgt ttaggttatg     64920
     tgaatagaga ggtggtaaag ggcaaacaag cccatctttc ctttctctgc actcgttagc     64980
     gaaaaggcca gtagggtagt ttccataaat attcatgtag ctgaacattg tctgtgcaca     65040
     atcactattc atgtcgttga tctgactcac gtaaggacat gcaaattctt taaaagcaga     65100
     gcaacattct ttggctggaa acgctggacc tttgcacctc tttgtcaaga ccttgtagtc     65160
     catatactca aagttcactt cacattctgt ttccaaccaa acaaaaaaca agagttagtg     65220
     tcacaccact tatatatact tatctataca caaacttgat acactgatcc aataatacaa     65280
     atattatata agaacactaa tgatacaatt tgattttaaa ttaaaaccaa agatgaaaaa     65340
     gttctgaaac ataaccgaaa tctataaatt aaacatctct agcttataga caggaccaaa     65400
     attcatgtaa gagtacaaat gttcctagtt ccgacgttac gtcataatcc tcaccatacc     65460
     aagctatata tcaatatatc atacatatca taaatatgta catgagtcta tattcacaca     65520
     ttgacgtaaa cataaaatga aaagcagaag taaattaaca aatcggatta acaaattaaa     65580
     aggatgagga tgcttttact tttcttggca tgacgaaggt tccttccact aaccgaggtt     65640
     tgtgattcaa acacaccatc tacagaaagc gacgacccat tagaaacaaa ttaaagatgg     65700
     agggtggaga aggaagacaa caaaaagaca tacccgatat ggaacttgaa gaggagagag     65760
     ataccaacag tgccatcaga aagaagaata ataatatcag ctccatgaaa ttgttgttaa     65820
     agaagcttgt aacattttca aagaagaata cataaggaaa agagttatgg cgaaattaat     65880
     gtcttacaaa aaatttcaac ggtagtcgtt tcaaaaacgc caaataatta aataactaaa     65940
     atataaaata accattcaat aatatatgtt tgtttcgtaa ttaagaaccc caaacatcta     66000
     gtaattttca aaaggcccct taaattttga gaccataata tcttcgtact ctaaaactgg     66060
     ctttgtataa agaattaaaa gacttatcta agacaaaggt ctttcctagc tactagagta     66120
     gtaagaccat agataattgt ttgatataaa gaggattatt ataacgattt atgtataaat     66180
     tgacaaattt agcctaaggt cgatagtgca ataatgaaaa tttaaagaga ttctaaaatg     66240
     aaatctttaa attttcgaat tctcaagtta gaagaaaagg atggatagat ttctgtgtac     66300
     acccgtgatt aacaaagtca tggatttgat caatacactg aattgaaccc atggtcccaa     66360
     aattaacttc caaaaaatgc aacaaattaa aatgactgat gacgaaaaag taaatatgac     66420
     gacatttaca cacaagagta accctactta ggtgcatgtg tgcgtggttt ctaagtagtg     66480
     ggcagtttag gttaattcat tttgaagaaa ataagatagt tttaagcttc tccacgaagt     66540
     actttctcaa aatgcttaaa gttaataatc aacctggtat tggtaatgca gacagagcac     66600
     acggtattta gattgctatt ctactatata aagagagctc atccttctca tatatctcaa     66660
     catatactta ctcaaacata ttctataaaa atttcccaaa ttaaatatgc taatttacgc     66720
     attggatttt ttcatccgat ttcctcgaaa ggatgactca cagatcatgg aattgtgtat     66780
     aggcacggtt aacaacggca caagtgacaa gacggcggac caaatcaagg cgacaatgga     66840
     agcggcttac cgtgtattat ataggcatgc acctttacct cgcaatatat ttggtcccat     66900
     gttcccgatg tcttacctcc atgtcgcagt gagctcgagg gttttgcaca tactctctaa     66960
     ggtattaaca taaaataaat ttatgttctg tataaatctg ggttataata tcattgtcgg     67020
     ctatatatga tataggtacc ggagaaagta gtagagaatg ggtggaacaa aaggaaggcg     67080
     tggatagaag gatctgatcg acaagtgttg atgcgttacg cggagcaagc ggacaaggac     67140
     ttagtcgact ttttggcaga gccgtgccga ggaattttga tgccataggc gaaaaaatat     67200
     ggtttaatag tttaataaaa taatgtatac ataacaaaaa aatattttca tgttcaaagt     67260
     ttaataataa attacgaaaa tcttaagcaa aacttaaaaa ataatttaga ataaaaatat     67320
     gccaaaaaaa ataaaaaaaa ttaggttgat tataatgtgt aattttgtaa attgtgttag     67380
     tatcattatt gtgttaccat tcaaacggta taatgatgtt aataaaataa aacataattt     67440
     tagtagttaa taaaaattta atatatatat atatatatat ttataatatc caaaatatag     67500
     tatctatata taaaaatata aaaataatta ataaagtttg ataaagataa ttattgcctt     67560
     aaatatatta aagaagtgag aaaaaaaaaa ttagtgagat atgaaaaaaa gaagtgagaa     67620
     aaaagacttt aagatattgc cttaaatcat ctaaaaatta tgaatgataa taatacccaa     67680
     tagtactgac atctagaacg gaaatacgga attatgaata ctatatacta atgcattatg     67740
     ccaataaagt aataatagat aagattagta ctagtagcta atacctttgt acattgaaat     67800
     aatattacta cttgtgtttc taaatatttg atattcttaa agttttcaca caattaagaa     67860
     ataattcata tttagttata aatatacatt taaccatttt catttaatag ttttttaagt     67920
     ttacaattca tgaatattaa ttacaaaaat tatataacaa acataaagat acaatattta     67980
     tgaaacaagg aaaaaaaaat ctagaaaatt aaacttttaa aaacaaaaga agtagtaaaa     68040
     tggagaaaag tcaaatgaag atggagagtt tgggttaaaa taataaatag atgacaaatg     68100
     aattagcgtt ttttaaaaag atgcgcaatt acgtggaagc ttcagcattc ttcacgccca     68160
     ttacaaaagc tttcttcttc tcaaacatct gattaaaaat tataacaata aacagatctg     68220
     tgtgattttg tgttttgact tttgatctcg agacaaacaa gaaactaaaa caggttcttc     68280
     ttctcttctt ttaccttttt gtttgctttc gtcctgattc ttgtgacatt tattgtctga     68340
     tgtgaaactt gtcctttatc tattatgcct cgatttttat ttttatttcc ccctcatata     68400
     ttgaatctag atctggtttt gataatcttg gaatcagaca gtgtttgtat atttcggaca     68460
     aacaagacgt taaaaagctg ccttgtctta caagaaacta gattttgtct cggggtcgat     68520
     cttatctcca aacagagaga aattaacaga gacatgggag gtgcagtgac gaaatctgaa     68580
     actctgcaaa aagaatgggt tccagagaca aagttggagg ctaagatcat agaagccgtg     68640
     caacgcaggg catcgagggg caccacaatg aaatctttca acagtattgt tctcaagttc     68700
     ccaaagatcg atgatggtct tcgaaactgc aaagccattt tccaagaatt cggtgagtgc     68760
     atatagggca gattctaaat tgcgggtttt cgcacgattt gaggttgttt acttgtttgg     68820
     ttttgggcag atgaggattc aaacgggtca atagatcaca cggagctaaa gaattgtatc     68880
     aggaagctag agatctcgtt cgatgaagaa gagattaatg atttgttcaa ggcttgcgat     68940
     attaacgagg atatgggaat tacatttaca gaattcattg ttcttctttg cctcgtctat     69000
     cttcttaaag acgattcatc cactctccaa aaggtacccg caaaatactt ttatcgatct     69060
     cctatgctcg gtttgatatt tcgttttaga ttttgattgg ttattcaatg gttttaaagc     69120
     tatttttgtg tgatgaatag aaatggacaa tgggaatgcc aaagctggaa ccaacattcg     69180
     agacgcttgt tgacacattt gtgttcctag acgagaacaa ggacggatat gttagccgcg     69240
     aggagatggt ccgagccatt gatgaatcag gagaacgatc ctccgggcgg attgcaatga     69300
     agagatttgg tttattctta aactccctcc ctcttcttct caagctttct tcttcactga     69360
     accaagaata ttgattttga ttcctgtgtc tgcagaggaa atggactggg acaagaacgg     69420
     aatggtgaac ttcaaagagt ttctcttcgc atttacgcag tgggttggga tagatgagaa     69480
     tgaagaagaa gaagaagaag acaacaatga gaaagcttaa atgttatgag tttctaagtc     69540
     taaatatgtg ttttgtgttt gcagaatcta gtagtaacaa aagatattaa ttagttgatg     69600
     tttatgttaa cgcaaacata ataattcatt accaaacaca aaaccatgat gttttaccca     69660
     aaaactggct tcaagcaaca aaacttatta gtagtctcca ctgaaccaaa ttattaaaac     69720
     aaaaaaaaaa aaaagagcaa gcaagccaaa aatagtctcg gaaagagaca gcgacagcga     69780
     cagagagact caccatccct ttgtattgcc cctagttctg tcgtctgaac tctctccggg     69840
     acatgataaa taagacaaga cacagattca tatacgacgc tgttcttttt gtttttttat     69900
     tccagggatt agagacagta ccggtagccc gaggaagagg aggaatggga tggagacaga     69960
     atctccaaat ccttcttgtt tgaaggaagc tgttacggtg gatatatacc ttcttggaaa     70020
     ggtgagagag gcaagcaaaa atatgaaatt tagacgtgtt tttagcccct tgtcttagct     70080
     ctcttcatgc cgaggctatt gtaaggtgag atggaaccag acattggaga tccttcttct     70140
     cgaagactgc cgttgagaag ggccaattcc cgtagctgtt gtttcttgta gaaatcatgg     70200
     gtttcctcct aaaacagtac acaaaacaag tacggttata ttgacaaaca aatactacat     70260
     gtatctctgg tttaagatct tttaagagct aagaacaaac cacgggagta agtagatcgt     70320
     cgagtatttc acgggcttgc atgagacgtg cgtccactat ttcaatgggt aattctgcct     70380
     cgactaagat gtggagtggt tcattgaggt gctcataacc aggtttacct ctcatcatat     70440
     cctcctgcaa acaataacgc tatattaatg aagatacaat tggagttaag gtattattag     70500
     actgaacaaa tgaaaaatgt gattacctta atcggatctt taatgctgcc tctacccctt     70560
     attagaacac gacaatcagt actcgcttca actcgtttga gggagtttcc tctaggaccc     70620
     aagagacgac cgacaaaatt gtactgcaaa ttatgaaatt attgtttata ctttgacaag     70680
     ataataaagg aactcatcaa gggaataaag attcatacgt ttgggtattt gtcgactgga     70740
     atatccaccc ttattgttcg cttgacgatg agaccggacg agctaccagg agagttaagc     70800
     caatttggtg ctggggatga tgaaaccgat ctctacaaat caaaagataa accaacaaaa     70860
     cctgttagaa gccatgtcaa cctcaataca tacatatgat tgcagcatca aaaccaagaa     70920
     taacatgaaa taaatatctt atcaaacgtt tcttccatgg aaaagggaca atgtatcgcg     70980
     ctgttgcatg ctagcaaccc gtaattgctt atcctaatta taatattcaa agaatggttc     71040
     caaatattag agcatgttat ttctatccta tcgttcacct aacaattata tggctcttca     71100
     aggcaatgga attagttagt gcattgacct taagtcaaaa acattgtcat tactgatatt     71160
     cagtgttagc aaaggctacc tgtaatgaag actatgatta caattaagtc aaagcaagtt     71220
     atgtcagaac aacttaagtc aacaaaagct ttaactgcag tagtatggaa ttagatgaaa     71280
     agagttatgt taatggttag tagtcatact tctgatggaa attgtgaggc ccatccgttc     71340
     atgtcagctc ttgaattctg aaatatccct ccagaagcca gagggctagg gtgatcaaac     71400
     ctactctgac ttaaggcatt ctccaacagc gtggttacac gcaaaatttc tgtttcaaaa     71460
     aatgtcaatt ttcaagagta agacggacca gttagaatta gtcaacaaat ccatcaccaa     71520
     tgatagtgga atggagagac atcatagtct caactaagtt agtgaatatt aacgttgaca     71580
     ctctagttaa aatagattga aacagactgc aaacaatgac aataccctaa ttttgctatg     71640
     atctacaaat gtcacaaatg tgatctgttc aatatcactt ccctacgaaa caactcagaa     71700
     caaggatttc aagaaattag atttcaagta aaagtcttat taataggatt tgaaaaccaa     71760
     atctacatca gagaaaagtc aattgtaaag tctattatac cacaattaaa ctaaattact     71820
     ccgcactatc gttgaatatt ctaattcata gtaagagaag gaggactaag tgtctctttg     71880
     gatagtaaga tatcttactt atgggtttgt acaactactc tatcatatgt cttttgctaa     71940
     gatataacta atctctctta gaagcaccac tgaaaatgct tttcaactgt acaaagatag     72000
     aagttctgaa gcaagaaacg aaaattacag aagatcatat gatgaacagt atggctcacc     72060
     ttggttcatg agccggcaaa catgtggaag cacaggcaaa aatggagtaa gcttgtgacg     72120
     ctctgcaagt aactcagaaa gatacctgaa aaaaaagaag agaaattgca gattatccag     72180
     attagtatga ccttgagcat acaagaagat ccactcattt tcacttaata atcacgttta     72240
     ataagcggaa tatgaatgtc agtagattaa tgtattcaaa ttcatttagc aaatccgtct     72300
     ccaaacatca gcatctaggc agagtggaga attcatagct tcatgaacac aagtcaacaa     72360
     acacgaaatg aacacaacat acgattttat aacacctgtg gcactaacaa tccattaccc     72420
     tgtcgataca aacacaaact aagttgatag atttagataa attgttttga aatttaaaag     72480
     ttggatattt tatagaaacc aatccacaat tgaagtatat tgagctcaaa aggagcttaa     72540
     tttgcagtgg taggtaggta agaactcatc catatatatt tgaaaatcga cgggggcatc     72600
     agaagtagaa agcatagatc tcagtatgag aaaccagaac cagaaatgaa aaatacgata     72660
     cgaaaaacaa aaaaaaagtt ttaagatttg cgataaaaat taagactttg agatccaaat     72720
     cagtataaca gagatcaaga aacaagtcaa ctataagaca aagcgaaaaa catagagatt     72780
     gatataatta cttctcttgc tcaacgagga aagaaggctg tgatcggaga ccaccagaga     72840
     agttaggtga ctgaggagcc gacggaggca cagatagagg cggcggatac gtcacaaatc     72900
     tcccaccacc actaccacca cctcctccgc cgcctccagc accaccacca agtgacgtca     72960
     tcatcatcat cacggctact acttcttctt cttcctcagc tggttgttac cggagaaaca     73020
     actgaataga tagatagaaa agaagggagc tgggcggaga tcgaggaggt gcggcggcgg     73080
     attagtaggg agctaatctg gcacacacaa aggcttttag ttgtagacct ctaaatctac     73140
     aatactcgtc ggtggattgg tgtttttggg cctttatagc tgtgtgagac tctctctact     73200
     cttttctttc ttgaaatgaa tgatttttgc cattttgata ttaccggaca taactcgtgt     73260
     tttttttacc gtttcctgtc cctcttagaa gcttcttact gactcagagg gtctctggat     73320
     acagctggtt ccctcttaat cattgagagg gctacctact tgacctggcc cgcttcgatt     73380
     tatttcacgt ttgttgaatt gatccggttc ggtcttgtaa aaaaaaaatt ggttactcga     73440
     ttagtcaaaa acgctgcgtt tctattcaag caaacaaaca aaaagatgac tcatctgtac     73500
     attgtgtttc agccacagct tacttctgat caaatggctt gcatttggta atgactcatg     73560
     tacattgagg attttctttc atggatattg tatgttttat gtttaacaga actgcttaat     73620
     gcttgtcagg ctaaatattt cgtaaaatat gagaaaaatg gtcatgctga tacatttata     73680
     aggaaacatt caaaccgagt atttgatcta gtgacatcat aatcacaata agcatagaga     73740
     gaaaacaaca actaataata tagatttgat ttcgtcaaca cgttgacaaa agacagaact     73800
     aatattgaac tagtaaggga gagtcagaga gcctcattag ggaaatcatc atctgccttg     73860
     ttccacaagt atggctccaa tcttgaccta atttcttagg gaatcatcac ttgccttgtt     73920
     ttttttaatg aatttagtga tcgagttcca gtacaccact cgtacttaat taatcgatca     73980
     gtgagtttgc gtgcgaccat taccgagttc acaaagccat cagacatgga cgggtgatag     74040
     atttccaaga cctcgaaacc ttttagatca caaggatcaa cgtctacata taggaaagat     74100
     ctaaggcctc gagcactcct aagcatgagc agagctccag gatccatgtg attctccaag     74160
     tgttcaattt actcgtacgt aatttaatta gctttttcgt ttttcttttg ttggcggaaa     74220
     acaacaataa attttacatg tagtatggat gcatatcgtc ataatcgaag ttcacataaa     74280
     tgcatgttcc aactatagag aaacgacaaa gaaatctacc aactcttgga ccaaccaata     74340
     aactaaagtg ttaatctcaa ccaatttagt ttcctcgtcc tttttcttgt tggcgaaaaa     74400
     tagatatatt ctatatacat gtatgtatgc atatagatta tagagattca tatgattaca     74460
     cacttaatta tacttacatg agaaaacaac aaaaaaaagg cctacttatt ggccaattat     74520
     gtataaatta atacatgaaa ctatatataa agtcagttac gggaacttgt ataagctcaa     74580
     taaaaatcga tgtattataa acaaaaatga gattaaaaag tttaaagatc tttattatta     74640
     acatagttca tataacttct tctttttttt ctttttcaaa gtacatagtt catataactt     74700
     tttgatcttt ttatatacca attgcttttg agttttcaga aggaactgaa tgaacgtgtc     74760
     cagtcggacc aaattattgt taccttgttg atgttgtaat gcccaattct tttttttagt     74820
     tatcataata ccaaaaaaaa attaagcaag atttcccaaa gttaggattg ggtaaacatg     74880
     taagtagaac attcaccaac agggaaataa tcatcactcc tacgtccacc actccctctc     74940
     ttggtgatat aacccggata atgactcagc tcgaacttcg atttcttaag cagcttcaaa     75000
     ccttctcctt tacccagctt ctttatcccc caatcgctaa atggatacgt tgtcttgtgt     75060
     gtaatatgga tctctccgtc ctcttccaac atctccttag cgttctcaag aaatcctctc     75120
     actaactctt tgtggctcct gatccaaaac acagcatttt atcattacat cagtccaaat     75180
     cataaactat atattatagt aagaaaatga aagaatatat ttcgttactc gatggcccta     75240
     gaggacaatt cacgaccaaa gaaacgagac cctgcgtgag gaaaattgaa gacaatgcgg     75300
     tcataacgtt gcagactcaa actattatcg aagctcattg tgtgcacgtc aacctcgtgc     75360
     tgaatatcac acccgtatct cttcaatatg tttatgttat ccaccgcatc catatatttt     75420
     atgctcagtt catctacatg taaaatttta ttgatttaag tcaatacatt agttacgact     75480
     agtgatcgat agatgtatat tataaatgtt catataaaat gggttttaca taccttcaga     75540
     atcgagagag gtcgcagtta tgttcatggc cgagccaaaa gctgaagcta gacatagtga     75600
     gaatgagaag tttccttctc caactagaag gattttgtgt gtgctactat agtgtcttat     75660
     ccatttttct gaaatctcca ttacatatct gaagactttg tattctataa accatatata     75720
     tatacactca tatagagtca caacacaaag gttgcttcag tgtcgtttaa ttttgggttc     75780
     attgttaaat tcggctcttc gagttctgtg cgtgtttata tttcgaacct aattgcttaa     75840
     ccctttcata tacccttttc ttgtactaat aaaaccgttt cacattcaat tctactcata     75900
     attaggatct taaatatcgt atttgaaact tcaaattatt acctttaatt cggtatagaa     75960
     aactagttta ctcactgtaa aataaaatat cttggtcatt ctatggttaa accaaattat     76020
     tgccaatatt aaaacacgtg aggttttatc aagatattag tatattactg attaaatatg     76080
     aagttttgtt gttattctca tatttgtttc aggttagctc ttatgcttat ctctaacttt     76140
     cttctctttg tttagaatcg ttttcactta aacttttcct tcatactttt atgcaatctt     76200
     actacaactc ttacactcat acttatagta gactttcatc tactacacac acttgcacac     76260
     atactttcat tttacctcca gacactagac tgactcacct acacaagcag cactacttat     76320
     gcgtagactc caacaactct taattagcta actctttacc aaagcaaaat acagcatttt     76380
     gcttattatt tgggcctgac caagttaatg ccccaataaa acttcttaac ccaaaagcaa     76440
     aacaatcttc ttgttaactt tttttgtgct tcatctgctc attcttgtct gtctcaattg     76500
     taggatcaat caaaggtagt caactttcaa caagtttttc agttgtaata agagtctctt     76560
     tcgcagttat cgttgtattt atttgtgaac aaaacctaac ttactgccat tactcttaat     76620
     aaaatccagg agtttggaat tatcaaatta ctatggaaag catgatcatt gttaaaagac     76680
     aaaaatggaa ttattataac tttttcatag gtaaaaagct ttttcttagt gctgaagtgt     76740
     tttatggatc cgcaactaac cacacattac aactaccaca aaaagtgaga agaaaaaaga     76800
     agcacaatta cccaaggaac aaactcattt tgattatctt cacaaccaaa gataaagccc     76860
     aaaaatgttt tttcaaacct tagacaaaac ctaaaagcaa cttaaagaat aattttgtat     76920
     tcatttactt ttttttattt ttttattttt ttcttttcta ctcacaatag tttttcaatc     76980
     gaaaataaaa taaaattagg ttaatcaaaa aatttttttt atctaacatc gttgttttat     77040
     catactagac ataaaataga caggaaaaaa aacacattgt tttatcatag tgttttatca     77100
     tgcatgatgc ttctaacgat attgtttaga taggcattaa ctagaatttt taatgaaatt     77160
     ttttattctt aaaatgtcaa ataagtccta tattgaaata ttttttaatg gtatactaat     77220
     ttttatatcc ttttcctaaa atacataaga cttttaagtt tgttcaatta acaagtatct     77280
     gtcccctgta atcaatcaaa accttttatc tcagatttaa ttaggaaaag ccacttgtta     77340
     agaagaagga atattaaacg aaaacgcatg tagttttcaa actttaatcc accgagattt     77400
     gctttactag ttcttcaaaa cgacacgcat ggtcccactc attacaaaaa ccaaacccca     77460
     ttatgcaaaa gctctcttct tttgcccaaa ctctcgcttt ccctttttta cacacaacaa     77520
     aaaacaaaag ttctgttatt ttcctattta atccataacc attacacatt tccaattttc     77580
     ctttcattga tcacataact catgccaaat ctacctcatc ttcctcctcc accgcagttg     77640
     caaccgcccg aaacgccatc atgggaaaca ccatcgtctg tatggtatac tccaagaacc     77700
     acaccatgga gaacaccaca gagcacacaa tccacaccag ttggccaaat ggtcttaaca     77760
     aagccagcaa cggttagatt caacggtctt gatgcagagc cgaggaaaga tagggtgatt     77820
     ctccgtcagc caaggagtag caggaccagt ctctggatat ggtgtgttgc cggtttctgt     77880
     tttgtgttca gccttttgct tatctttttt gcgattgcca ctttgatagt gtttcttgcg     77940
     attagaccaa gaatacctgt tttcgacatc ccaaacgcaa acctacacac gatctacttc     78000
     gacacgccgg agtttttcaa cggcgatttg tccatgctgg tgaatttcac taaccctaat     78060
     aagaagatag aagtgaagtt tgagaagctt cggattgagc tcttcttctt caatagattg     78120
     attgcagcgc aagtggtcca gccattcttg cagaaaaagc atgagacgag gttggaacca     78180
     atccgtttga tctctagttt ggtaggcttg cctgtaaacc acgcggtgga actcaggaga     78240
     cagctggaaa acaacaagat agaatatgag attagaggta ccttcaaagt caaagctcat     78300
     tttggaatga ttcattactc ttatcagctg cacgggaggt gccaacttca gatgaccggt     78360
     ccaccaaccg gaatcctgat ttctcgtaat tgcacgacga agaaatgaaa aagaatacgg     78420
     tacagttctc tgagtcagta gtcatcttca aagtctttag ctttggcatg tttattcaac     78480
     tatatttcta tttgcttacc cacaacttgt ataaaagaaa aagacctagt gaactctatc     78540
     caagaaccga gatcggagtt tgtactattt ccaagataaa gaaactggaa agatattatc     78600
     tttctatgaa gcagatccat aattgatcca caagacacag tgccaagacc aatgttgtat     78660
     tttaatacag ttcaacatac ctgaaccacc agagaaaaga attaagacca aaagcaaaag     78720
     aggtacaagc attagatgcc tatgttggtt ccctttagga cttaaagtaa tcaaaatcag     78780
     taaaacacac aagaagaagc ttaaccattt tttagcatat accaacacag aggattttaa     78840
     tattcaaaat ctcaactttg atcaaaaaaa aaaaaaaaaa aaagatacaa tggtctcagg     78900
     aaagaaaagt tgcagaaatt ggttggctaa aaccacagct ggtttcacta gacaggtatg     78960
     taaagctgat tgtatataaa accccacaag tctcagctaa tggggcttta agaaacatca     79020
     catgtctaac ggtagactga aacagggatc atctgaaact cctttcacat tttttactta     79080
     ttttatcaga aagaagtaaa gcaaccaaat ctctttcttt ttttctgtag tccctcaaac     79140
     caacttgcat cacttgatta gacaatacca actttgagta tctagattct agaagaatta     79200
     aaaaatgaac aagaaacttc gcatgtctaa tggtggcatg aatatagtac catttttctc     79260
     cccaaattcc tttttcgctt tccctaggtg ctgtgatctt tctaacgatt caaacttagc     79320
     caaatggaca acaaccttga gcattctctc tattcatctc tcaaagcgta ggtacaaaac     79380
     ttaatatcag gaaaccatat caaaacaaaa aagaccttga ccctcataag ataaagggaa     79440
     atcagtttga aaatggtgaa tcatgtggcg attggcgaaa acattattta tatccttcaa     79500
     tatctatctc tcatttaaca caatcctgat cgagctctta acattattag aaggtccaga     79560
     gaacaatatc caaagcaaat ggaccaaaag aagtaaaaga atcaggacct gacttcttcc     79620
     aatgttacac cctcaaacct cagcaggagt ctttgccaca atagagagag catgtaaccc     79680
     gctcttcaac tcatcttgca acaagtcata tatcagccta tgtctcttga ccaagctttt     79740
     accttggaaa gcatccgaaa cgattcgcaa gttgaaatgt gtttccccat catcaccagc     79800
     actacctcta acagcggcat gtcctgcgtg ctggtaagaa acatcttcaa cttctaactc     79860
     aacaggatct agctccttct ccaatttctc tcttatcctc atccctctac tccctaaagc     79920
     aacaacattt gacccactct cagaatcatc aatcttttct gttcccaaat cctcaactag     79980
     atcaggttta gactccaaat ccacctccgg aacattagct tcgtccttag tctcaggaat     80040
     agacacaaag ctggattctg aactctctcc agaacttgaa tcttcctcac ctttgacttc     80100
     caaatgaaga gcctttttct gcatcagctt aagcatatta agtaatccat tgtttctaga     80160
     aggagacaga ctctgctgca acccgagaag aacagcgaaa tcaggtgtta tcctcaaaat     80220
     ctcagggaca ggtcttccag ataaaccctt gactaataga gcagctaacc ctttagtgag     80280
     aaccgaatca gaatcagctt catacacaac attacgttcc tcatcaaaga aagccctaac     80340
     ccaaacctga gaaacacatc cttctacttt attctccctc gtcttgaatt gagaatcgag     80400
     aggtgtcaga ttcttcccgt agaacataag ctgctcgtat ttagcctttg gctcttgtac     80460
     cgattggaaa agcttgacga tctcttgtag cttcggtgga agctcttcga ttggttgaag     80520
     gtctccatag ctcgacggag atgatgaagc cgatggtgga ggaacaatcc cggttgaaat     80580
     tttctggaaa gtgatgatcg tccggcgaaa ggaaggaact tccgacggtt ttagtggtcg     80640
     tagaagaagg gttttggccg gataatggat tgaagaaaac aaggtccgtt tgaatgggat     80700
     taaacgaagc gaggaagcgc aacaagaaga agacatcgct gctgccatag tcgcgaactt     80760
     gaaacttcga gagagactga gatgatgatg aaagctctcc ttcttcactt tttctgagtc     80820
     aaaaaccaat accgccaatt aggtagtaac cgggaattaa accgggaatg taccaaaatc     80880
     caaaaattag atgtaaaatc aattgtgggg ttgattatga ataattagaa agtatacgac     80940
     tcttttcata aataaggaaa agaaaaagat atctagattt tttttgtttt gttttgaagc     81000
     atcgtcttcc tggttcttcg ttctcttgcg ttcgtcacct caaacacgtc cgccattatt     81060
     atatatcaaa tcaatcatgt ccgaatccag cttttaccaa tgtaagcaat taaattaaat     81120
     taaataaaaa cacttttatc aaatttaatc aaattaaaaa actgtccctt tcttatctga     81180
     gattctattg tttctgtcta cttccacaga aagaaactgc atctccgttt ttttttctga     81240
     tttgaggctt tccttagatc cttgagagca aaactgaatc tgggtaattt taaaaatctc     81300
     atttttacga cttatctctt ttgaacgatc tgttttttca tgtaagtacg atttcacctc     81360
     gagatgatcg atcattgctc ttctggttct tccatgtttg attaaatgtt ataacttgag     81420
     ggttttgttt cttttggatt gttctcgcat ttgttgatct atggttatca aaagagtttg     81480
     gatttacagt ttttggttgc agctgaaatt tttcactctt ttcttctctg ttttgctgga     81540
     taaagttgga tttgattcac attgttgttt agaatctaga tgaagttgta agattccttg     81600
     tattgtgttt gcttatgcat gattgtgata aagatttaag ttattttacc aatgtacaat     81660
     gtccagaatt gtcgtcggga tgggttctaa gtccgttgtt gacatgatcg aagctgcctc     81720
     gcgggcacat ttttctggtt tacacgtgaa tgggcacatg aatgggttgg aaccaagtgc     81780
     acttaaggaa accacttctg catcagaaga tatccaaaga cagccttttg taataggtga     81840
     gttctgcttt tgctttcatt tttgattaat atatggtcgt ggataaaaaa agcttgacga     81900
     atggtcttga ttgatatgtt gtgacttgaa ttggttaggt gttgctggag gcgcacatcg     81960
     ggaaagacta ctgtttgtga tatgataatc cagcaactgc acgatcagcg tgttgtactt     82020
     attaacctgg taattttgtt ttgctaataa agtttcatag agctaagtga taaccaccgg     82080
     tttgatttgt gtttcgaatg tatatgaagt caattgaatt ccacacaatt tagagatcta     82140
     aaaggagaat attaccagct aataacttat atatggctga agtttaacat tgttcaacct     82200
     tgtcaccatt gtttagatat ttatgtcagt ctatttatct aattctcaaa ttcctttggc     82260
     atcatgataa accacaaatt gctcgactta atatcctatg ataatgattt ttggcaggac     82320
     tcgttctatc ataatctgac tgaagaagaa cttgctagag ttcatgaata caactttgat     82380
     catccaggtg agaatatatt tggagtgtaa ttgctttctg taatctactc ttgtcaatac     82440
     atagtgtcat caggagtaaa aaatctttcc tagcttcttt ggccattttt ttttttttta     82500
     taatacttct ttgggataat taaggcataa ctaacagcca tattattcag tgatatctta     82560
     ctaattgatg tattctcttt tattaaagca atttcatccc tgacagcaca ttactagttg     82620
     ctgggagtta tgagaaaaag tcttgtgcat tactctttgt catccaccgt taatttcttt     82680
     ttatccagga ttctaatgaa ttgttgttgt ttctgtagac gcatttgaca cagagcattt     82740
     attgtcttgt atggagaaat tgaggcaagg gcaagctgta gatattccaa aatatgattt     82800
     taaaacttac aggagcagtg ttttcagaag ggtaccacct tccctctcag catcactcat     82860
     tatcatattg ttacttgatg tttataaatt tgagattcct ttttcatttt ctcactgcct     82920
     ctttctgtaa caatagcaat ttcttagatg tcaccactgg cttttatctg gttggggatt     82980
     taaggggaga tcaatttaat cttatttgat gctaggattt tgaaaaacat tctgcaggta     83040
     aatcctacag atgtaataat tcttgaaggg atacttttgt tccatgatcc acgcgtccga     83100
     aagttgatga acatgaagat ttttgtttgc acaggtaatt tgttgcctct tcccgttata     83160
     attattgtaa actcttgttt cgactacatt ccatttccct tttgtagatt cacttggctt     83220
     tttttttcta caaaatttca catgatggaa caacttctta tgctttaaga ttttgctgtt     83280
     tcacattgct tattttgttt tctgcgtaga tgctgacgtt cgtttggcaa gaaggataaa     83340
     aagagatact gtcgagaatg gtagagatat cggcacagta cttgaccagg ttagcccgtc     83400
     ttagtattgt tactgtatat attatcatca agaacaacaa gaaatggttt acctcttgca     83460
     ttttaaatat tacattgctc tgatctgtat gtttttttct catattagtt cggcgttttc     83520
     aaatctatat gtttctaccc atattttata tgatgtcaac cttttgatgc agtactcaaa     83580
     gtttgtgaag cctgcttttg atgacttcat tcttccaacg aagaaatatg cagatattat     83640
     aatccctcgt ggtggggata atcatgtagc tattgactta attgtgcaac atatttgcac     83700
     caagctgggt caacatgatc tctgtaaaat atatcctaat ctctacgtta tacactcgac     83760
     atttcaggta attgatatat caatctcatc tacatacgag taacattctc ttaactacca     83820
     aacaagatcc agaaaattga tttctcttgc agataagagg gatgcacacc cttatacgag     83880
     attctcagac aaccaaacat gattttgtct tctattctga tcgattgatt aggctggtag     83940
     gattattaaa gctcatttaa atggctgacc aaattctcct atcacgtctc atttctgttg     84000
     tctgagtttt tttcttatat ttatcaggtt gtagaacatg gtcttggaca tctgcctttt     84060
     actgaaaagc aagtgattac tccaaccggt aagcttggtg atttttgttt ttgcagtgtt     84120
     gttcgtgaat tcacaagatt attatgtata tatttagagg ttaaactcgt gactaatagg     84180
     tcatagatat cccggttacc tgtctcagga tgtgtgtatt ctggtgtgga tttctgtaaa     84240
     cggttatgtg gtgtctcggt gattaggagg tactttccta tatcttagct ttagtttata     84300
     caataggaac ttccccatcc tttcatatcc cactctctca ccaacttgat ggtgttttga     84360
     aataatgcta gtggtgagag catggagaat gcgttacgag catgttgcaa aggtatcaag     84420
     atcgggaaga tcctaattca cagagaaggt gacaatggtc aacaggtaaa cgagtcactc     84480
     ctatttcatt ccaggtgttc tgtttcatca ctgttgatgt ctgtatcact gtgcagcttg     84540
     tttatgagaa attgccaaat gatatctcag agaggcatgt cctattgttg gatcctattc     84600
     tcgggacagg taattaaccc gtctttcttc atcacttttt actgaaaaca ttttatttca     84660
     tatttctctt tgctgtaata cacatttgtt agccaattca acacacttga agtgcctagt     84720
     gacactgaaa ttatacatct tgtcaggaaa ctcagcggtt gaagctatca acctccttat     84780
     aagcaagggc gtacctgagg gaaacatcat atttctaaac cttatctcag taagctaaca     84840
     cacacccttt gcgtatcatt tatacacccc ttgtgattac tccttatcca tgtttatcca     84900
     caagaatgca gctggattga gatatttttt ttctttgttc aatcaggcac ctcaaggtgt     84960
     tcatgtggtc tgcaaaaaat tcccaagaat aaagatagtg acatctgaaa tcgataatgg     85020
     gttaaacgaa gagtttcgtg ttattcctgg tatgggggag tttggggaca gatattttgg     85080
     cacagacgat gactaggcca ctgtgttcct gcagcattag ttgtcccatc catgtcctgc     85140
     atagcagttt actgatgcat tcaccatcct attctctaca acggctacac aaactatcaa     85200
     aggaatcacc tttaactttg ttggttttcc catttaaacc ccctcaaggt gttgggaaca     85260
     gttttgttta cttataaatg cccaagtgag gggttgatcg atcccgggac ttgggattcg     85320
     gtgtaccata tataattacc cttggaactc ttgataattc atctacaact cttgtgtacc     85380
     atatataaat atccttggaa cccttgatac tccataagca taatacattt ggcttcgaaa     85440
     ggaacatgtg ggccaatggt tgcaccacct ctgttgtcat ctcatgaatt caggttcgga     85500
     cctggtctct ctctctccca agtgggaggt atatgaacgg cccaattatg acaaaaggaa     85560
     agaaaattat atttggcttc aatgtccaat atatctaagt ttggtggtga cttatgttgg     85620
     ttgaagtgtg agagaggtat tatagaaaat actctgctcg ttctcctcca catatccaag     85680
     actttggaga taatgctggt atccttggct agcatttggt agtgtcgaag caatcattcc     85740
     tcgggctctc ctttctaact gcattcctag aaaatattac cctaaaggcc tttgtcttgg     85800
     catcctcgtc ctcttcagca ggaactcatc tgtcttggaa gaattattac catgtctgct     85860
     tttgtcagca aatacgaagg taagtacact taatatgcac tcttctcttc gtgttccagt     85920
     aatcttcagt tctccatttt atgtgctttc tgagttcaga tgagctgatc aagacggcca     85980
     agtacattgc aacgccggga aggggcattt tggcggcaga tgagagcaca gaaaccattg     86040
     ggaaacgatt cgccggaatc aatgttgaga acactgagtc caaccgccaa gcttaccgtg     86100
     agctcctctt cacttcccct ggcagttacc cttgcctctc tggtgttata ctcttcgagg     86160
     aaaccctcta ccagaaaacc tctgatggca aacccttcgt cgatctcctc atggtccgtc     86220
     tcggaaaaag caaactccag ctctagtctt agtcattggg tccaagagtt gcagagttga     86280
     agctcttgac atgacccaaa tggaacttac tgtttcagtt tggatctgat ttttctttgg     86340
     atcaggagaa cggtgttatc cccggaatca aagtggacaa gggtttggtt gatctagcag     86400
     ggaccaacgg cgagaccact actcaaggtc tagactcgct tggtgcacgg tgtcagcagt     86460
     attacgaggc aggagcccgg tttgctaaat ggcgtgcatt cttcaagatt ggggccaccg     86520
     agccaagcgt tctctccatc caagaggacg ccagggtgct agcccgctat gccatcatct     86580
     gccaggagaa tggacttgtc ccgatcgtcg agccagaggt gctgacaggt gggagccacg     86640
     acatcaagaa atgtgcggcg gtgactgaga cggttcttgc tgccgtgttc aaggccttga     86700
     actaccacca tgtcctcctc gaaggcactc tgcttaaacc taacatggtc actcccggct     86760
     ccgacagccc aaaggtatcc aaactagatg ttgcaatccg gttttgtttt ggagtcgttg     86820
     ttttattggt cttatatttt gaaactgaaa ccacaaccaa actgtatcgg tgtgatgcta     86880
     ttttatttaa atttacatgc ccggtcctta cgtaaccaca atcaaatgaa tcacagagac     86940
     atcaatacct cgaaatgcaa cgttaatttg ctacaaaacg ctaaaatagt tcttcttaca     87000
     ggttgcaccg gaactaattg cggaatacac ggtgactgct ctgcgccgca cagtcccacc     87060
     agctattccg ggaatcgtgt tcctctcagg catacagcgc gaagagcaag cgacactaaa     87120
     tctaaacgca atgaacaagc ttgatgtgtt gaagccatgg acgctcactt tctcttttgg     87180
     cggagccctc cagcaaagtg ctatcaaggc ttgggccggt aagcccgaga acgtagccaa     87240
     agctcaggcc aagttcctga ccaggtgcaa ggctaacaag gacgctaccc tcgggaaata     87300
     caccggctgg gcttctggtg actcggccgc tttcgagaac ttggttgtga taggatacag     87360
     gtactaggat cctttgagaa cgggcgtttg cctttgatgc ggtttgagta gatatctaat     87420
     gtttcgtgtg tgttttaact gtttgaatgt tcaattttgc agactgctaa taattgttat     87480
     tttccggtta ctgtcaaact atccatgtga aattcacgtt ttgaaaagct aataataatg     87540
     tttttattgt atgagaataa atttagaaaa ctaaaaattg ttaaggacat attacaagat     87600
     atctcctctt ttcgctttgc tctagtgcac attgttagcc aattcaaaca cacttgaagt     87660
     gcttaatgac actgaaattg aatatgatct tgtccggaaa cacagcggct gaagctatca     87720
     accttcttat aagcaatggg cgtacttgag ggaaacatca tatttttaaa ccttgtctca     87780
     gtaagctaac acacacccct tgtgattact tatccatgtt tatccacaag aatgcagttg     87840
     gattgagata ttttcttctt tgttgaaatc aggcctcaag gtgttcatgt ggtctgcaaa     87900
     aaaattccca aaaataaaga tagtgacatc tgaaatcgat aatggattag acgaagagtt     87960
     tcgtgttatt ccttggtatg ggcgggtttg gggacagata ttttggcaca gacgaggact     88020
     aggccactgt ggtcctgcag cattaggtgt cccttccatg tcctgcatta cattttattg     88080
     atggattcat caccctatct actacaacgg ctacacaaac tatgaagagt tttgtttact     88140
     aataaatgcc caagtgaggg gtcgatcgaa cccgggacac gtttttcagt ttaccatata     88200
     gaattatcct tggaaccctt gatactccat aaaacatcac cacctctgtt gtcatctcat     88260
     gaatccaggt tcaaacctag tctctctctc cctagtggga ggtatatggc cactgggcca     88320
     atgatgacaa aatgcaaaaa aaataaaata catttgggtt cattatctaa aatatctctt     88380
     gtgtttgtaa gttttggttg cacactcgtg tggttgaagt gtgtgtgaga ggtactatac     88440
     aatacactct gcttttgttt tgtacctatc tctttctctt ctccacatat ccaagacttt     88500
     ggggataaag ctgagatcat tggttgccat ttggttgtgt agaagcaatc acccatttgc     88560
     tttatccgag gttgataaat ttcctcgggt tctccttctg acacgtatga caaattctaa     88620
     tagtatattc ctcgtagata ttacctatat attctcaata gttgcaggta cttaaggctt     88680
     tgtcttggca tcctcgtcct cttcagcaaa actcgtctct cttgcactcc aaaaagcaac     88740
     catgtctgct tttgtcggca aatacgcagg taaattcata cacttaacat gcactcttct     88800
     tgttgaataa cttaggttct ctctctttaa tgcgctttct gtgttcagat gagctgataa     88860
     agacggctaa gtacattgcc acaccgggaa agggcatttt ggcagcagac gagagcacgg     88920
     gaactattgg gaaacgattc gccagcatca atgttgagaa cattgagtcc aaccgccaag     88980
     ctctccgtga gctcctcttc acgtcccctg gcactttccc ttgcctctcc ggtgttatcc     89040
     tcttcgagga aaccctctac cagaaaacca cggatggcaa acccttcgtt gagctcctca     89100
     tggtccgtcc ctgaaaaacc aaactccagc actagtctta atcattaatc attgggttca     89160
     agagttgcaa aatggaactt actatttcaa tttggattct gattcctttt tgtatcagga     89220
     aaacggagtt atccctggaa tcaaagtgga caagggtgtg gttgatctag caggaaccaa     89280
     tggcgagacc actactcagg gtctagattc acttggtgca cgttgccagg agtattacaa     89340
     ggcaggagct cggtttgcaa aatggcgtgc agtcctcaag attggggcca ccgagccaag     89400
     cgagctctct atccaagaga acgccaaggg gctagcccgc tatgccatca tctgccagga     89460
     gaatggactc gtcccaatcg tcgagccaga ggtactgacc gacgggagcc atgacatcaa     89520
     gaaatgtgca gcggtgaccg agaccgttct tgctgccgtg tacaaggcct tgaacgacca     89580
     ccatgtcctc ctcgaaggca ctctgcttaa accgaacatg gtcactcccg gctctgacag     89640
     cccaaaggta acgaaattaa ggattataga tcgtttgatg ctactcctta tggaaccaca     89700
     atcaaatgaa tcacagagac ataactctaa aactatattt ctaacaggtt gcaccggaag     89760
     tgatagcgga atacacagtg actgctctgc gccgcacagt cccacctgca gttccaggaa     89820
     tcgtgttcct ctcaggcgga cagagtgaag aggaagcaac actaaatctg aacgcaatga     89880
     acaagctcga tgtgttgaag ccatggactc tcactttctc atttggccga gccctccaac     89940
     aaagcactct caaggcttgg gcaggtaaga cagagaatgt agccaaagct caggccactt     90000
     tcctgaccag gtgcaagggt aactcggacg ctaccctcgg gaaatacacc ggcggggctt     90060
     ctggtgactc ggccgcctct gagagcttgt atgaggaagg atacaagtat taggagcgtt     90120
     taaatacggg tgtcgccttt tatacgattt gaatatatgt caaatgtttc gtaggcgttt     90180
     aactgtttaa atttttatcg atttggttta gcgtctgtgt aatgttctta aactgtgttg     90240
     tgttttttgt gatggtttct ataatatttt cgcgccatga cataacggtt cgttcaaaag     90300
     ttcggtaata tcccctaagt gggtcccaca aggaagtcta tcttcttctt aatcaccaaa     90360
     aaaaagaagt cattttccga aggagagata tttttacttg atattttata attgtaagaa     90420
     tgatctaaaa ctagtttggt tataaatcca aatctttgaa ctatttttga taacattgtt     90480
     catgaattag ggatcaggcg gatgctctta caaaatggat tagggcttgt gcaacattat     90540
     cctgcttatt atgtgaacaa aattgaagaa acatttatgc ttaaaagtta tccgaataac     90600
     aatcataata ttaatgttaa taatcgaaga gaacaaaaaa aagggcgttt atttaggctg     90660
     gaaagtcgaa gtcattgtta ttgagacagc acatgctcat gtgatgaggg tggctcaagg     90720
     gtccacgtga tccactcgct tctgtcttaa gcctctcttc ttcttattct tcttcataat     90780
     ttcacaaatc gttaatataa aaacaaacaa ccaaaacaca aaacaaatca cgcatcgtta     90840
     tcgcgtgtga ctccaaatgc tccagtccca atcggtcatt atcctataaa atagattata     90900
     ttcgagttgt atgttaataa acaatcacaa cattaaaaaa atgataaaac tcacatactc     90960
     taaccaacct ctaatacata cagtacgtca gatagagtcg ttatggaaat atcctacatg     91020
     catggaccag aggaatgagg tacaaaacat caataaaaat ccagataaaa tcgcagtagc     91080
     ctaacatgag ggcatgacaa gctttagaaa acaataattt caattacctc aaacttcctt     91140
     ttatctgctc acaatcgaag atcttatact cacatatttc atgtcatatt cgagttttga     91200
     catggcttgc atacaacttg tttctcgaat taccttcgat taactaattt actatcgata     91260
     taggacaaat gactaagtat attggaatcg tcacatctat ttgacttgtt ctaatctttt     91320
     ttatctagaa attgtggatg gaaactgaac atttctttga taaggaataa gatggttctg     91380
     tatatcaaaa agatatttat aatcagtttg agaagaagaa aaatcatcca taaatccaat     91440
     gataacaggg aaaatgaaag gcaattagat aggagtagga caagaacata gtaaatagtt     91500
     gttaacccaa aacaaaacaa aaaaaaagag gggaaaaata tgacagagaa atgaaaaatc     91560
     ttgattttag taccaagtat ttttccattt tatgttcgac attttaatga gatttataac     91620
     caccaaaatt ggtatatatg tattattttt ccgttaactt gttgtatgct attgacgtta     91680
     tttgggaatc aagaatacag gaacaaatca ctaaaatcta ttgcaactgt agttgtaatt     91740
     gattatacaa aaacttccaa aaaatttaaa gctccaacaa aagcatatat attcacacag     91800
     ctttgtaaac aatagctcac ggtttacatt tgttaccttg ttcctttttt aaacggagtc     91860
     atccgaaaac gcaaatgaac aattagacga accgtgagaa ttgatgattt tctcattcga     91920
     cataaattgt tgtggctctt tgcttccgca accaccagct ttgatcttct ctgtctccga     91980
     tcttccaaca tcaatatgcc ttatttctgt gagcattgcc acaacatctt tcattaaagg     92040
     tcgttcgttt gccttgttgc taacacacaa gaacgcaacc gcaagagttt gaagcatctc     92100
     atgcattatc gagtcagtcc gtccatcgag tctcggatca agaagcctgc taggatcttt     92160
     tttctcagcc aagtgatctc tcacccactt aaccaaatgt gcacctcctg gtagatccgg     92220
     atctaacgga tgctttccgg ttaaaacctc taacaatacc accccgtaac tataaacatc     92280
     gctcttctcg gtaatacgtt gcatcgaagc atgttctgta aaacccaaca aacaaaacaa     92340
     atcaaaatca aaactccaaa cttagttaag tgtacaagta ctttctcaag cttacctgga     92400
     gccatgtaac cataaggagc cagccatcgg aggccgattg gtgggtttcg ctaaatcgat     92460
     tccggtattt ggataaccgg agatggttct agctaaaccg aaatcagcta agtagggttc     92520
     aaagtgagga cccaataaga cattcatagc tttaacgtca ccatgtataa ttgtggggag     92580
     acaatcatgg tggagataag caagtgcatg ggccacacca agaacgacgt cgtatcgcgc     92640
     ctcccaatca acacatcctc cttttccggc gccgtgaagc cgagaactca agctaccgtt     92700
     agggagatag tcgtagaaca agagtttcag attccgatta gagcaccaac caagaagacg     92760
     aacgatgttt ctgtgacgaa tcgatcctag agttttaatc tcggagttaa acgcaccact     92820
     ctcttccttt gaccacattt tcttcaccgc gagtgactcg ccggagggaa tcgttatacg     92880
     gtaaaccaca ccggagcttc cggttccgat cacgtttgct gacgtcagat tcttaacaat     92940
     gtcgtcgatt gaaaaatcga gtttttggta aagcgtcact tcccacgaat ctatttcttc     93000
     tccgaggagt tgttttccgg cggctcttgc ccggactaga gtgtaaaccg ccatgagaac     93060
     aagtacggca gtgacgacga cgagaattaa aatagtcaat ctaacgacgg agctgttcct     93120
     ggtcgtcggg tcgggtcggg tcgagattgc gttcgagatg taaagccctc tgtttgaggc     93180
     gagatcagaa agtggaagtc gccggaaaaa gggcgtgttg ggtaaatcgc cggagaaatc     93240
     gttgtaggag atgttgagag agacgaggtt ttgcaaatcc gttaaaacgt ttaagtttcc     93300
     ggtgagttgg ttgtgagata cgtcgagcac tccaaggttt ttcaagtcgg agaatctaga     93360
     cgggatttct ccgacgaacc tattgcagct gagattaaga gatatcgcca gagacgggat     93420
     ttgacccaat tcgtcaggga tttcaccaga aaagtcattt tcgccgagat tgagaagctg     93480
     tagactccga caagtggaga tttctctagg gatttcgccg gataatctgt tcttggcgag     93540
     attgagcttt gtaagctctg tcaacaatcc tattcccgga ggcagagtac tggacagagc     93600
     attatcggag aaatcgatga acttcaagct ctttgggagt gtagtaccga gcaatgaacc     93660
     ggagagacta ttcgtgtgaa gatcgagaaa ctcgaggctt tcacaaccag agatcgccgg     93720
     aggattgacc cgacgagacg gttctcactt atatcaacaa agttgagatt tttcagattc     93780
     ccgatttccg acggatactt ccggcgagtc tgttaccgtt gagtcttaac cggtaaagat     93840
     tcgtacagtt tccaatatcc ggaggtatga aacccgacaa atcattggag agaagaagaa     93900
     gcttcgtgag gtttcgtaac ccgaatatct cttttgggat ggagccagag agactgttgt     93960
     aagagagatc gatggcttga agctcacgac actgggagag actttgaggg atgtttccag     94020
     ttaacttgtt ctgccatgcg aagaacatgg ttaagcttct taggttactc atcaatgacg     94080
     gaatctctcc tgtgatgaga ttattgtcga tctctaaatg cgtcagcttc gtgcaattcg     94140
     ttagctcttc agggattgtt cctgagatct ggtttacact cagctgaagc tcttgtagat     94200
     tctcaagttt tccgaagctc cttgggatgg tcccggtgag gagattctcg gaaaaatcga     94260
     taagccagag ctcgggacag ttcccaagct cggttgggat tttcccaacg agattgttct     94320
     gccataaaag tagactctgc agcttcttta aacctccaat ggtggtaggg atcgatcctg     94380
     agattgaatt ctgatacaag tagaggtttt ggagctctgt gcagtatcca atctcatccg     94440
     gaattggacc agacaagagt gacgtgtaaa ttgctattgt ctgaacacgt ttcaggtttc     94500
     caatcgacgc cggaagtttc ccggagagac tagtctcagc gagaccaagc attacaagat     94560
     tctcgcagtt acctatctcc caaggaagct cacctcttag attcttgttc ccaccagcac     94620
     gtaagacttg tagattcttg agctctccga tactccttgg gatctctccg gatagcttgt     94680
     tgtcgaaaag cataagctct acgagacccg aaagattccc aatctccatc ggaatatgac     94740
     cttctagatt gttagtgttc agagacagag tcttgagttt cttgagcctg aagatttcca     94800
     cagggatatc accggagaga gaattatccg acaaatcgag taactcaagc tccgtgaagt     94860
     ctccgatctc cttggggatt actccggtga gattcagtga agataaagtg agggaagtaa     94920
     gagacttgag gctccggaga ctagtcaccg gcagagaacc ttgcaagtcc atacctttga     94980
     gctgtatctc cgaaacttca cctctacggt tacattttac gccgacccaa ttgcagggag     95040
     atgtgtcggc gacgtgccag gaggaaaaag cgtcgccgga gatgttcagt tgagacttcc     95100
     atgacaagag agcttgacct tgttggtcga gagagaaaca ggggatgaag aagaaacaga     95160
     gtagggatga gaagaaggag agtctataga tatttggtgg catcggagaa gacgaagatg     95220
     aggaagaaga atgagagaag tgcgttggga ttgtaaagcg aagaaccaat ccatcggttt     95280
     tggttttatt ttgtttatag gaaatatata aataaacaca gagcagagag agaagtagca     95340
     aaggaaggtt tttgatccca acaaagtttc tatcactaac cctttagtat tattttaatc     95400
     tttgcttttg atttttgtaa aattgaaaaa acaattaccc taaatagtcc taattaagtt     95460
     acaaagtagt tcactcttga aatagctgga tcaagtttta gataacgttt tgaaacataa     95520
     tcctgtaatt aaatttggat ttgacttcaa ggaatatacc ttacatagat aaaccttttt     95580
     tatttattta ttggaaaaac atattatggc cgaccaccaa aatttttgaa agtaagaaaa     95640
     taatcaaata ttatgcaaca aaaatagtat gctataattt atatgaaaat cgaaatctga     95700
     gaatcaagaa tgacatgtca aaacaatagc cctcttacaa tggcaccaac tttcatggtt     95760
     ttgagaccga catgtcaaat agtcctcctc tcttttccgc tgctatattg taattgcctt     95820
     ttacgacatt tgcatgtacg aattttgtcg aaatttcact ccaatccact aatcagagag     95880
     catcgtatca tgatcttata acatgtgaac gagaagtgtt ctccacttcg ataaaaggtt     95940
     gcgatcattt ataggtcttg acgtcttgtt ccatgtggcc agttttacca ttaaactagt     96000
     atcaaactgt tacgaaaggt tcaatcacat tcaaacgttt ttttaagagt tagaccgagc     96060
     attacaagtt atttaaattt aactatatca ttaattcata tatactagct ctaacttaca     96120
     aaagaaaaga cccgttaaat ataatgacaa tagtacagcc caaagatggc tgcaacgttc     96180
     accacgaaga atcgaagaaa caaaacttgt ggatcttaaa gcggcacgat gaactttaat     96240
     gcttcttttt ggtttaataa taggtaataa agtgttcaac gaattctcaa cacattaaac     96300
     gcaccgataa ttttaaccaa ttatatccac gacaaaaagt gcttgtgttt tagtagttac     96360
     atttaaatag ggtttctcat agtaagaatt gaagtatcca aatcccttga acttcccatg     96420
     aatgtcgaca taattgtgta actagtaacg aggaaccatg tgtatttgaa ctagaaaact     96480
     gtacatggtt taatcagaag cacttcttgt agctagtaca ttgtgtaact agtaaccaca     96540
     agaaaccatg tatataatgt ggattctgtt tttattttga gagaaaacag aagtgggtaa     96600
     atagtggtta tattaaaatt atttactatt agcgtagaat acagatcatc tactttgagt     96660
     ctttgatagt ataaactagt gataaaagtt gaagtaaaac atggaatctt ggagagtgaa     96720
     attgcacatg caagctagga atttttgtga ctgattaatt aaagaaataa ttagtttaca     96780
     accatgtccc ttgctcatct tgtcggtctt aaatttccca aaaaaaaata ttttttcaaa     96840
     tttgtaattt aattaaaatg agttttatat atatgacaca tgaaaaagaa atcagatttg     96900
     gacataataa taaaaaaata gaaatgattt ttaaatttag ggtaacgggt cgaacaaatt     96960
     ataaaaagat cgaacacggc aacttaaggc acatgacata gagaggtcat gtgcatgtga     97020
     ataaataaaa agtcgtttcc ctacatacca attgaatatt taattttagt ttccctaatt     97080
     gccttaacat tcactatttc actttacgtt atacatctaa ttttctcaag cagccgtatc     97140
     gtagtcggtc catatttttc atacctacaa cgactttctt tcacgttgat cctacacgta     97200
     aaacgaatcg aaatttcacc taacataatc cttttttttg ttataaaaac ttatagacgt     97260
     cgttgtttat atgtacacaa atttaaacgg atataacaaa atcaactaaa tacagcaaat     97320
     aataagaaaa agagagaaat gaatggtaat ggtccattta tggtagggaa aaaaaataag     97380
     aaaagaacaa aaaccaacaa acaagaagga agtaaagaga acaaaaggtg cagaagagaa     97440
     aagacaaaga acctccaact gtacttctgc caaatcagtg aaacatttct ttcacaaatc     97500
     ttattatgat tatcggttat taatggtccc tctccttgtt gggtgacaac accctttcat     97560
     ccaaacatta ttcctaaatt ctctacacca atttataatt tatacaacta ctactgttgt     97620
     atgattacat aggcaaacat tgatgagtct aatagtgaaa gttaacgtta caaaacactt     97680
     tataaccagt ggtttggata tgaaacttca cgttatataa gacatttgtt gatgaagaca     97740
     tttgtttatg aaagagtagt ttatgggtgg gtactcttta ttagtacaga aagatgaaat     97800
     atgtgttaca acgtatacta atagtgtaaa ataacgaaga aatgtttaag tgcggataat     97860
     tgacgaagac aatgtaacaa gatctagatc taatcacgat tcaattaggt cagagatctc     97920
     atcacatgag agagaggctt tgttgaatgg cttgatctgc tccaataaat tatattaagt     97980
     gagaattaat aaagggtgtt acgctggatc taatctagaa tatgatatgg gttatttatt     98040
     tctatagtag aaggttttgt ctgtatactt ttcaatcgga tttaacttgt tttgtctaat     98100
     aataaaagaa tggtcccttg tggtgggaat atagcggcag aagcagtcca agaatgtagt     98160
     ggcagtagtg cagaagtgtg aacagaagtg ggcatttcat ccaaaactat ctatatgtgt     98220
     atattatctc atgatccaat gaataaaaat ttagtatgat atagatttaa tatggatgta     98280
     aatcttgtct atatagagga gtttaccttc tgcatttttg cctggtttta atatatcgaa     98340
     tttggtatta actttaaaaa ttacattatc atatatgcct tatgcaatga tcaaatgccc     98400
     aaaattataa ataaattatc aatgttttag ttattttttc agctttgttt ttcaactttc     98460
     cgcttgaatt cctccttttt tcttttaact tttagttttt ttgtctaacc atgaatagaa     98520
     ttcattaaga cttcagccaa ttaaaaggcc tttttctagt tttctaattt aaacgttgca     98580
     cgaccacaga tttatagatt agagaaagag aaagcatagt actaaatttt gaactgatta     98640
     aaacaataat gtttatgtct ttttaactaa cattgcttag tggagaagat gagcttttgc     98700
     tttcaactaa tattatctct cgctcaaaag cttttgtttt caaataaata tcagaaacaa     98760
     tacgtgtaat gtaaggtcaa atgttcctgc tccattgttt ccgtattttc aggatttggg     98820
     tttcccgctc actaagcatt ataccccaac atcaagataa acaaatagat caacaattat     98880
     aatattttct taccactatc gtacacaaaa taaacaaaca aacacttgga gtttccattt     98940
     tcaagtggaa gtttatttag aatgcttgtc aaagatcttc agcgtgatat acatgtagag     99000
     cctttcgttg tatttcaatt atgataagac tacaagtgta caacatttct atggtatata     99060
     tagcgtgagt acgtagaaac gtctatcatg aatctttgta catgtaagac gacccgtcgt     99120
     gaaacaacca tgaaccgttt atgtgcggca tggtgttaga ttttcgcatc ttgaatgata     99180
     aaattcattg tttatcttgt catatgacaa aaagaattat aatttttcca ttgatttgat     99240
     tatcgtcgat gtgtaaccac tcaaattcag atctaaatat tatatgttat tgataaaaat     99300
     aatgatcaag acataattat tcatcattga taatctttaa ctaaagatgg tcctaaacac     99360
     actgcttttg actgatggtc ccagtttaaa gagccgaaca atcttttatc gggctttact     99420
     tggccaacca aaacctatgt tgcatatact tttctcagca gtaatacagg acagcaaaat     99480
     acacacgtct tattgatatt gtgatcactt gatgatctta atcgggacat gatctaaacg     99540
     tttttttttt tttgcaaaaa caagacctaa tcagcttaag tatttgttac aatgtctata     99600
     ccctaaagag tttcacattg tcacctatca gaacttcgct aacacatttt gggaaacgaa     99660
     tcagtcgaca ccatcctgcg tgggaattag gaaactcatt ttgacatttt cttggtacaa     99720
     tggatttttt cgttttggtt cgggaatcac cagcaactaa aaaaaaaaga acatcaattg     99780
     ggttcttcac taaacatttc cttcacgatc atttatcttt tcgagggatt tcatcaaatc     99840
     tatgttaaag agtataccaa aaaacgcttc gacatctttc tttgtacacc gacaagtatt     99900
     gttctctctc ccagattggc tacgaaagct tatctcccga aaactcttag cgcagatgag     99960
     gtgagagcag aactgaggaa cctcatgcct gatgatccac cagggaagta ggatatacag    100020
     tagtaaacca gcgcaagaac ctgtccatta gcacaaaaag aaacagatac tggagattat    100080
     gagattcagc agaatgcgcg gattttgcga gcagaagttc tcaaaacctc tacaagtata    100140
     tctttcatac agtccaaata gataacgggt gaagacccag ataagtatca ccacttgttc    100200
     gagagtctaa tgtttgttgc taaactctgg agattcgaaa ggttccatct caagaccgat    100260
     tcaacaatga ggtgagttac tatatgatct taaatacttt ggtgaggtcc aatattgttt    100320
     tccacttgct catagcaata tctcattttg aaaaacttaa actcataatt aaagggaata    100380
     tcctaagaat tggaagatga aatgtttagt acctgtaaca ctgagaagag caccgagaga    100440
     atgtagctgt ggagaaccat tgatacgtat atggtaccaa ccatggtagc aatgaaacct    100500
     agggttgaag gaagcctctg gagaagtaca caagatattc aaaagagagg aaggaaatca    100560
     ctcttggatt taaggcatga cagacacaca atagaacagt gtaacatacc tccatcgaag    100620
     acatgtgtgc gagctgattt ttagggccac gaagtgcgaa gaaggatcca atgatgaatc    100680
     cacatccaag ggtgaaacaa atggcaaatt tctgtggcat aagcaccatg actggaagaa    100740
     acattgtgaa ggcaatgaag atgaagaaaa caccacttgc gagaagtaaa ccgaaataca    100800
     tgagcgcttt tcctgaaggc atactacttg ttgctgactg caagctccct ggaatatctc    100860
     taactccttt tgaaaccctg tagtcatcaa attcaggtac attgcaaaaa caacagaaga    100920
     acaagaattt tatcagagaa acaaaagaag attcctgaaa acaactacaa atataaataa    100980
     ctcaatagac ttattcacta actctaaatc cattggtatg caaaactcat aaatgcattt    101040
     cccaaactat caaatctcac aatcaacaaa gtaaatctca atagctcaga ttcactaaca    101100
     cccacttctc actaccacta ataaacctca tcttcttaga ttcagtcacg gaataaacat    101160
     tatgagatga ctaattgcaa tctacttaca cactgaaggt gcccgaaaca gtgtcattgg    101220
     cagatctaac ggcggattcg atatcaaagc cgaagcttcc gccgctttcc tcgaaatctc    101280
     tagaggctgc gtaagaattc caatccgcaa gcagagacga acccgattgc tgctgctgat    101340
     ctacggtgct actcccgccc atcgaaaacc atccttgtga cattttttgg gtttcgggat    101400
     cttcaaggaa agcaaacaat gatagaccag aacgccggcg atcggatatt tttcgttgac    101460
     gttttaaggt tttttggtaa acgccgcagc taaagaatta cttactcggg aagaagaaga    101520
     cgggagaacc gatgctgtaa cgtcgataga agtcaacggc gtcgtttctt aagtaactta    101580
     gctttaccat ttttttcccc gagtaaaacg agtaatttgg aaacttcttg agtgaattta    101640
     aaaatactgg tatggtaatt cccttattaa tccaagcctt aaagcagaac tcatcaagat    101700
     atgtagttcc aagcagttgt tgttacagat ttacaataga aaataaataa tctcacagcc    101760
     aaaatacttc attaacagtc agtgacagga caaatatcat aatactttca agagctggat    101820
     ttcaaagacc agaggctcgt tcgcatgcga tagaaggctg cgtcgtggtc caaactgcat    101880
     ccacaaacac atatgagaga tcatttgaga catacgtatg tagcaagttc attgtggaag    101940
     atgaagagta aagatctgac tacctcctcg gggattggct tcaatgtctc gtttatgtac    102000
     cctactgatg gaggtatcag tgccctacgc ttcccttcat ccgcaaaaga ccattatgtg    102060
     cgagtcatta gaaatatgag attacatcaa aagaccaaaa tcttatttgt tgtttcaagt    102120
     ttttacctcc agctttcatg cccaccaaga cttctttcaa gccctcaatt acctgtcatg    102180
     cgaagcagtt tgttagtaca ggccatgatt ggaacgctat gttatatgca aggttgagtg    102240
     caaatcaaag tacgtcgttt tcatcgagaa taagtttgac aggagagctt tcaccactga    102300
     attgatccac cgtgctgaat caagaaacta tgagagttaa aaagaggatc agatttggat    102360
     gaaagaaact atcaaggcat ctaaagtttt gcatgaaatc taacctatga acgaaatatc    102420
     catttgcacg ccgacacaca tagtttagtt cgaccaggtc cccttcatga gcttctcgtc    102480
     cttcaccttc aattatctct aaaacaagac ttccatgatt agcaaataaa acgaacaata    102540
     ttacaagttt ttgaatgtta tcatcagaag gaacaacaga cagaattcta gcgaaagatt    102600
     agtaccttga tacctcacgc cactcgggag tttcaatgtc ctgcattctt cgatcgccaa    102660
     ccaaaaaaac aattaaaaac taggatgagg aactaagtcc atgcaacaag tagaacaatc    102720
     caataagctc aaagaagctt tcacatattc ctcacttctt tgtgtacatg gcttatcaat    102780
     gcaataaaca agcacattaa acaggaagcc ataaaatatt gcaattcata aactagtaaa    102840
     agattatttg aaaagcagac cagaaatata atcacaaaat catttcaaac atggacacaa    102900
     ctacaaattt tcctcaatgc tagcatctac aattatcatc gacgttctaa cgcaatttcc    102960
     tgaatcaaaa tcaaaatgaa aaaggagttt agatagctca gagaagtacc aattttacct    103020
     gatcacttca ggttccttca tctgaggaac cggcgccgct aaactaggaa aatccagaag    103080
     cgtcaagacc gaaccaaatc cagacagctg cataaacatc cttctgggta catgtacagc    103140
     cgagaccgaa gagaatccaa cacgactaat cctagaaacg ctgttccttg attttcccgc    103200
     gctgataaat aaaataaaaa aggttcaatc tccagcgacc atactctcaa atcgacggag    103260
     atagaaaatt atgagattcc aaaacatacg aatctacctt aaggccatgg atgatccaac    103320
     gaaaggaaga gaaatctcca tagccatcgc catcgccgtc gtcgtcaaca gtcttcttct    103380
     tcttcttcta tggatagtgg ataagaaaaa gagtgagaga tgagattagc tacggagcaa    103440
     cccaccacta aacttagtgg acctgtggga cccacactgc ttatgaattt tgttgtgaaa    103500
     aaaatacgcg ctacggtaac gcgtgaggat ctatttttcc ttcttttttt gtttattttg    103560
     tttattttgt taaatacatc cggttcgatc aaaccggcga tttcaatttt gacttgagaa    103620
     ttcagattag agcatagccg atcattggtg ttgagttctt ctctcttttt tttctagcag    103680
     tttgcccttt caatgctcta gcagtttgct tttacatgtc tcaagattag tagtagatct    103740
     acagatgcga ggagaaaatc atcaacggat ttgttttttt tccacacaaa ggaacaacaa    103800
     aatcttgaaa atgttgagag agattgaaaa caaataaaca tgatacataa tcagaaaaca    103860
     aacacaattc ccaaacagtc tcctctgcta atatgctatt gtttttctca ggtatcttcc    103920
     acttgcgagt gtaacacaaa gctcggaaat gtagttgtga tatccctgca cacaatatca    103980
     gatatcatgg tgttaataat acgtgatgca gaaaaatttg aagttgcatt ggctaaacct    104040
     cgggttagtc tttggtttag gagctcactt gagatactgg agagtcatgt tcttcagaag    104100
     aagaggatgt ctaaaaacta ggtccatcca ctcttcctca tcgatcatcc cttcatgttt    104160
     tgtgtcagct tgcacaaatg tctgcctcat aaactcaaaa atcactcttc acttcatatt    104220
     catcagctgc ttaaacttag ttggctatac tatagactag agtcgaacca aaaaatagaa    104280
     ggaaggaaaa cacaccttgt cgattatact ctctacgatt tcgtctgact ggctcatgcc    104340
     ggacgcagca agagtagcca ccaccagttg tttcaccccc tgcctttcga taaaaccttg    104400
     ctgcttaaga tcatatagct gaaacgaaac tgccaaataa tgttccaggt aaccgttaat    104460
     aagctttcat ggaatatata taggtagcat gtgaacagtt tgtttgtaga tggttaatat    104520
     atcgggtcta gtttttgaga tcagagacgt acggtcaatt ttatcatcta taggagcaga    104580
     tggatgaaag acagagagag ctcgggcaaa ctcctcaaac ccaagtaatc catcatgatt    104640
     tgtgtcgaac aaatcgaaga cctgtgtgat agggtaatgt cattgtttgc aaatggatta    104700
     caaagacttt ttttgttgag aacaaaaata aaataccctc tctgaaaaca agctctcatt    104760
     tttgtcagtc tggaatatgg ctacatgaaa ctgttcctga tacaacagaa atacaacagg    104820
     acacgttatg gaaaatctgt aagacttgtt gaaaagaagg agtgcgtggc aagaaagaca    104880
     tatatattta tatataattc caaatacctt gttcatttca ccataataac acgttacgcc    104940
     ttctacaacg ttaccctgaa cgaagaaaca cagatttata tcatatgcgt acttagcaag    105000
     aaagttacat ataatttata cgaacctcgt ttctttggca atcaacaccg ctgagtttct    105060
     taaacacctc atagagtgcc tttcgctttt tctgatccgt aaagcatccc gtggagttgg    105120
     aagaagctga atttcttgtt gaatccatgg agagtcgtgt agatagaaac tttttagcca    105180
     agaaagagag aacaaatcga tgatcaaaaa aagagattgt caacgcgctc tgatacctat    105240
     tcagatcttt gagacaggga aaacatatat attaggaaag accgaaagag taagtaattt    105300
     attcctcaaa gtaaacgtgt ttatgcagaa cacaatcgtc actaactttg ctaattactt    105360
     tgtcaactct aactgacaaa gtcaaccaca agactaacaa atccgattgt tgtaatgttg    105420
     catccggttc gatcaaatcg gtgatttcaa ttttgacttc agaattcaga ctagagcata    105480
     cccgatcatt tggtgttggg ttctctcttt tttgctctct attatcactt catcagtttg    105540
     ctctttatta ataggattca tgtctcaagg ttagtagtat atctacagat gcgaggagaa    105600
     aatcagcaat caaaatcagg agtagcaaaa atacagattt gttttcttta cttttaattc    105660
     acacaagtaa caacaaaatc ttgaaaatgt tcagagagat tgaaacaaat agacatgata    105720
     cataatcaga aaacaaacac aattcccaaa ttgtctcctc tgctaatatg ctattgtttt    105780
     tctcaggtat cttccacctg cgagtggaac acaaagctcg gaaatgtagt tgttatatcc    105840
     ctgcacacaa tatcagagat cggtgttaat aataacacag aaaaaattgg aagttgcatt    105900
     gcctaaacct cggataagtc ttggtttagg aactcactta agatactgga gagtcatatt    105960
     ctttagaagg gaaggatgcc tgagaacaag ggttctccac tcttccttat cgatcctccc    106020
     gtcatgtttt gtatcagctt cctcaaatgt ctgtgaaaga agaaacttag aaaccactct    106080
     ttactttatt ctcaactgct atcatgagtt ggctatacaa cagtggaaca agaatatagt    106140
     atcgagcagg gtaggaagga accacacctt gtcgattata ctctctatga tttcgtctga    106200
     caggttcatg ccggactcag caagagtagc caccaccatt tgcttcacct cttgcctctc    106260
     tatgaaacct tgctgcttaa gatcatatag ctgaaacgaa actgcaaaac aatgttcccg    106320
     gtaactgtta gtgatatttc atgggttaca tgtagcatgt caacatcaga taaattgtat    106380
     agatggtttc tcagatcaac tttgtaagat caaagacgta cagtcaatct tgtcttctat    106440
     gggagcattt ggatgaaaga cagagagagc acgcgcaaac tcctcaaacc ccagtattcc    106500
     attatgcttt gtgtcaaaca aatcgaatac ctgtgattgg tactgtcaag ttatctttca    106560
     aaaaggatct tggcaaatgg ataacaaagt cttttgatta aaaaagaaga acatacccgg    106620
     tctgcaaaca agctctcttt tttatttgtc ttgaacaagg ctaactgaaa ttcttcctga    106680
     acgacaagac aggtcaagga aaatcagaaa aggatgtcca aaagacgtag caatatgcat    106740
     gattcgtgag gagtataagt gagtggcata aaagacatat aatgatgccc ttccttcata    106800
     ccttgtttat tagcccatca tcaatcacag cactgctgat tttcttaaac agctcataga    106860
     gagcctctat ttcactcacg ctaactgcac ccaaacgagt caatgatcaa aacacagaaa    106920
     gaaagatttg cattcctctt aacagagagc atcaactaga gtaatggcaa gcctttgaat    106980
     catacatata actggaaaaa aaaagtgcat ggaagttaaa ataagatgga aaagaagttg    107040
     agagcataca aactgtctct ctcgcaagaa gttcagggtc accaaggcct ccagattgtt    107100
     tgtaaatatc gatatcaaaa caccggaaaa aagaggagca tacatgcttg aaaccgtcta    107160
     tgcactgcga catgatatat cttgtaaatc aaaactctcc atgcctgtta aataacaata    107220
     aaatgtaaga actttcgaac cacttggaag aatctaaaga catatgcatt tgaacaagat    107280
     aagtaccttt taaccatttc ctggttcgtc aaataggcaa tgctttgtac acctcaaaaa    107340
     attctgcgat gggaaggaaa tgagatatag tcagttatta gctcatcaaa ttgcaaaaca    107400
     gttaaagaag aattgacagg agcaaacaag attcatcatt ctcagatcag atctgaatta    107460
     gactaaagca ccagatacta tgaaacacaa acagaggaga cgcatattat aaacggtcgt    107520
     aaactttatg cattaatctt aactccagat tcatttccag attaaccaat gtattcatgg    107580
     attaggaact atctttaagc taaaacacga aacccaaatc taagaaacag ccccaaaaaa    107640
     tacatgaact aggataaaat gaggaatcaa aaacacccaa tttcacgtca gaaatgcatc    107700
     atgaattttg cggggaaaaa aaatgcatca tgaagaacat aataaaacta tccagacgga    107760
     ttaatcgtca gaaaatataa tcctctgagg atcgacacct gaatctaatc gcgatatgaa    107820
     tcagagaagt gattaagcta aggagaaatg acggatatga gaaaaagcga tccaatgagt    107880
     tttagattcc aaatcgttcg gattcagaga tacaacaacg atgaatctcg ttatataaac    107940
     ttggtaatca gctcatggat ctatcagctt gcgaagaaat tagttgcttg attctcaatc    108000
     tcaaatttta acttgtttcc catcgcgatt ttcccggaat aaacacacga gattacgagg    108060
     aagcgaccga ccgcgaaatc gtagaaaagg gagaaagaga agaagaaaaa gccttacgcc    108120
     acggcggatg atgagccttc cttgcggcgg ctccggcggt tgaaggtgac ggtggttgcg    108180
     gtggaaaacg cgaaaaaagc tcttattggg taagtgagag aaaaaaggtc gacacgattt    108240
     tctataagca gaatgaatat attgcaaaat tttaaatatg ctaagaaaaa gaccaaatta    108300
     tttttgtttg ttggcgtttt tatacttttt aaatttaaaa aataaataat tttgtttatt    108360
     tttactcgat gttgatacag ttgtaataaa actccttgtt acattcactt tcacacgtcg    108420
     tcgtctagtg gagcatgtgt ccatttatgc gctgtcttaa acaccatcgt ttcaataatc    108480
     gttcctatac gacggcgtgt catgttattc ggattctgac tgttgctttg gtctgatttg    108540
     gtctctgggt ttgaattcgg tttaaattgt ctttggaaaa aatattatag caaaaaccag    108600
     tataagctta gttacattaa ccaacaatta aaactttgat taatggtaag agagggacaa    108660
     actctactgg taaaacaaca gattgatcat gttttttaac ttttttttta ggtaaaatta    108720
     cagttactgg tgagctactt tgtacacaag aaaaaaaaag gaatgataac gacattcaca    108780
     caagtaaacg tgtttaggcg gcaacagaaa aaaaaaaaaa cacatatatg gtacttggtc    108840
     agagattcaa tcttgtgact catgtattgt tttgattttt cagttaggga gatcttgttt    108900
     gcaaagagga caacacgaga tgatacgaag ccattgatct acgcatttga ggtgaaacct    108960
     atgcgaacat ggaagctttc tcacttcttc tttctctttg tactttgcca aacatataca    109020
     acattcctgc aataatgaaa ccggtgggtt tcagttttga tatcaagatt gatttctgac    109080
     tatttgacct atttcagaat tcaaattagt gcttaccgga tcattgtttg cttgagaaga    109140
     atcagaagtt tcatcaatga gtttgtattt ccaacttggg agactggaga tctggtcatc    109200
     tgaagctcct ttttccgaag atccaacgtt catgttgtag ccgaggaagc tactaacgag    109260
     aggtacaaca caacagagca ggaggaagag aagaaatggg aaggagtaac agagagcgtt    109320
     ccaagcgagt agggagatgc agaggacatg aaggattgga gcatagtgga aagaaccaaa    109380
     ccgagaatca aaaacccata cattacctat cacaaaccat atcgcaaaga atagctccag    109440
     cgatgtccgg catttgttca tcaaatgcga gcacctaaaa cacacacaaa aataagtcat    109500
     tttcctagaa atctttgcat tttatgatca aacttgaaaa aactagattt ttgttagtaa    109560
     cctggtggtc tcttccctgc ttctttgttg ctgctcaata tcgccgaagc taaatgcatt    109620
     ttcatggcta gtatcttgct gacgataccg accgtatagt aacataagat tgagcagaca    109680
     tccaacgttg tagccagtga tccataacct catcggccaa acaggcctct cgtttttgga    109740
     caaagctagt gtggatgtta tcacagtgat ctgtaaaagt aaagcgatga gctctgatac    109800
     catccaagcg atagaattga aaggattggt gccaagatcg gatcttgagg cgttctggta    109860
     atgaaagact cttctcaaga aaatgaacca ccttgctcta gataccctca tggcaagtct    109920
     catgaagaag gaagaagatg gagagctctc cggagccgtg tgagtgttat catccagttg    109980
     cgtggaagcg aaggaagaag atgaggagac agtgatggag ttaatggctg atgattgcaa    110040
     ctgagaggaa taacgggtac tcatatcgga aacagagagg tctttgattt gatctcctga    110100
     acaagagcaa agagaaacag agtaaagctt gagctaaaaa gccatgaaaa gtctttaaaa    110160
     tatgcaatta aagtacatgt aaaaaaaaag acatggatgg atatatcagt gaggcatttt    110220
     catcaaatac cttatcttca ctctgcgaaa cagagcaaca taccaaaaag tgtaggtttt    110280
     ggtgtgaacc cagcagatgg agaagatttt ggtaaaaaaa tagtgaagat agaagagatg    110340
     aagaagaaag gaaggtgtag tgatattgtc agagaaggtg aagttggccg tttgatagtg    110400
     acgtccacaa atggattttt gcttaggatt gaagaatgca gaagaagcag agaagtagga    110460
     gaacataaac cgttggccta taaaacctaa caaccttagt tttttgtctt cgaagcaaaa    110520
     ctccgacagc aaccgctgct gctttatcta ttctcgtttt ttttttggtt agacaacgcc    110580
     atctctcctc cctctctccc tctctccctc tacgcaaagc caaatattta taagaaaatc    110640
     attaaacata aaaaaattca aaatccagta ttgggccggg ttgggccgcg taaacgggta    110700
     tccaaattag agggtcgttg aactgagtct gactcactga gttttgtgat cgagtcaaac    110760
     aaaggtgagc ttgggaaata atggcgtagc tctactagct caagtttgag ctctcccata    110820
     atgagtacat caagcttgtc ctccatctcc tgcctcctct ggagatctct ctcatgatga    110880
     cttcgaaggt ttgaaaaacc taactatgaa tcttaggatc tgattacgtt tgacatgtac    110940
     gttaaattgc acaatttagg agttttcctg agttcaatag aaggtgacaa atttggttct    111000
     tgattgcttg aaattgacag gaacggaagt tgttcacaga tcttagtgtt attcaattag    111060
     aaaaagatgg aaacttttag ccttgttttg ctttgtcctg aaattatact ctctttgatt    111120
     gaaatttgtg ttagagctat catctttggg tgttcttaat ttgcaaacca ttttttactt    111180
     tatcacttaa actctcacaa agtctttacg cattattatt attatggcca ccaaacgact    111240
     ttgcagtaac tgtccctcac ctgcaggtat gagaaactac agagataatg ttaaactgca    111300
     acaaggtttt agaacaccgg gcagccctta gcgacgatcc ctttctctgt tgggcaattt    111360
     gccaaagggc aatggtctgt gttctcattc ccccaccaat ctggtaagct tatgttattg    111420
     ttctgtaacg caaagtagat caacactccc ataaccgcag tgcctgcatc aagagctgca    111480
     gagaggatgt agttatgcct tgcccaccat cccttgtacc tcctgaagat atagtagttg    111540
     aacacgatcc caacagcgaa ccacgaccag taatgcacag ccttggccat tggcatcaca    111600
     ttagcccctg agaagatcaa gggaatatga atctgatgta tccacttctt ctccgggaat    111660
     ttccttgcaa agaaccagac cgggacagga gcaaggaagc caatgaggaa gaaccagttc    111720
     atcccggggt atataccttt acttgtgaac atccttccag gaccgatgat tccccaaatg    111780
     atcgacgcgt tgtagaacac tacatcccca gggcaagtcc acggactact ctttgggagc    111840
     atatctgtgt tacagatgtt ctcgactgaa gaaagcaacc accatgtggt cccgaaggag    111900
     acagttgaag caacaatagt cgcaacgagt tgaacgatga acatagatct cggaggaatc    111960
     ttcatgtagt ggccaagttt gaagtctccg acaaagtaca aggcttgagc tatactcaca    112020
     gaaccataag tcttaaaagc cacattggca agtggctttc ccggatacaa gaacccgatg    112080
     atcagttccg atataacatt aagacccatt cgctggtttg tggtcgctag gataactcca    112140
     ataggcaaag tgaaggtaaa ggcgatggca caagcgagta aaagtcccca ccatgggagc    112200
     tgaagctgtt tgccaaatcc ctcacatgca taaagagcta gcacaaagga agcagcgaga    112260
     accgcaacga accaccattg aggtacttcc ttataattct tcttcatcaa tcttgtatgc    112320
     acatctccaa acttgtcctt tgtcgtcaat gttgccttct tccacagctc ccagataaac    112380
     cttcatgtaa acaaccacaa caacaacaaa aaaatatttt tcatggaaac tgataaattg    112440
     atctatacag tattttgaga cgcagagtag agaaaaaaag aaaaaaaaaa gaatcttact    112500
     ttccgtcaaa gagggcgaca tgagaaatgg ttgcggtaag ggtaccgaag ctgagcccat    112560
     agatcagagc aaacagaatg ctaaggtaaa gcttgctata gctttcgtaa gcaggaagat    112620
     caatattgaa tgttttctgg ttgaggatac gagtggtgtt gtaacgctga ccagtgtgat    112680
     caaatgggtg agaggtatag aaaggaaact tctttgcctc gtaagcgttg ctccagtaga    112740
     agataggaag gatgatgtag aagaagatga taaatccgcc aaaggaattg gctatagcga    112800
     agaacggtac agctaaagga ctgcctaaga aacctgcaac cgtggaccaa tcaagaccaa    112860
     atgagccaat gccgagaccg tgcagccctg aaccgatctg ttgagcggtt acagagcggg    112920
     tccatatcca gcagacaaag gagagatatg agatggaagg gaaaagatag cctgggacta    112980
     tgtagtaagt gaagctcagg aagaagacta tcaagaagaa tctaagtttc gtttgttttc    113040
     cttcacgctt ctcctccttc tcatgtaagg ctctaatcca tcaaaaagta aaatttcgtg    113100
     acagttacaa atgtgaatga tttggagaaa aaaacacgaa cctaaagaga gagacttgaa    113160
     caagatttgc aggccaccac atgtaaggtg agtccactag gtatttcctg aacatacccg    113220
     cccatccata tcccaacaac tacatgacag ataaataatg taactgttac aaacaaaaac    113280
     tatgtaattt ttgaattata ttgtatattg tgtatacata cctgagtggt ttggacaagc    113340
     aacatggcgg cggcgggatt gagattccgg tgataaaatg ctttaacgat ggttaggatg    113400
     ctggtggcat aagctcctcc agctccggta ttagcgaata tagtgatcag tacatgttcc    113460
     ttcatgttga atggtccagg gttcaacgaa cacgaccaat ttgtaccagg taaacggagt    113520
     tttgttgttg gtagagtcgt ggccatgagc tttcctagag ggagagtgat gatctgagcc    113580
     acgactgaag ataccgtgag cgggttcgac cggtaaccga agaaattgtt cacgaacgcg    113640
     agtaccacgc aagaaaccat tcctaagaac catgtacgga atgtcaaaac tggtagagat    113700
     ggatcgtcgg ttatcggtac ggttaaacgg acctcttcga ttggactgtc gttttcatcc    113760
     tcttcttctt catctgcccc agggacaaaa tcggtttact cagaaccaac caaagttgct    113820
     tagtatgatc tacattaatc taaaggaatc gagttgtgtt taagaattat acaaatagag    113880
     catcagccat aacggtacac aaggaatcaa accacatcga accaagattg gtcaaaacag    113940
     aatcgagatt ttatttaccg gctatgacga tcttggactc aaccttgtgc tctggaggct    114000
     tggatacttc gagagagcct accattttct gttaggcggc cctgacgtcg atcgactcgg    114060
     gtgataatgt ccagagttct gaataacttg ctgtagaagt aatgttcttg taagcaacct    114120
     gtgttaatga cctgacatta aaaataaatt ttctctgcaa tttttccagg aaaaaggaaa    114180
     aagttagacc tctgttttag ttaagatgtt tgagaggatg tactagtatt agagaagata    114240
     caagagagta tttcctctaa tatgtattgg agtgaagact gaaagaatca tgatttctcg    114300
     acgaatttct taatatcgac aagtttactg aactcattag aactaaagtt gttgattcac    114360
     tttcagtgga aaaaaaactt tcacttcggg gtaaaaagct aaaatcttga tttcgagtat    114420
     gaatgtagat tctacatctg gtatgttttt gaaataggta cttaaactaa aagaataaac    114480
     agatcataaa tatagcaatt tttggcattt aatcatttag agatactgga tctagcaatt    114540
     tgtagtgtat tccgtctata gctttcaatt attcacttta cttctctggt ttgaaagaga    114600
     caaaaatcag tttacagaaa gtagactttc tatatagaaa aaagagaaag aacttatcaa    114660
     aaatagttta tacatacact ctcattcaaa gtaaaagatt aggatagaga gtaaattaca    114720
     aaaagaaatt gagcattaca ataattagcg gatgttgata ataaaaagga aataattgaa    114780
     ctagcaagag acaattttgt gaggtaagag ttgcaattta attggcgatc acttgcagca    114840
     gctaaaaaca aaatttttag cgatagtgac agtcttaatg cattatgcat gtaattggtt    114900
     cgtacgtgta tacttgctgg tgcaccgctt aatagactcc gaatttgact cggactcttt    114960
     gtgcgttgga cgcgcgtcac aggtgtgtct ttcggtcttg cttgtggtcg caattgtatg    115020
     tatcgttgtt tttgttttga ttgccaatat gcatcattgt ttccataatc tatcggttat    115080
     acaatatgaa acgcatattt ccacttttat tcaagtttct gtttctaaga cacacactgt    115140
     cttattcaat ctgtttcatg tcaacgtcta tgactaggtt ctatgtgtta taaataactt    115200
     gcaacttcac caaaaacata atacattttt ttttgacagc caaactacat atatatcctg    115260
     caaatgataa tatttcaaat tctaacacaa ttttacaaga aatttcaacc aatcaatcaa    115320
     attatttttg gtagttggaa ttaaaattca ccaaaaataa attcgtgttt tcattcttaa    115380
     agaagaaaca gaatcgttta gaactgattt tagaaaatta cgtgattcat ttcagttttt    115440
     gttatcaaca tcactagctt caatcatgca tgggctgagc atgtaacgca ggtagagatg    115500
     tcaaaatggg ttaaaattca tgggttaact caactcaatt caacccatga actctaatga    115560
     gttgaaaatt ttgactcaaa tgagttaatg ggtcaaatga gttgatgagt caattggttt    115620
     gatgagtaaa atgagttggg ttgtaatggt taatgatttc aatggtttac ccaattaacc    115680
     catcaagttt tgtaaaattg aattaaacca actaaaattt ctaaaccaat gccaatttaa    115740
     gtttaaccaa cacatttaaa ccaatttaat aaaattaata tttttccaaa tttcttaaat    115800
     atacaagcga tgaaattgat aaaaagtaaa ctcgtaattt ttcactaaaa agataaaccc    115860
     gtgattttcc cgccaaaaac gtaaatccat aattttcccg ccaaaaacgt aaactcgtaa    115920
     ttttccagcc aaaaacgcaa atccgtaatt ttcccgccaa aaacgtaaac tcgtaatttc    115980
     ccgccaaaaa cgtaaacccg tgattttccc gccaaaaacg taaatccgtt attttcccgc    116040
     caaaacgtaa actcataatt ttcccgccaa aaacgtaaat ccgtaatttt cccgccaaaa    116100
     acgtaaactc gtaattttcc cgccaaaaac gttaacccgt gattttcccg ccaaaaacgt    116160
     aaacccgaga ttttcctgtc aaaaatgtaa acccgtaatt ttcccaccaa aaacataaac    116220
     ccgtaatttt cctgccaaaa acgtaaacct ataattttct cgccaaaaac ataaacctgt    116280
     gatttttccg ccaaaaacgt aaacccgtaa aaagtggaat ccgtaaatat tttaagtttg    116340
     atgataatga attaataata ttaattattt attattgttt tataataata attaattaaa    116400
     ttattattta aatgggttaa cccatttaac aattcaatcc atcaaattaa atgagttatg    116460
     ggttgaccca actcatttaa catctaaact tatttgatta agagttgagt tggattaccc    116520
     attttgaaac ccctaaacgc atacatcaaa taacttattg aattatgttt ttataggttt    116580
     tatgaattca gtggctcgat aatttattag gctgacaaaa aataagttcg actacagccc    116640
     attagttagt attagtcagg cccattagtt agtatcaatc aagcccatta agcaactttg    116700
     ctcatcctcc atctttacta gattcttcga ccttgcttct cctacctctg caattctgct    116760
     aaaccctcac ggcgataaac cctaagttgt aaaaaccgta tccatggctg ctcttacgcg    116820
     taacaagaag aagggttcca attcacagac tccgccactg aataagcaga ctaaggcgtc    116880
     tccgctgaag aaggcggcta aaacccagaa gcctccattg aagaagcaga ggaaatgtat    116940
     ttcggagaag aagcccctca aaaagcctga agtttccaca gacgaggaag aagaagaaga    117000
     agagaatgaa cagtctgatg aagggtctga atcaggttct gatttgttct ctgatggtga    117060
     tgaagaagga aacaatgata gtgatgatga tgatgatgat gatgatgatg atgatgatga    117120
     tgatgaggat gcagaaccct tagctgaaga ctttctcgat ggtagcgata atgaggaggt    117180
     aaccatgggt tctgatttgg attctgactc tggtggatcc aaactcgaga ggaaatctag    117240
     agctattgat agaaaacgta aaaaggaggt acaagatgca gacgatgaat tcaagatgaa    117300
     cattaaggag aaacctgatg agtttcagct accaacccaa aaggttacat tttcctttac    117360
     ttaattgtgg atttgttcat attctggatc tctggagcta tttgttagct aatcttttct    117420
     attactctac attgtttagg aacttgaaga agaggcacgt cggccgccag atcttcctag    117480
     cttgcaaatg aggataagag agagtgagta acattttcaa attttattcc tttttaagaa    117540
     ttctggtgta atgttattat tatgattgtt ttaaatctcc taaggaatca tcctctcggt    117600
     tcttagttta atggtactaa tttgtgtttc agttgttaga atcctgtcga attttaagga    117660
     cttgaagcca aaaggagaca agcacgagag gaatgattat gttggacagc ttaaagctga    117720
     tcttagttct tactacggct ataatgagtt tcttattgga actttaattg aggttattcc    117780
     ctagtctctg actttactct ttatgcttgc tttgatctag agttatgtgt aggaattctg    117840
     ttacttatac tctttagttg taatcttctg gcagatgttt cctgttgttg aactcatgga    117900
     actaatcgaa gcttttgaaa agaaaagacc tacatctata cgtactaaca ctcttaaggt    117960
     gaacttggtt gtgcattgga gtgtctaaaa caaagtattt ctcagctgtt gtgatatttc    118020
     aattaatgct gatgtttgtt ttggttaaga ctcgaagacg ggatctggct gatatacttt    118080
     tgaacagagg agttaatcta gacccattaa gcaagtggtc aaaagtaagt agtatttgca    118140
     gattgtcttc cattttattt gcgaaaacat ttttgtggac catctttagt tgatcctggc    118200
     ataatatttg taggttggac ttatcgttta tgattcacaa gttccgattg gtgcaactcc    118260
     tgaatatttg gcaggattct atatggtact tgattttctg attttttttg tacttttcgg    118320
     ctcacacttt atgggttttc ttattgttta cttaagtatg ttcttggtac attttcagtt    118380
     gcaaagtgct agttcgttct tgccagtgat ggcccttgct cctcgagaaa aagaacgagt    118440
     tgtggacatg gcgtaagtca ttatcttaca taaatgcact atatttgtgt ctcagataaa    118500
     tatatatata tatatatgat gaccaagcag taccttaatc tgatattcaa gtgtagcttg    118560
     tgatatgtat catttgttat gattgttgtg atgataagtg ctgtcaaaac ggaaaagcca    118620
     atttgattgt cccgtgatgt gagacatatg caactagtat attgtgatat ctgtaacaag    118680
     ttcttatacc actgcagtgc tgcccctggt ggtaaaacaa catatgttgc tgcactaatg    118740
     aaaaatacag gtatacatat attggttcct tattcctcca gccccataat tttagtcagt    118800
     tatatctaat gttataatgt ttatataacc aggcataata tatgcaaacg agatgaaagt    118860
     acctaggctt aagtcacttt ctgccaatct acatcgcatg ggagtgacaa ataccatagt    118920
     ttgtaactat gacggacgag aggttagttt cttgaacctt tattcttctg ttgacggtac    118980
     atgcttgagg atgttaaata ttgcaaactg gttgtaaacc atcagctcaa ccaaattgaa    119040
     aaattactgg caagactgta attgcaccaa ataacaaagt tttaaagaca gcttctctat    119100
     tattcccttg cattttttat ttatctcatc ttctttgcct ttcagctaac caaagtttta    119160
     ggtcagagct cggttgatag agtattgctg gatgctccct gcagtggaac tggagtaaga    119220
     aagtttggac catacactct tatagtcttt taagtgaatt tctctgttca tagtttaatg    119280
     tcacttctac acaatgcagg ttatatcaaa agacgaatca gttaaaactt ccaaaagtgc    119340
     tgatgacata aagaaatttg cccatttgca aaaggtatgt tgttgcctta aacaatatca    119400
     actaaaacat tctttacatc caagacaaat atttaaacat gaaaatggca taaacgccgt    119460
     ttataccctc ttactgtgag tatataaaga aggatgcatt tggtatataa tgctaaccat    119520
     actctcttct tttcttgcgc atagcaactt atacttggtg cgattgattt ggtagacgcc    119580
     aattccaaaa ccggtggata tattgtttac tcaacatgtt cagttatgat acccgaggtt    119640
     ggtgaaccat actttttctg ttccactatt tttttttcct ggcatcttca tgttttctca    119700
     ctagttctat ttgtacaaca aattatgcag aacgaagctg tcatcgatta tgctctgaaa    119760
     aacagggatg ttaaactcgt tccatgtgga cttgattttg gccgaccagg gtaatataca    119820
     ttttcatctg cattgaaaaa tttcatgatt cgtcatctga acacaaatgt tttgctgcat    119880
     atcttcagat ttagcagttt tagagaacac cggttccacc cttctttaga gaagactaga    119940
     cgtttctatc ctcacgtgca caacatggat ggattctttg ttgcaaaggt atacacttgg    120000
     ttaacctatg aatagctttt ccctgcaaaa cagatgtttt ataaaatatg aatagtgatt    120060
     aaaccaacga ggtatttact ttttcctttc tttgttctgc agctgaagaa gatgagcaat    120120
     gcaatgcagc cttcaggaaa tgatgagcca gctgtaacaa tggagcaagc tcaggtgtcg    120180
     tctagtgatg atgatgatga gaaagctgag gccattgagg agttggagaa gccacctgtt    120240
     gccagtgggc aacccaagag agagagtaac actaaagaag acacgaacaa acgaaaaaat    120300
     ccaaggtcaa aggaaattca caaaggcaaa aggaataaaa acacaaaaac cgaaagtggt    120360
     aatgtggaag aacccaggaa gcaaaagaag aagagatcac aatggaagaa tgagattgct    120420
     caagctaggt aaaaaaacta agtgtttcct tgacagacaa aagagaaaac cttcttatgt    120480
     acattgttgt atcatacacc catttaccca taaatggttg aatatgttgc agggaagaaa    120540
     aaagaaaaac catgagagag aatgctaagg agacgccaaa gcacagggga taagaatagg    120600
     tttgagatcg tgatgcatct tgaagagtag aatatttcgg tgttctggcc atggcgaagg    120660
     acacaagaaa agaggcttca ttggctgagg ccaaggtatc tatacaatgg ctttctagtt    120720
     ttgattaatt tactgcgtaa agaaagggtg acacccacat ggattagctg ttacatgtcc    120780
     aaaagttttg tatcaatcac ataacttgat ttttgtgaga ggctgtttct attttccgtt    120840
     ttcaattgga gttgtaaaat ttattgaaaa caaaaacgag tccctacttt ctctcacaag    120900
     tgtgtttgaa aggctattca tttttctgct cctagcaatt atttaataaa atacataaat    120960
     cttggagggt tgggtccata ccaccacata aggatagaat ttctcatagt attgatttga    121020
     cgaaaaaata agggaattgg gagtgagctg gtcattgtta gggagagatg tgaaggtttt    121080
     ctgaagtggg acttgagtgt tggagaaaca tgacaatcca attcaactct tcttcatcca    121140
     tctttatcag attctcctcc gttggggacc ttacatttac ttctctcaca ctaatcttct    121200
     tgtttctatt tttagattat aagcccatat tataactgct agtgcttgta gccttgtata    121260
     cacaaactca catgcatcac atataacatc gtataattgc tgtattcact ttatatttgg    121320
     atatccaaga ttatagaaaa gagattcctt tgcaggaccc aaaagataca gcttttaaaa    121380
     gcaaatgagt tcattttaat ttcttgctaa ccaaaatggt aagtaatttt gtggacttat    121440
     ggtatggata aataacaaaa tctcaataaa ccattgaaaa taggaaatca aaaaatatat    121500
     ttctgcatat aatttgaaaa gaaaatttgc atggaaataa ctatgttttt gaacaaacta    121560
     aacatggaaa taattattac cgcaaagtac aaggcattac gataagcatc cttgaaagct    121620
     ttgtcttttt ttttgggaac tcgaaagctt tttgtcttcc agttgtaaga aaaatacagg    121680
     aaaaaagaat tgaaaagccc taaataaaaa agtcgaaaac tttagctttg accaactctt    121740
     tcctctcttt tcatggtaga cccaactctc tcatttctta ctctctgatt catctctctc    121800
     tctctcttca tttccatgga aggaaggtga tgagctttct caatctctct ttactgattc    121860
     ttaatgaaag tcatctcctt tctctttggt atcccttttc ttcttctctg cttaattcct    121920
     gaccaaaaat tgtgacaaga tctttcaatc caaaagctat atacattaag gtaacgattt    121980
     atgaagtatt tctcctcaat ttcatttctt ttgtttctac gagtctgcat agatccagaa    122040
     gagctttgct tgattgttct tactttcctg agatctgttt aaacttagca aaaaaaaaaa    122100
     gtctactttg catgaaatgt gtgattaggg tttatgctaa ttttggttaa ttggagaatc    122160
     agagagtgtt ccctgatgtg gaagtagtga attactttgg gttgagtaaa tgtatgtctc    122220
     tcaattgatt gtcaacgaga tttgagctcg agatccgtaa ccaagttgag ctaaagcttc    122280
     tttctttcga cttgttctct atatgaaaat tattttttct ttgactcagt tatttttctt    122340
     aatttgattt ctttgagctc gatcttatga ttcatactgc aatgattgag ttgtggcatc    122400
     agctctgatg gtatcttctg tttttaaaaa atagcaactt tttagtgttt ttctgctcag    122460
     ctctatgtta aaggatgttt cttcattacg gggagaaatg aatgagagct cttgtttatt    122520
     gatcttccca tgattctagt tctaaacgag ccttctgtta tctgaatttg aagtgtttta    122580
     agctttttta ttctaataag ccgtcttctt ctctgacgct atgttttgct cactgcagag    122640
     ctcaggtcac tatctgacgg gatccgtgac aatagtggtt actggagtca aaagcagctc    122700
     cttgaatctt gagtgttaag tagataggta aggtaaccgt tcatggcctc gaagtatggt    122760
     tctggagttc tcccagaaaa taagaaggaa aagggcgata aggaaacccc ggaaacatct    122820
     tattccagtc aaagtgtctc agtaaacact ttggcagatc aagtatcttc aactttgtct    122880
     tttgctccaa gcagcgacag taaaactgga ggtgaagtta aatttaatga aaagtctgat    122940
     cagagcggga agagtaacac atgtagacca agcacaagca gtgatatcag tgatgagagc    123000
     acatgtagca gctttagtgg taacaacaag cctcacaagg cgaatgacgt gagatgggaa    123060
     gcaattcaag ctgtccgaac gaaacatggc gtattggggt tgaaccattt taggctcttg    123120
     aagaggttag ggtgtgggga tatcggaact gtccaccttg ctgagttgca cggaacaagg    123180
     tgtttttttg caatgaaggt tatggacaaa ggggctttgg ctagccgtaa aaagcttctt    123240
     agagctcaga ccgagaggga gatattgcag tgtcttgacc acccttttct cccaactttg    123300
     tatagtcact tcgagactga gaagttctca tgtttggtta tggagttctg tcctggaggt    123360
     gacttgcata cccttcgaca aagacagccc gggaagcgat tttcagaaca agcagcaaag    123420
     taaaaacatt ttgaataatc agtttcatgt tttgcatcca agataccact tttttttttt    123480
     ttttgttaaa atcatattgg ctttgtttac attttccagg ttttatgtag cggaagtact    123540
     tcttgcaatg gaatatcttc atatgcttgg catcatatac cgcgatctaa agccagagaa    123600
     tgttcttgtt agagatgatg gacatgtgat gctttctgac ttcgacctct ccttgagatg    123660
     tactgttagc cccacagtgg tcagatcaac tgttcttgcg tctgaagggc aaaagaactc    123720
     gggttattgt gcgcaacctg cttgcatcca acagccatct tgcatttctg ctcctacaac    123780
     atgcttttct ccacgttatt tctcaagtaa atccaagaaa gacaagaaaa tgaaaaacga    123840
     aactggaaac caggtaagtc cattgcccga gctcgttgct gagcccacaa gtgctcgctc    123900
     aatgtcattt gttggcacac atgagtattt agctcctgag atcatcaaag gtgaagggca    123960
     tgggagtgcg gttgattggt ggacttttgg gatctttttg tatgagctat tgtttggtaa    124020
     aaccccgttt aaagggtcag gaaaccgagc aacactcttc aacgttgtgg gtcagcctct    124080
     gcgtttccca gaatctccag ttgtcagttt tgctgctagg gatttgatta ggagtctgct    124140
     tgtgaaagag cctcagcata gattagcgta taagcgtggt gcaactgaga tgaagcaaca    124200
     tcctttcttt gaaggagtga attgggcatt ggttcgatgc gctagcccac cagagatacc    124260
     aaaaccggtt gattatgaga gtgcgcctgc tactccagca gcagccacat ctactagtgt    124320
     caagtctgac cagagtaatt atctggagtt cgatttcttt tgacatattt cagcaagaaa    124380
     actgccatta gatttatcaa tttgttcttg gcgatctgca aatacgttta gtattttgaa    124440
     aatgtgataa ctctttttaa ttctttgtca atgccattct tgagagttca cgctgagatg    124500
     gttttgtgat tacctgcaac gcaaagaagc ttaaaagccc taagctactt ttctaaatca    124560
     gaaattgcga aagctgagat attttagcaa taacactcgg ttctaagaat cttgagaagc    124620
     agaagcagag ttaacaggat acatatcatc aaacagttct gacaagaacc ctcctttaaa    124680
     tcgaaaggaa aatgtagttt gaaagcagaa acaaaatcac aatgtcttat aagaacacaa    124740
     tacacaatca tcttagggct acaaatttct tcgttacaac tgtttgtagc aagtataggc    124800
     aacagccacg gaagcagcag cacagacaac agcaagagca gcataagtat cttctcgctc    124860
     ccagctctct aaccatgttg gtattccgca aaccttacgt gtcgaagatc ctttgtcact    124920
     attaattcta aagaaagtct tttctgcaat ttttcttcct ggtgtcagct tctcagtgtt    124980
     gttttcactt tcaagttgat tatcttctga tgttcccagt gacaacatca gagtagtgtc    125040
     gtcttgacaa catgaagagc tgttcccatt ttgttggcaa caaccattag gttctgcagc    125100
     tcgtgactgg caacaggaaa catcggcgtt gtgaaccgat gattcttgac tcactttccc    125160
     attgatcttt acggaatgga ctgtaccatt tagctgaaat cgcccttctt gagttttctt    125220
     ctgatcttct tctgatagac ccatttcacc cctaataatc agagaagcat catgtgtgaa    125280
     tctaccaatt accactaatc cggaaactgc gagaaaactg acagaacaag aaaactttgt    125340
     acgtacctcc atagccggtc tacaatctcg cctttgttga tgtgctgctc caaaagaata    125400
     ggtacatctt ctggggtcac atacccatac ctagacacaa gaatgattca atcatcaagt    125460
     caaaaacagg gtatgattga ttcagacatt gcagagaact tccaatgtac taataacaac    125520
     tgaagtttga agataccaat taaaagatca caaccgttca tgaaaccaac accattacaa    125580
     atgtattctt gatcttctca ttcaaaatta ttgtaaaacc acatgaaaaa gatgaatata    125640
     gcctcaaact agttgataaa tccgtaattc cttactcacc agtgtcctgt gacttccctg    125700
     ttgatgtttg atcggtagat gataacattc ccagcgtatt tgtgaccacc tatgtgagaa    125760
     catgggctaa ttgacacttt accttgaaga ccatggaact caagttcttc tctgaatcta    125820
     ctaactagcg acggcccaca aaccccacat cgccggtctc gggatccatg ggaacataca    125880
     aagacatatg agcctttcag caattcagga tttccaggca gccattcacc atccttcaca    125940
     agcacctctt ccacaaaggt ctccacatca aagtgagtca atctcctgca atttttgtta    126000
     aatcaaaact gtcaaaaaaa agtcccaact gttgatagaa aaaacgaaac caaatctaag    126060
     aaatctccaa ctaggaagac ttcacccctt acctgtatct gatcatatca ggaaaaataa    126120
     gtacatcacc attggatgtc tctgttccat catgcccctc acatattgtg agtcgagtct    126180
     acgaaacaat ggccaaaaaa aaaaaaaaaa acatgaggca caaagcaaaa gacaatcatg    126240
     aaggcatcat catgagacta tccgaaaaga agcaatccat tacagacacc atttccactt    126300
     aagttcacca ctgtcatagc tcaaaaaacg gaggtgcaag tcctaagatc ccatcttgaa    126360
     gccaatagac aagttattat gttgttagcc atagaatcgt gccaaaaata gaaactttgc    126420
     cttatttgac ccatacagaa atcccaagag tcaccaggca agagttttta tgactcatta    126480
     cgaccttaaa cagatacttt aagtaagcca aaacaagtga acgcaaatgc tttttgctta    126540
     tttgggagac ttattggaaa caatcagacc tagatttatg agaatcaagc aatatacttg    126600
     gaaacaggag atgcaagtta acagcgaaca agctgaatca atggaatcag aaaatagtag    126660
     agtaaaaagc tgacctcctt cttcatgcta ccctttctgg ccgatacagc agcagagagt    126720
     agcctaggca atcgatcgaa ctcagcagcc tcgatccttg cgggccaaac agatggcttt    126780
     ttgtagcaca agaagacatg cctctcgtaa aactgtacgg ttccagctag ttgttccgat    126840
     cggaaatcag gacgagcgaa tccaaaatca gcgtcgttga tgctttctcc accgcctcca    126900
     ccgagtaagc tctcgctttg aaaactaccg gagcgagaag tgggttcgcc gagaaagttg    126960
     tcgagatagt cagatacagt gactggagac gacgccgtag atggattgct ggtgaaggat    127020
     aaagggtcgt ctctatctct tccacttccc atttaaaaat tcgaccacaa gtttgaaact    127080
     ttacagatcg aaactgaaac tacggagacg aagaagaagt gaaagtttct cagtgattct    127140
     tctactgaga gaggtctgtc aagtatattc cgttactctt attccggttt actccttaat    127200
     cgatattcta ttttgcaatc ggaccggtac ttttgccttt gtgtgtgtga caggtctttt    127260
     cgaatctagt acatcaaata agataatagt agctgcagcc agaatgataa aagcctggac    127320
     aagtgttgct tatgcttata gttaaccatg tttagccatc tgctttgaat tctatgtatt    127380
     tgcagtgtct ccattgcaat ctatttaggt actctgaatg taacaacagc aattacattc    127440
     ttttggaact tgtgtttggg ttgtccgaaa aggggatgta gaagaagagc acagattctt    127500
     ttctgtatat tttggtcctg taagaataca gactctcttc ttcatcaatg ttaatctttg    127560
     ttgtatatgt ttatgaggta ccaattccta catttcttag actggatttg cgttggtaga    127620
     tttgcagata tgttagagat agatcaagga tacaagatga gcataaattc cttctgcaat    127680
     attcaaagtc ttaaagggaa tcaagagaaa catattattc atttattacc attggcctcc    127740
     ttcaaaccaa aagacataaa caaaagaaac cttgacaatg tctcgaaaag ggagcctcac    127800
     aaatcaaaga caatccaagg aggcttttat gttaaatgct atagacatac aagcaaccta    127860
     tcctttggct atgcagcttc ttcctcttgt ctctaccaaa agtaaagctg ctttacgcag    127920
     ttcagactcc aacaacaaaa tattacatcc acagatttaa cttacacatt tgccagatga    127980
     ctactaggca ttaggcaaca gtatctgaca gagagactca atatgtgcga tgtgatcaga    128040
     aaggagttta ggctttcacc tcctcaccac caccagaccc tcctgcttcc tccttctctg    128100
     aatcctcttc tttcttttcc tcctcctcct cctcatctgc taatttggtg agctcctctt    128160
     ggattatcat ctttatagat gactttcttg gagtgagatc ttctgtgaac tccttagctg    128220
     aaagatggat gaaacaatgt gtttatttta tatataacca ggaatcactg gaaaaacaaa    128280
     tgactgaaac caatctgttc ataccaagtt ctttaaggat gtccgtgaac gtagcctgca    128340
     gaagaacaac aatgctctta ttaggttatc taggtataga aggaaattca cagtttgaat    128400
     agatattgca caacaaactt caaatcagct ttcagaaaac gaaggttatt tcatgtaacc    128460
     aataagtttg ttcggcagaa tccaattttg ttttattcca cacacatccc aagtagttaa    128520
     gtgtatcgca tataaaaggt tgagaaatta ctcaccgtac taaagtccac tcttttcaag    128580
     atctcaacga ttgcattttt cagcacttta tcactcggct tgtctttccc ttttccagcc    128640
     ctttttactt ttagcatata gacacaaaca gagataaaca tggtgtcaga aaacattagt    128700
     ggttgtatat tggttcgctt ctgaaaatga agatataagg aataagattc tccaatgcat    128760
     ctgacataca ctacacccaa catgttttta ttctacctaa gcgaccatct tactggaaga    128820
     aaaaaacagg ataatgacca aacctggctt ctcttttgat gcagactttg aaggagccgg    128880
     ggaggccttg atagggtttt cagacttctt cctcttagag gacgcctttg gacttgtatc    128940
     actgtcatca tcagtcttct ttcgtttggc tgatgaccgc ttctgtgtaa tcttctctgg    129000
     tggactggat tttgcagcga ccactgcttt cttgtttctg gctctccctg ctgattcttt    129060
     cttcccagct gacaatctag aaccacgttt cttctttgta gtttcttctt cagaatgctc    129120
     ctcagattca tctttctcct cgctttcaga aggctgaggc gcctcatcct cagatttatc    129180
     aggaatgcca ttttcattct cctcctcttt tttctcttct ttctcttctg ccttctcctc    129240
     ctcttgtttt tcttcttctt ctttctcttc ttcagattca tcatcagaat gagctaaact    129300
     ctttttgaca acttttgttg cttcttcaga ctttttttgg ctctgcaaag gaagtgcaga    129360
     ataatataat cagattaaaa tacttagcca gaaacattga cgggttgacc agtgatggac    129420
     agttgcaaat aagctacatt gagattacac gttcttttca gagttaataa caagattaat    129480
     gaacaagcaa gccctcagct ctaagctatg cattaccttt gctgatcgtt tggaggatga    129540
     actcccagct gtaggtgaag ttttcttggg agttctcttg cgttttgctc ccttacttga    129600
     ctgtttcaac agaatgtttt taaagaatgt aagatgcaca atagttatta aagcaaacaa    129660
     aactttccca acaccacatt accttctctt tctcagaaac tgtagtgtca ccggtcacat    129720
     cacctgtcac atgaggtttc tccaaaaact caaacagttt tgtaataata tcttcctgtg    129780
     ttgaaaaagc atgcaacaag aagttgccag attcgattaa atggggaaat gaataagcat    129840
     aaacttggac aaccagaaat ggctaatcaa gctgctcaac aaagacagaa atttaaacct    129900
     tcacatgtat ctattcacag aggaaaaaaa tgaatctcaa gaacaaaaac ttagaaattg    129960
     ataaccataa tgaccttctt tgttgtagcc ttggtaatgt gtatgtccaa cacatcacaa    130020
     aactcccaca gtttctcttt ggtgcatttc tcaagctttt cttttacttt ttcttttgct    130080
     ttcttctgca aataccaaag agccacaatt atatacaaag caaaggcata tgtaaaagca    130140
     ttcattatgt gtaatgttgc acacctcatc tccatgccaa acgaaaccag agaagcccaa    130200
     tatgtttgtc ttgatctgag cagcctgtta aagcaagaag aataagatac atacaaacat    130260
     gattagcaga cttgctacag cacatgagtc cataccactg gtctcaaact acaagagtat    130320
     gcccatgatt gacaatttta gaagtatgac tattggagca gcataatgtc aaaaggatcc    130380
     aaagagacgc tcaccttccc tctcctccca ccaaatagaa ttgggtgaag cagcttcaaa    130440
     gtttcatcag acctcttcct cattaccttg ttagcaacta cagagaagaa acattcaagt    130500
     tatctacttc atttcaactt caaacaaaaa taaaaagatg aaaaaatgga acaataaagg    130560
     tattttttag gtaggtcgcg attattagat tttggtttac aagaaatctt gcttctgagc    130620
     cggctggaat tgatcaatgc caagaaaaaa aattcaaatg aagattcaca taaccagaac    130680
     cgaaaagtgt atagatcaaa gaatccaccc atagtataca tgcaatttaa caactagtag    130740
     tatccagcac atagaattct cgtaacaaaa gaacgtttag gctacgcaca cttgaagata    130800
     ataaggggct caaactgtaa acttggaaag ctaacacaaa agacttttca gcacaaggat    130860
     aattcgagat agatgcttga aggacagata gatagaatat gaacatacca ttgggaatat    130920
     ctttgagata tgcacctcgc ccctgtaata tccaaaggat tattataaac atatctagca    130980
     ataaagttct actcagctca ggaaagtttt ggcaaacctt ttcaacacgg aattctttcg    131040
     aggagtcttt atcaatcaat gcaacaagcc tctcaacaga tttccgctca cgcacagggc    131100
     gatcagagaa aggagtccta ggctctgcat ccttttttac ttcctcggtt ttattcttct    131160
     cgcgaacctt tcctccagaa ctcgtccctt tcccacgctt tttagaaccc ttgctctctt    131220
     ctttttcatc ttctttatca tcatttgtct cctctttctc atcttccttt gcatctttgc    131280
     tctccacttt ttcattgtcg ttctcatcct cactcccttc tttttcatct tctacctttg    131340
     actcatccac ctcagccttt gccgcctcaa cttcctttgt tttattttct tccttatctt    131400
     ccttttcttt tccttcaaca ttctccactt gtttattttc atccccattc tccacttttt    131460
     catccatatc tgtccctttg tcttcatcta ccagtgtccc ttcctctttg atgtctcctg    131520
     tattgccatc ttttgttcca tttgctttgt cagcttcatg ttgtatgtcc tccttcccag    131580
     cttttttgtg gtctgcctca gtaatatctg tctctttggt ctctttttca tcatctttgg    131640
     catagttatt gtctttagat tccacgtttt ccttcattac agtatcttcc actgaaacac    131700
     catcatcagt ttgctctttc tttccatcgg catcttcatc catgttggta gcctctgctt    131760
     gtccctcatc tttggtgacc tcaaccttct cttccatttt ttgagtctca gcattgtctt    131820
     catttttctt aacctctgac tctttatctt ccgtctcagc tttttcatca tctttcttaa    131880
     tctgagcatc tatctccata ttgtctggct cagccatatc ctcatctttc gccagttctt    131940
     gtgtttcctt acccccagca ttctcctttc cagccatagc ctctgatggc ttttcaagag    132000
     aagtagtctt gtttgcggtt ggctcaatgg ttgcctttgt atcttccccc atattacaaa    132060
     ccagttcagt agatccttcc accaaaaaca cttcttgtgg ctgtgaatga gaaatcagtt    132120
     cagaggatta atattgctac gatagcagaa attaatgctc tctataaaga aattgaacaa    132180
     cttgacataa agaacatgta aaacgcattg aattcacact tagcatatat gcgaaaaaaa    132240
     actaattcca ggaaaacaac atctaaaact tggctagtca acaataagac aaatctaatt    132300
     tagatctcat tattgatcca taattatcac ttaatcccac tttagatctg cagaagaaga    132360
     actaaatgga aatttcgcgt aagtcactaa gaaaccaaaa tctcgaaggt tcatcattta    132420
     tcctcgcttc ttatacattc agtagaacaa agatccagat ggacaaatga aaccaaaaaa    132480
     caccctttca ttcagacaaa tctccagagc ttacaccaca cagattcaga caaaacacaa    132540
     acccatcttg aatctctcga aatcaagtca atcaacgtca aattcatgca ttttgtcaac    132600
     aacttaatag catcagatat caaaaagaca ataaataatc aaaacatcga aattcacaaa    132660
     taaaagaagc gcatgagaaa ccctaacttc tcatcgcaac tttaaacaaa cacaaagaag    132720
     aaccaaaaga acatgcgaat tcaaacaaag ctcaaaacat aaaagctcac aaagatttaa    132780
     gcagagtatc cacagggttc taaagcagaa gacttcggaa tctcacctca gagtatcaca    132840
     agactcggca ctgagttttt tttctcctct aactactttt tttcttacaa aacagaacaa    132900
     atagcttttg tttttctttt tgatagcgtt ttttaggaga gagaaattca aggattcgga    132960
     cgcaaagcca gattttaaat acaatttaat gccacgtcag gcttaggatg aatcattacc    133020
     gtccgatttc attgctgtaa tagagttcat caacggttca gattttatgt ttgatgcatc    133080
     tcgtggatcg atgacgctat aaactaccct aacgtccggt tccgaaccag gtaccgagcc    133140
     tagactttat atttcaagga ttttatatta ggtttttgga caaaaaaagt taacatattc    133200
     aatgtttgtg acctatagaa aaatatattt ttttaactac aaatttaatt tggtaatttt    133260
     tcaatgatat gatagttttg taaataaatt atctataaaa ttactatata acagataaaa    133320
     ataaaattga tacgtaataa ttgctatatc ggtttaatat taatgaaatt gttttacttc    133380
     tttatgataa ggaagctaag tttatgtgat tgaacaaatg attaaaacaa actctttctt    133440
     aaaatgtact tctttttaaa gaaatttaac gaattcgttg aatgttcaat tataattgat    133500
     ttaaacaacg ctatattagg taaaatgatc taattgaata gaattgtata agtgacttta    133560
     acaaattttg ttattttata tttaaatatt ttttatgatg gattcgatcc gctaccataa    133620
     atagcgttgt caatttttgc aaaaaaatta acatgataat ccgattttta cctttccgca    133680
     aaagatgaaa atgattcact ggtccggtga aaaaaacaag actattttga cgacgatgat    133740
     tataaatgac ttataatgtc attagtttga tagcgacaaa atttttattt gcttaacggg    133800
     tactatgatc taaaagaatc taatatgttt gtctttaaca acagtaaatg cttcggaaaa    133860
     aaaaaagttc taaatatgaa attagagatt gtaacttcca ccaaataatc tagatacatg    133920
     taagagagaa taaggttact gttttaattg ccaatctact tcttgcacaa atctcttaat    133980
     tttgtataga gactgtatag tataaccttc caaataattg aacaaagttt aatattgtcc    134040
     catggtaaat cacctagtcg aagtatttat atctcattat tatgagtttt tgacaaatct    134100
     agaagtctag aactaaaagt tgagaaacta ttattgaaaa acgggcaaca gttgtaattg    134160
     tctgcttaag gaccacgtag cttaagtacc gtcgtggtgt ttctttcatg gagcatatct    134220
     aattacggtg aagaagaaat agtttgtagt aatattgctg tttcttgttt aaataaaagc    134280
     attaacatct tgttgtgtat ttttacataa catttttgga actcaataca ggtgacacaa    134340
     acaaatatat atggtggaga tagtttgaat caagatcagc tctctgtgaa gaaataggaa    134400
     ttatatagaa caaggcctcg tcccattcct aacctaagaa gatcccgtac ataatgttgc    134460
     ttactttttg ttttacggac ccgattgtac tctccccatg ttgggcggat atgggtaaga    134520
     tgaattgttc aaggacgaga tgtcaccatt ttgagtctcg ttctttgttt ctctctggcc    134580
     gtactgattc ataccgctat ttaagctagc atagtaggat gacatgggac tagcatgaac    134640
     aaacctgaaa ttgactccat ttgggtgagt ttggttgaca agttgttgat tctggtgctg    134700
     atgttcgttg gaagcgtggt taggtccatc agatgagatt ccaacaccaa gattgaggct    134760
     gatggtgtct gtttcatctg gtctgaaccg aggctggatt tcgtgattgc tgctagactt    134820
     tgaagtggga acatcatgat cgtgtttgcc ttcgtatgtt gttattacag cttttggatc    134880
     atgtgatgct ctctccacgt gttttctcac tgggcatcca tgagctgtgc atttgtagta    134940
     gctcctacaa aaggccgagg aacatcatga aacataatat ctccattgcg cacatgttga    135000
     gtctgttaag atcactatct tccatattcc aaaccaaatt cctaaaagaa gcaacacttt    135060
     atgcacatgt caaataacta ggtcctgaag acaaggacta aactgttcta gctaccattt    135120
     tgaactcgca agttatgttt atgtatgttc attcgagaaa aaagcaagga attttttggg    135180
     gtgttaaaag ctttaatgct gtacaaacct gggatttggg ttccccctta cgactttctg    135240
     cccatatttg cgccatctat aaccatcatc cagaatgtca acctcactca gagtttgaac    135300
     aacaacccga ggctcccgga tgggtttcac tagtggagtt atttccatcg caccctccat    135360
     cctcctacat aaagttaaaa taaagtttta atcatgtcaa atcacagatt caaatcaagc    135420
     acctgaatcc tttgttaaac tctaatacct ccgttttgag aatggatcat catcgtccgg    135480
     ctcatcttta ttcctatttg acgctgccgc ttctccacca tcgtcagatg ctgagatagg    135540
     aggtacttca gggttaccag tttgttcatt ggggttagac aagttgtaga cgccagatcc    135600
     cttctctgta tgcagacata agagtagaag gaaaaagtta tagatattgc caagggagta    135660
     agtgcatatt tgtctcaagt tttagttatg attaccatct cggccagttg aagaaggata    135720
     cttgtctagc ctttcttctt gtgcagccat accaccagag tttcggcgac caggttgagg    135780
     tttaggatgg tcatgtgtac ccttgtatat aatatcggtg atctgcccat catgagatct    135840
     ttcaaataac tttttcactt cacaattagg atgtgtacat ttataatagc tccggggaaa    135900
     ttcactccct ttgacatgct tttgaccata ttttctccag ttataaccat catcagccaa    135960
     gatggatgga gtgcttcctc tggagtcatt ttgggaagtc tggattgatt cctcttgatc    136020
     agatccagcc ggaatatctg agctcgttgg tgtcatctga caaggaggag ttggccggct    136080
     tagctcactt gaggaacctg cagcatcact gatcgaagaa ggtgagtgtg aggatccatg    136140
     gccctggcct tgaaaatgta ctggtggctc acttctaatc ttgccaagct ctgcatatac    136200
     cttgaaatca ataaagatgt ttagacaaag tcatccccca acaatataca agtaacttat    136260
     aaactgtgag cttttggata caaggctcct tatgaaacaa tttaaggctg gcatggtatt    136320
     atatgtatgc aaaggcgaaa gattttgaga tttacaagca atccaagcgc tgaataaata    136380
     gacttcgtgc agaaaaatta ggtcagccac tgttcggggt tcatatgtcg tcgactatct    136440
     gaacagtaca ttacatgcaa agcataacaa acagcattgt tttggacaat accatatttg    136500
     atgcaggagg tctgaactca aattcactgg acttctgctc agtaaaggtg ttctgatgga    136560
     accccctgcc tgtataagaa cttgagctag cagaaatgtg cactggtcga ggcttgaaca    136620
     aagaaccagt agtaggggaa ggttctggct gaaagttaaa gaaagtggca tattattaat    136680
     ggcatgaata aaacaataca tatcagattt tgtaaaacat gaacctgatc tatcaataaa    136740
     catgatgttt taaaaaaaac agtcttctaa aaacaaaaac aatatcttgt tcaatcaagg    136800
     gataagaaga tataactaag agatgcaaaa taaaattgag cacatagcat ataacctatt    136860
     attcataact taattgaaca aaacgaatac tctatagatc taaatggtga acatgcgagt    136920
     aaagtacatt ttctcaccaa cagaatcatt caatagctca tataagtaaa aggaatcccc    136980
     acacagacgc agctaaccga aacctaaatg tacaaagaat ggaaaaagaa aagagaagca    137040
     ccaaacacat ggaagataga cactagacag tatgaagaag aaacgacaaa gagcaagagg    137100
     atataaataa agtatccagc accaatagaa catgataaaa aaaaaaggtt tattcgaaag    137160
     aacaatctga acggacacaa atgcaaacca atgcagagta tagtagcaca aagaatcaga    137220
     atcttggcca aagtccctaa cgtaagcaaa caaatcatag ttttttaatc acttgtaatg    137280
     gactaagaaa caaaaatgga aacccaagtc caatgttttt cctagtgagc aagcagagag    137340
     catctccacc aaattaccag aaattcccca ctaacatgaa cagtgatcca aatcgaaatt    137400
     gaagcaacga gaaaccgaac aagtgggaca aaatgtcaat gttatgaatc aattccaatt    137460
     ccaaactcag tttcaaaatg gcacaatcca atttcatgaa aaatccttta ggtcttaaaa    137520
     atatgaaatc agaaaaccta atttctcaaa tcgacaacaa aaatgaggtg aaactgtgat    137580
     tgcatttacc aaaatcgaag aagaagaaga agaaagagat agtaaagtag ctgcttaaac    137640
     cttgatgttg gagatgaaaa caggagattc caaaaacgaa gtcggactca acccaggagg    137700
     aatcgtgata tcagtcgacc tcgagatcgg aagcttggcc ggtgacatca gcttatacct    137760
     agcacctcca cctccgtttc ctccagctga atcgtgcttt gccgtgagat ctcccgtcgc    137820
     cgaacaatct ccctgaaact ccttccggtc attagcttga gggttcattt cagagattcg    137880
     caagggtaga acaaaaatga aggaaaaaag aagctaaggg aaagtagaag aagctctcag    137940
     ctatggcgaa atgagagaga ttttggtctc tgcgttagtg aagattgtag tgaaagatga    138000
     aagaacgata ttgacttcac acctctctta attctttgtt tttccttttc atttttttaa    138060
     taatttattt tcttcttctt ctttttctcc tttatttagc tttatcaatt tctaaagcaa    138120
     caacaacaaa cgttaaagtt gacaaaaaca attagaagat gtaaacaatc ctcttttttt    138180
     ttctcatgta catttgtcaa aatgtaaaag ataaaaaagt tagtgtaatc aaaattgctt    138240
     gtttaaagag ttgttggaac cagaaacatc ctaaatctca aagtaagagt gttgtagcat    138300
     tggtagattg acacagtcag aagcagtatt gttgatgata attaaggatc aggtatcaac    138360
     agtctcaggt cttttaaaac ttaccttttt gaatcttttg tgcgccaatg atccgttgct    138420
     tcgactctcg tctatcttat cttctgcgat gtttatcaat agttcaatac cgacgctgaa    138480
     ataaatgtat ttgctgattt gtaacaagtt tctattgtga tgaggccaaa tatcaatcgc    138540
     atcatcgaca attaccactc tacgctcatc aacagcaaga agatcgagtg tcttctcata    138600
     aggactttgt tctctggcta ggactcgatc tccaaagtat atttttttcc ggatcaatcc    138660
     acttcaacac ggtctgagcg taactagaat cacccattgt gtatacgtgc atgatgaaac    138720
     gcttgttggc ttctaataga aattcatgaa gaaaaggtcg tagctttatc atatattcgc    138780
     tgggagtgga tctctgttga ttctccacag atctgacctt gaatcagctc cttcgattag    138840
     atacttctgc tcttcggaaa ggtccgaaac aagtaccgag tggacaagcg tgtggtccaa    138900
     gtcaaggact aggtgaaact tcttcttctt atcatcgttg agacaggcca tttttttctt    138960
     gttttggatt ttggttgcag agtatgattg ttggctccaa acaagtgaaa ctctgtaatc    139020
     gaaagagaaa ccctaatttg atcggtgata atgaaattga tatgctatga ttatgtatta    139080
     tatagagagg atatgtgtga gatatctttg ggccgttctc agtttctttc attggtttaa    139140
     atgggcctag gcccttgagt caaattacct accaaattat gtgggagttg aatcgaattt    139200
     tttttgttaa aaatttaagc tattggttta tcttgtgggg tagcggttgt gttctatttg    139260
     cgtggataac agttaggata tataatggtg agtggtgaca ttctggatcc aagttggtcc    139320
     acctcaaatc ttgttagaga atttttcaaa aaaaaaaaaa aacatgtttc tttggttgta    139380
     aaacttccaa aatgtgtaaa agataagaag aatatgtgta tatatctctc aatactgttc    139440
     aatgccgttt cagaataaaa ctatgtaatt cttttctaaa ccaacaattg ttttacttgt    139500
     attttaaata attatcaatc catgttttga taaaaactga taattcgaaa gtgggtaact    139560
     cggtaaaatg ataaagcaac agaaaatata tcataactat tcaaaaatat gtgactagtg    139620
     aagattttag atagtaattt tttcttggtg caacactcat atcatataca tagtcttgtc    139680
     atttttacat attaaattta atgtctagat taacagaaga aataaggaaa aactcgataa    139740
     ctgttttttt ttggtaatta aaaaactcta agaaaatcta gaaacggaaa agtttgcatg    139800
     aaaatttcca aagttcaaaa aggtgttgtc cccttcacat aaccacacca tcatcataat    139860
     tttgatcaaa catttgacca agaaaaaggg gtggtttcac tattttagtt tggtgtactt    139920
     aagattttga attatttaaa gttcacgata tattggcata tacctcgaag aatggtgatc    139980
     ttgtactcaa gtgctggagg agacctttaa tttttaggag tgaaattctc ttcaatttgc    140040
     aattttctat ttgatcacgt tgaagatttc aaaaacattt tttaatccaa ttttgtatgt    140100
     ttgaaattag tcaggaattc ggcatatgat taactgctta tacacaagta ttctgaaata    140160
     aactaagatg ttttggaaaa aaaaaaaaaa aaaaaaaaag tattttaaac tcatattaca    140220
     ttttttttct tcgcaaacta gtattacctt cttactagaa caagtaaaca actatgggat    140280
     caatgaggtc atcgaatgcc aaatatgaat tctattattg gccgtctaca aattaattaa    140340
     tggatataat gcaacccttg gatactcata aacatcatta tgcccaaaaa gaacattaga    140400
     ggtagacttt ttcctctaca caagagaagc tcagctgtct acagatccta tcttctcctt    140460
     ctcataattt tatagaaaac tatagtatat agataaaaac tatattgttt taggcgtcat    140520
     atataagaaa tatgcccacg caagagagga taaaaaaaac accacacaac agaatatttt    140580
     cccttatagg taaaggtaaa atgtcaatgg aacataatat taaaatgatt aaatttgatg    140640
     caaaaatatt attttgtata ttttcatgta gggcatatga ttctatcttt gtgatataaa    140700
     aagatagcat cgagtaccca gttttaaaat tatgtcaacg taggcatatc acaagtgaaa    140760
     aacaaaacgt agacaaatca aaatattaaa aatgtaaagg tcttatcata agtagaatgt    140820
     gaatttgtta atagaaaata tgaaaaagtc gttaataaca taaatgtgta taatatgtat    140880
     cgtgggttcg tatattagat agaagacaag tcacctacga acaagaaaat gtactatgta    140940
     gtaatcttgg aatattaatg taatttctct ctaacgctca attaatatat aacgttgtca    141000
     cttgactcac tttatctctt aaccattcat tttctggtgt tttgtgtacc gaataacata    141060
     ctgattaatt attatgtatc cgtccacttg ttcgtgattt tgtaaggtaa agtccaaaca    141120
     ttttgtaaat agtctgaaaa gaccaaaaaa attctaaaac ataacgctaa gtaattcacc    141180
     taacttaaat tatatgagac actaataatt tcggaaactt tgatgacgat tttagctcaa    141240
     acattatgta actattttct aatgtttgtc ccagtgatta tgatgatatg aatatatgat    141300
     aatttttaga tatttaaatt atttcaatac ttttgtagat agtgattgaa tacattatac    141360
     cttacctaat tagaaattaa ctcattcatt cacctatagt ttttacaaac acattactgg    141420
     tttacaaact catattatta tacgctgatg acatttatat aaatcattaa actacaatgt    141480
     atgttctaaa aatcttccaa ttttaaagta aatagtataa aattaaatat atgcataaag    141540
     tttaaactta gtttgtttcc aaagcaagga ataatgtgca gggattcaga actttggaaa    141600
     ttcttgtgag tttttttaaa attataagaa ctttggaaat taaactttag aagaaaatct    141660
     tcatacaatc ataaattcag ctacaattga aaagttgtag aagaacaaaa atagacaatg    141720
     aaattagtgt ttcttcaaat aaaatggaac attttctttt gatgatatta attagccttt    141780
     agaaaagttg tgatactcat aaattgaatt actcattttt tctagagact ccataaattg    141840
     aatttaatct cataagaaat gtaaaatcta tttttcaatt gtttttatca caaataaatt    141900
     attggttaga aagtgaatta ttgagatgaa tatatatata tttgtgggaa aaaataaaat    141960
     ttaaaaataa aaaggagcta tcatcttcca tcatctgtct ttagggcctc cctctaagtc    142020
     taacaaccct aaaataaaag attctaacac caaaagagag aagcaaatct caaattcttc    142080
     ccctattatt atatgtgact gttgttgttt ttctctcttt taccatcttt ggcctgaaga    142140
     aaaaaaaaag gaatccttct taatggattt ggtaaatcaa ttaagaaagc attacacaaa    142200
     ataaaaaagg aaagtttttt aataagcttc attgagagag agatatagag agagaaaaga    142260
     gagagaggcc atattttgat aagagaagaa gaacccttat agagaaagag aaagagagag    142320
     acagagagag tggatggatg tcttatagaa tgaacaaaac atcctctgtt tctcttgtcc    142380
     ttgtcccttt ttccagatct taaggttttc cacattttat catctgggtc ctctccttaa    142440
     tggtgaattc tccatcttta caagtttgat gtttttgttc atcaaatctg gcgttttttt    142500
     ttctcttcta atatatattg tctctgctca ttttccgttt ctcttcccat tgattgttct    142560
     gtttcatttc tgtttttttt ttttcaatag ttttgattgg atgctttgat gatccattgt    142620
     cagatttgaa gacactcaat tcctatttga tcggggacta gaatttggat tctgtttcag    142680
     acaaaagtag atttccctgt ctctttcccg tttgattttc aataagatga atccggaggt    142740
     aaaacattga acaattcttc ataaatctca gaactttgag cttttttgaa tcttaaaaca    142800
     cgatcgaagt aaaaaatcga attgttagat gaaatgggca atcgtcattt tcgcaaatct    142860
     gatccgtatt tgtgagatcg gattcattgg atcgactttg gggttttgca ggagcaaaag    142920
     atggaatctg catcggatct gggcaagctc ttcattggcg ggatttcatg ggacacagat    142980
     gaagaacgac tgcaagagta ttttggcaag tatggagatt tggttgaagc tgtgatcatg    143040
     agagaccgta ctaccggacg tgcccgtggc tttgggttta tcgtttttgc agatccttct    143100
     gttgccgaga gagtcatcat ggacaaacac atcattgatg gccgcacggt tagtattctt    143160
     ggatccattg cttgacaatt catctaatta tcagtcttga gtaatcgagt gttctaaagt    143220
     ctcgatcttt ctgtaatgat tctgtcttag aggtcttatt ggtctcgctg ctcgttaatg    143280
     agcaacggat tgttctataa tctcgatctt tctgtattca tgctctctta gagatctgtt    143340
     tggtgtcatc cattaatgag ttttaagcag caacgtttag atctttctgt aatcatgctc    143400
     ttttcgaaat cttctgttgt cattagcttc tggatttgct gttactgtta taacttgtga    143460
     gaatgtgttg ttgctttgtg ttgaagtggc aatgttagtg ttagatcaat gagaaaagaa    143520
     tgaaagatct ttttttattt ctttgttgca ggtcgaggcg aagaaagctg tcccgcggga    143580
     tgatcagcaa gtgctaaaac gacacgccag tccaatgcac cttatctcac ctagccatgg    143640
     tggtaatggt ggtggagcac ggacaaagaa gatctttgtt ggaggtttac cgtctagcat    143700
     tactgaggcc gagttcaaga actactttga tcagtttggt acaattgctg atgttgtggt    143760
     aatgtatgat cataatacac agaggccaag aggctttggc ttcatcactt ttgattccga    143820
     agagtctgtt gatatggttc tccacaagac ctttcatgag ctaaacggaa aaatggttga    143880
     ggttaaaaga gcagtgccaa aggagctctc ctcgactact cctaaccgaa gcccacttat    143940
     tgggtatggt aacaactatg gagtagtccc taataggtct tctgctaata gctacttcaa    144000
     tagttttcct cctggttata ataataataa tctaggctct gctggccggt ttagtcctat    144060
     tggtagcggt agaaatgctt tctctagctt cgggctcgga ttgaatcaag aactgaattt    144120
     gaattcaaac tttgatggaa acactcttgg gtatagccgg atccctggca accaatactt    144180
     caacagtgct tcaccaaacc gttacaactc tccaattggg tacaacagag gagactctgc    144240
     ttacaacccg agcaacagag acttgtgggg aaacagaagc gattcctctg gtccaggttg    144300
     gaacttggga gtttcggttg gtaacaacag aggaaactgg ggactttctt ctgtggtgag    144360
     cgataacaat ggctatggaa gaagctatgg ggctggttct ggactttcgg ggttatcatt    144420
     cgcgggtaat acaaacggtt ttgatggctc tataggggaa ttgtatagag gcagctcagt    144480
     ttatagcgac tcaacatggc agcagtcaat gcctcatcat cagtcttcta atgagttaga    144540
     cggcttgtct cgctcttatg gctttggtat tgacaatgta ggctcagacc catcagccaa    144600
     tgcctcagaa ggatactccg gaaactacaa tgtcggaaat agacaaacac atagaggtac    144660
     actcatcgat gtcaaacttt tttccttttg catctcatct gctacattta tttttgcctg    144720
     ttgaaaagta attagattga ttaacgtttt caggtattga agcatagaaa gaaatcgacg    144780
     aagagaagtg agaattgtag atcaagaaga acagccattt ccgttgcaga gtttgaagag    144840
     ttgttatttc gatatcaagt agagaaagaa accaactttc ttcatcacag tgagtttctt    144900
     gttttgtttt tttcgtcgtt agcatcacaa acacaaaaaa gagaagttta tttttacttt    144960
     aaaaattctt acataagata agatcagatt ggtagctgca aagatacaac atggatgata    145020
     aaaaaagatt tggtttcgtc tccatagcaa taaccagaga tcgttgattc tcgatcacta    145080
     ttctttaggt ttctctcctt cttcttccat gatttcttga tgttgtgtgc tctgtttgta    145140
     actctaattg ttaaaatttt ttatgttaca gatttttttt ttcttttggt ttttaaactt    145200
     tggattcgaa ttgttcatgg gaacttttgg atttttctat tagcgtgaga gaaaacacat    145260
     tgtgcaaaag gctccaaaat gattattttg ttacatttca tactttttac ctttgggttt    145320
     cttttctctt ctgcttacag tataatctat ttattaagta catgtggtta attcatgatt    145380
     ttaaggtaaa aaagtaaaca agcttatctt ccaaattgga tttgtttcca agaagacatt    145440
     ggggttgtta ccaagaattt gagaaagcct gaattattgg atcctttgac taaaccaaga    145500
     cacatttggg tccaggaagt gacaatcaca ttcacacaaa taattaacca atcttaaacc    145560
     atgggacatt gtgattaaga gctacaacat cagttgaact tgaacattat gagactacat    145620
     cttgagcatt agcactagca ttggaagtta atgggcttca ggcccactaa gtaagttttc    145680
     agcctaagca atatcttcaa taatgatttt ttatttattt aggatattta cttttaaaaa    145740
     tgtaaaaaca aaaagacaat aaaagtttgt tgacaaaaga aaaaaaggtt caaaagtccc    145800
     aacggtcgaa tcgaaattca gacagttcaa aaagccgctc tccatctcct tctctcttac    145860
     agaacataat cagatctctc ttgctctctc accctcactc tcactctcac tctcattgtc    145920
     tgaaaaccat gaagtctccg gcgatattaa gcgagaacag gttcctaggc agcattacaa    145980
     gttcttccat ccgaaatctg cttccaaaat ctatctcagg gaagcagaaa ccaatcatcc    146040
     aaaacccaga tactaagatt cccagatcca acgacgagaa cgcgattcct gtagatccaa    146100
     accaaaaggc tagcgatcat cacaccgctc ttcagttcac gaagcaatct gactcaaagg    146160
     atggtaattt cggagagcca attaaggtac ttccataact caaaaacctt ctaaatttgc    146220
     tttgtagttg cttaagcttg tatgatcagt tatagtatca gagtggattt ccactaatta    146280
     cagagagatc ctttggaaac ttttaacagg acaataaaat gggacaaagc acttttgctg    146340
     aagacaagcg cagtcttctg gattcaccat taaaggttga atcaaggagt atactttcta    146400
     gaagaaccaa ttcagtgcct agtgaaatta aagaggaaga tgacgacgac tcattgggtg    146460
     atcagattcg tgaactaaag gtcttgtttt ttgttactgt catatagctg caaatatcat    146520
     ctgttacata tttgatgtga gtttgttgta tatactgaca tttgaggaat caatgttttg    146580
     taatttggtt ggttacagga agagctcata agaacaaagt cggatgggta caacaaagct    146640
     gatgcaagta agagtggaca ctttgcacgt gacagtttaa gtcaattgag agtcagtatc    146700
     aacaaatctt tactcatgtc gtgtccaaaa agagatgaat ctgagggaaa agaggtgatc    146760
     gtggatggtg aagatgtgct ggaattgaat aaacatattg agaagcttca cggttcttat    146820
     gattctgttc actcctcatt tgcaagtgct tcatgctatg aagccgactc gatgagtgga    146880
     gatgatgagg atgtctgctc agaagacttg gagaaaccaa tgcatggaaa ccataaagat    146940
     gttgactttg tagataatga tccaagccag ctcgacaatg ttgaattcga tacaacgggt    147000
     agtggcattt caatcagatc acagcttcct agttgcgttc tagaagagcc aattttctca    147060
     gaatctccaa agtttaagaa tgttcagaag agtgtagctg catcgacaaa gttttcagca    147120
     aatcctagga atgtgtctga aagctccaac attggagaca tgaaagtcaa tcagattagc    147180
     ccgtgtatgt caaagaaggt ttcaggtcct acagattctc tagctgctag tcttcagaga    147240
     gggctgcaaa ttatagacta tcaccaaggg agctcactat caaaaagttc atctgtttcc    147300
     ttctcttttg gccatatggc attgaaacct tgcgcagaag gtgagaatct taatgcttca    147360
     gtccaatctt ttagaaaaga taaagcttca gaaggtggat tgtcgtcgat tctcctatgt    147420
     ctttcatgta gaaagaaagt tgaccaagaa gctgaagtat gtccacaaaa cctgagatat    147480
     ttgcctactt tctctatagc tttaattttg gtaattctgt ttcgttactt atcttataat    147540
     ctcttctata tcaggtaaca gaagaagctg gttcaaacga aaaacatctc aagaacatgt    147600
     gtatggagca agcagctaaa attgaggagc taactctcct ggtaaaaacc ttgtaaactt    147660
     taaagaatat tagtgttata aaaccttgaa tcagattttc aaaaattagt tttgataatt    147720
     cttaacttag accaatatac aacatagctg tggaagagcc tgtgaagtta ccagttgagt    147780
     ttcattgacg atatttgaca agaatggcaa tctaaattga ataaactgtg ttgtggcctt    147840
     gtttgcagct taggaaatca gatgatggag aagatggaac agagttcatc aaagaaacat    147900
     atgagacgaa acaaattagt gaagagtttg gaaaaacaaa ctttgaggta agtgaaaagg    147960
     aagctcttct caaggagatt gcagacctaa agagcaagct gcagcctact aagtccacag    148020
     acaatctgag atcctcgtta ctactacgat ccattcaaat gcgcaaaagc attgatgtta    148080
     gcaggaatgg tgagaacagt gatgatctag cgaaagaaag ggagatgtgg acagaaatgg    148140
     agagtgagtg gatatcctta acagatgatc tcagaatgga tatcgataac catcgcagtc    148200
     gagctgagaa tctagagttt gagctcaagc aagagaagct agccactgaa gagttgaatg    148260
     acgcgctcac tagagctgtg cttggccaca gtagattcat agagcagtac acagagctgc    148320
     aggagacgta caatgaactt ggggagaagc acagtgtgat gatggctgga ataacagatg    148380
     taaagaaagc agcatccaag gccgctatga acggccgcca tggaaagcgt tttgccaaag    148440
     ccttttcaga tgagctttct gccatcagag ctgagaaaga gaaagaaaga gagctcttga    148500
     agaaggagaa caagaaccta agaactcagc tgcgagatac agctgaagca gtccaagctg    148560
     ctggtgaact acttgtcaga cttagagaat ctgaacaggc cttacaagtc tctgaggtaa    148620
     actaagctca ttcataagat cataacactc tcatgtggaa aatcttggtt tcattaaatg    148680
     gctaaacttg aactcaaacc atcattgcag gaacgattca gcgtggtgga agaagagaaa    148740
     gagaggctga agaagcaaat ggagcaacta aagagcaaac acaagacaga aatagggaca    148800
     atgaagcaat acttagcaga gagtaaatta ccaggatctg cattgttgca gccatggtac    148860
     aaagatgagg aagatgaaat agaacaagta tcagaacatg aaaccggagc tgtcagtttc    148920
     gatgactacg aggatgatca ggcttggaga gcagagtttg gagctacata tcaagaccac    148980
     cattactagt ctttgtttca gacaaacgac ccttctcggg tcatttacta tgatcctcct    149040
     tagtactttt gtactgttat ctttcatttt gttgttctat tgtatctgcc attattgaac    149100
     cgctaaaaag atttgtaacg gttggaaaca tttttacatg tattgattga ttcatctttt    149160
     cctgaattcc agtgaaattc ccagaagaac agaaatctaa ctgaaaccgc aagaacttac    149220
     tgtaagccca attctgttaa tgataatgtt aaatgggcta taaaatgagc cccgtcatca    149280
     gccgctgaag tgaaacgcat cgtttagtat cgtcgtcttc tggggaaaat atcttttttt    149340
     ttaaacacta tcaattcgac tggaaaaagg atatttccag attaggtaga gagagagcaa    149400
     aagtactttc attcagactt cagtttaagc tatggcggcg aacgattctt caaatgctat    149460
     tgacatcgac gggaatctcg actccgattc gaatcttaac actgacggtg acgaagcgac    149520
     cgataatgat tcctcgaagg cattggttac tatccctgct ccagccgttt gtcttttccg    149580
     gttcgccgga gatgctgctg gtggcgccgt tatgggctct atcttcggat atggtgctct    149640
     tcttctttct attttgtttc ttctattgct tggttttatc tgctattgct ttactctctg    149700
     atagtgaatt gagaattact ggcaaacaat tgagtttgta ctcttttctt catttaagtt    149760
     gatttcaaaa catgtttcgt ggataagggt ttgagaaatc atagttgttt tagcagacta    149820
     gccttttgag ttattttcag gagtaatcta gatttagggg attcaacatt cctcaagttt    149880
     ggttatgttt tgctcctgga agctatagaa ttgaattagc ttagttttca ttaaagagcg    149940
     tcaatgtgat aagattggct actgatttga ttacgatgat ggaattgtga aatattatct    150000
     cactatataa gttgggattc aggttcagga ttgttcaaga agaaaggctt caaaggatca    150060
     tttgcagatg cagggcagtc tgctaaggta cccctcatct ttatgctata gcatatatat    150120
     gcttattgtt ccaagaaact gagtaatttg ctaatttttt gttcaagact tttgctgttt    150180
     tatctggagt ccacagtttg gttgtttgcc ttctgaagca aatccgaggc aaagatgacg    150240
     gtgagactct tcagattgct tccttcttgt gtaaatgatt agtttttaca tgaacttgta    150300
     atctctctcc tacttatatt gcttttgttc tttttttaca gccattaatg ttggagtagc    150360
     agggtgttgc actggtcttg ctcttagttt ccctggtaat ccaaatccat tatgctcatt    150420
     ctgatttcta ctttggcgtt atgtatcata tcaaagatgc aatcatcaca gagaggagag    150480
     ctaatagatt ctttcttata tggccttttt tacaggtgct ccacaggctc ttctacagag    150540
     ttgtctcacg tttggggcat tctcttttat tcttgaggga ctcaacaaaa gacaaacagc    150600
     tttggcacac tcggtctcgt tgagacacca aaccggactg ttccaagatc atcatcgtgc    150660
     tttaccactc tctcttgctc tcccgatccc tgaagaaatc aaaggagcct tttcttcttt    150720
     ctgcaagtcc ttagctaaac caaggaagtt ctaatctcgt cttattattc tccctttctt    150780
     gtgtcttagg ctctctctat gtagatgtaa aattttcccg cttttgttgt actttgtgag    150840
     acatgttttg tgaaaggctt tttgcaagag ccaatttgaa gagaaaaaga gttgtgtact    150900
     ttttgcttta ttgaatacga tctttacttt agactttact acttcaaatc aattacattt    150960
     gtatatcacg ttcttaattt cgctccgaaa aggtaagaca atgatcacaa ttctccaatg    151020
     atattaggac caaaactttg tatctgaaac cagttacagt aatttcttat gacattgttt    151080
     ctttaaggaa tctcaatgta aatctgaaat cacttgcctt gtttctgcct gaggcgttct    151140
     ttgacaaaat cattacgggc tttagtacga gcttgctgag gagcaacgtt gagatacgaa    151200
     aaatggattc caatggcgaa aagagcagcc cctgaggcaa aaaatgccac cgtcattgcc    151260
     agttttcttt gtgaagatgg atagcaaaac gacatcctca aagctatcaa ctcttcgttt    151320
     gctacaaatt caaggtttct gtgttcaata aaacaagatg taatcacacg gaaacgaaac    151380
     aactaggaag agagacgaga cacaagggtg aaagaggaga aactttctaa gacacatttc    151440
     atcgaacagt ttgtgtgctt gtctattttt cttaaaacct caaattcagt tgctataaat    151500
     tgcacgctta ttgaaacgag ttatgtagta atgagaaaaa ctgtacctgt tttttttaaa    151560
     gttttaacca taagagggga agtcccgagt ttcagcggca aaagacacgt acggcacagt    151620
     acgaggattc atagatcttc agacagcagt taattaacta ccttcgatga tgttccgaca    151680
     aatttggcaa agacacgctt tgtagtaaaa cgaatcagta tgcatcacaa tggggatgta    151740
     gctcagatgg tagagcgctc gcttagcatg cgagaggcac ggggatcgat accccgcatc    151800
     tccatatttt atgttgatat catttttcaa gggcccatag aaagcctacc aaatgaaaat    151860
     aattttaatt tcaaattttg ttcatcgttt aatctctcta cctccttctc cggcgacaat    151920
     ctgcgtgact ccgttcccga agctatttat cttattggaa ttctctgctc ggattcattt    151980
     tctgctgtaa cagtctcttg tgaaatctgc ttttgttgta aatcacgatg attcgcataa    152040
     gcatcggagt taatcgccgt ctgcgttatc aattctcaag ttttgctggc tacagtggat    152100
     ctgaaaaccc taggctcttt aaaactctcg gcgctgcaaa caccccgatt cctcacagaa    152160
     ggaatcctga acctaaaggc caagatcttg atttcgtcaa tgttgctcat agccacctga    152220
     ttcaatctga ttgggataag ctaaataagc tatcagacca cttggattca tttagggtca    152280
     agaacgtatt actgaagata cagaaagatt atcttctttc tcttgaattc ttcaattggg    152340
     cgaaaacccg aaacccaggt tctcactctc ttgaaaccca tgctatagtt cttcacactc    152400
     tcactaaaaa ccgcaagttc aagtctgcag agtccatttt gagagatgta cttgtaaatg    152460
     gtggtgtgga tttgcctgcc aaagtatttg atgctttgtt gtattcgtac cgggaatgtg    152520
     attctacgcc tagagtgttt gattcactct tcaaaacttt tgctcatttg aagaaattca    152580
     gaaatgctac agatactttt atgcagatga aggattatgg gtttcttcca actgttgaat    152640
     cttgcaatgc ttacatgagt tcattacttg gtcaagggag ggtggatatt gctttgaggt    152700
     tttacagaga aatgcggcgg tgtaagatat ctccaaaccc atacactctc aacatggtaa    152760
     tgtcaggtta ttgtaggtct ggaaaacttg acaagggcat tgagttacta caagacatgg    152820
     aaagattggg ttttcgggct acagatgtgt cgtataatac tttgatagcc ggacattgcg    152880
     aaaagggtct tttgagctca gctttgaagc ttaagaacat gatgggaaag agtggtctgc    152940
     agcctaatgt ggttactttt aacactctca tccatgggtt ttgcagagct atgaagttac    153000
     aagaagctag taaggttttc ggtgagatga aagcggtcaa cgtggctccc aacactgtca    153060
     cgtataacac gttgattaat gggtacagcc aacagggtga tcacgaaatg gcgttccggt    153120
     tttatgaaga tatggtctgc aacgggattc aacgtgacat tttgacgtac aacgcgttga    153180
     tatttggact atgcaaacaa gctaagacga ggaaagctgc acagtttgtt aaagaactcg    153240
     acaaagagaa tttggtgcca aactcgtcaa ccttttctgc gctaataatg ggacaatgcg    153300
     tgaggaaaaa tgcagaccgt ggttttgaac tgtacaaaag catgattagg agtggttgcc    153360
     atccgaatga acaaacattc aacatgctgg tttctgcctt ctgtaggaat gaggattttg    153420
     atggagcatc tcaagtgcta agggaaatgg tcagaagatc aattcctctt gattcaagga    153480
     ctgttcatca ggtctgcaat ggacttaagc atcaagggaa agaccaactt gtgaaaaagt    153540
     tgttacagga gatggaaggg aaaaagtttc tacaagaatc ttttaataac tgagaagcag    153600
     aaggtattaa ccaaaaaaaa atcaatttct tttattcagt ggaaaaagag attgatcgtg    153660
     tttataaagg atacagtctc ataaatatta taagagtata tgatacaaca acaaatgaat    153720
     atctcaaatg aatccgaggg aaagtcacac tcaaagaata acctgttgtt ttttggacag    153780
     aactagaata taagcagacg acatgcatag agaagtcgtc actgcaaata aacagaaggt    153840
     tgtcacgaag actcgctagc ggaaaaattt tatggttctg gctgttaaga tttgactgag    153900
     tcacacacag ggaaatctta cgagggtgga agacattatc aacagaggag atgagatcaa    153960
     gggttgatca cagaagtaga agagaggcaa gaaccattgc gaaaacagaa agtagaagag    154020
     atagagtgat tcgggtttgt ccactaggtg cttgtgcatt ggttgatggg gttccagggg    154080
     atgaggttgg ggcttttgcg gtaaccggag gtagtggtgg ctcagtgaca tcagcatctg    154140
     tgaaaaccgg gtttggagct tcggctggag gaaaggcagt aggactcaca agggttaaga    154200
     gggcaccggg ttgggcaggg gccatgtaag gtatagtttc ttttctgccc aaacatagat    154260
     tccctgcaga agagaaaaaa agttaggcat tgatgtaaat aactttgtgt tgtgagacct    154320
     ttggtgcaaa atttggctca cttacttttg tatcttgcag ctgtaaaagg gaactcggtg    154380
     atggttccat ttataccggc tccagtgata taagagttta tctcaacggt tgcatcagca    154440
     aagaagtcat atggttgaga taaaaactca ttctgaaaca gttccacata aactgggagc    154500
     tgagacttct gcagcttctc cacaacattg gtttgcgttg tgatgaacga ctgagcgaca    154560
     ggaaagactg ataatttttg gatcacaaca gcatcagcga atttctttat gtcttcaata    154620
     gcagagtcga gaatatcacg gatgttttct tcaactttgt agacagtctc gtactggctc    154680
     tgcttcttga agtcaactag aaccgagctg tttgttgact gaatcatgac ctttgtggct    154740
     gtactattgc tgtagccagt ctgtgtgagt gtatcaagaa ccgctttgac aacgtcgagc    154800
     ccttgctcct ctctcaggta tgccgcattc tgggggacat aaaagacaaa catgagtggt    154860
     gtggccatta gaagacagtc acggtctgat tgataaaatc gtaagactaa gaggtgcaca    154920
     agtgctcacc tctacactga tcaaaacacc ggagagagag gtggagtttt ttgccaagct    154980
     taggaaatca gaaagtgaga aaagcttccc agcatttttc tgttttggat tcctaaacag    155040
     gctggttact ctgtaggggt ttgaaatagc agctgcaaac aaaaaaagat tggagaatag    155100
     ttattgtaac tcttaagtta tgtatcctct aaaggagcct gtatttttga cccagacatt    155160
     tgcatctata tatgtaatct cttttaagtt actagaaata gcaggaagaa gagtgtacaa    155220
     aacagaccaa catttatcag aaagcaagta gatagcttga agacaaactt acgagtcaag    155280
     gtctggatct cagcccatgt gagactgaaa gtgtatattg caccaagtga gcccaactca    155340
     ggaacagttg ttgaacggtt tctgaaagca gttagggaga ccgtcgtgct gttcccgaga    155400
     tcgatcgaac ttaagcaaaa gggtgtacca tcgctggaca attggaccga gcaatcgatt    155460
     acatcagcac catctttgat tgccttctta tatgccaagt ctgtacatcc aggatagtct    155520
     ccactcgcac catctttggt tataacaaga aaatccactg agacaagaac cataaagtca    155580
     attactggtt cttcattagg ttatgacaag tcatggcaag atacaaagca aaataatcaa    155640
     ctcccatacc ttgttttgta gcgtttctgc caacgtggga gaagcaatct gaggaaaata    155700
     tgaaaacaat gactcaattt tgagtatttc cagcaatgtt ttaacgagaa aatgctttat    155760
     tctgtagacg acactttgct taccaaggga tgcagatgca gttatgggaa aatcagagag    155820
     cacaccatca acagagaagt tgccattgtc cacaaaagat agatactcag agactggatc    155880
     gaaactgtag tcgtgtgcaa tatcaatatc atttgcaaaa cctgacacaa aaacttctaa    155940
     tcctgctttg tgagcatctt gaaccaagga tgtatgagga agcaagtact gctggtcatc    156000
     aagtggcaat atgtaagact tggggacaag aatccctgaa gcaaacgtct tgacaaaagt    156060
     caagttactc aagatagagc cgtaagttct gtttgtcgtt ggctcgaact cgtcttgacc    156120
     aagaaaccgg aacacaagac ttggtccatt acgcccgaac cgaccagcaa ttttcttaaa    156180
     gaagttcact tcaggggaag agatgaagtc aatgagaaca gtttttgaag ctgcaaccag    156240
     aaaactgctc atgctcaaat tgtgctgcgc gtagaacgca tcgtgctgaa catttaacca    156300
     gaagaatgat ggtttcatct gcgtggatac gctttgaacc gtcataatcg ggttagaatt    156360
     accatcgaac ttttctgacc gagataaaat acctcggatc actgcaacac gtgaaaaaca    156420
     caagttaaac aaaatcctca ttacaaaaag cagtagatag agccatggac acttacagtt    156480
     aacatctttg agatctttca aggagaaatc aatggtgaac caaccggaag taggaactcc    156540
     gttaaccggg taagattttt gtcgagtagg gtaaacagct tcaatagatg aagaatttct    156600
     cattgttaaa tcagggaagc aaataccaag agcatctttg gttagctgaa catcacacca    156660
     tagaacagca tctggtacac ttgtcagaat tgcgaaattg taagcatcgt aactcgaatc    156720
     tgggaacaat ccagagaatc caccacgagc tatcacaaga ggaggatcac ctgagcacga    156780
     aattcaagaa agtgaaaaat tttaatacag aaaaaaagag atccaaagta attctatatt    156840
     tggaaactgt ccacaaatgg ctaaattctc acaaaccaaa atcaaatgga gaaaccaaag    156900
     tgaaatttac tatctggaaa gagagaaagt gagagaggac ataccagtga gcgttggcca    156960
     tggactttta ggttttttac tttgagcatg gatttgagca gcaagcagct gaatcagaat    157020
     aacaccacag agaagaagcg atgaagctcg taataaccct cgcattgttg gattgtctgc    157080
     cgggaattcg ttctaacctg ccttttagct tcccgccggc gacttcgccg gagacagaac    157140
     gaaatttaag agagaaagag aggtggagag agaaagagtc ttgttattag ttctggctat    157200
     ttggtttgtg ggattctcat ttatacgatc gttgattaat ttaaattaag tatagattat    157260
     caaaaaaagt ctgatgatta gtttctttct tacaagtttt ttatttaata ttgcagtcta    157320
     ccaaaattac gcgtaatcac gtattttgat tttgtggagg aggagccgag attttggtcg    157380
     ggtcggcttc agctgatgtt gttgttgacc tctttgttcc tcggactctt aatttcaccg    157440
     ggctttgata attcccatat caaaaatagt taaccctttg tgattatata agtcgatcat    157500
     caatacaacc acgtacgtat aacaagaact tttataacaa aaactaatgt ttatggtatc    157560
     gttaactttt tgctttatgc ttgaaacaat tactatattt ttactgtacc actacgtaca    157620
     acaaaaactt taaagtactt gtaagaagat cattaatatg gctaacaatt ggggcccctc    157680
     actgaaatga tgaagacatg aagttgtacc tttgcatgca ttggcattca tggttataat    157740
     atcaaaagaa ccaaatgaaa ttcgttttga tttttatttt tttaaaagcg ttttggtcat    157800
     ttattcactt aaatttagaa atctgaacca accaattggt taaagctgaa aaatgtatat    157860
     ccttatgtca aaaaagaaaa gaagaaaaac agagtacttg attgtcttta ctacaaaaga    157920
     acatattaac aacattcaca attttgtgtc tatattttag ggtaataaaa tgggtcgaac    157980
     taagaaaaaa atattagtac aaatctacaa tgctgggatt atttggtatg acatcattaa    158040
     gacaacagaa aaagagaaaa atcttttggt tgtcggctcg gcgcagcgcc aaattaaaca    158100
     gcaacaaagt ggtgaatgaa taataaacag ctacagaggg acccacaaca tggccgtcat    158160
     gacttatctg taataataca cgtggcgaat atctatttgt ggtcagtcat gacatcagtt    158220
     caaacgcgca aaccagtcac gtttatacgt gggaccgttg tttgctgtaa acacccaaac    158280
     ataaacccta aacactttcg acaatttatc tttctttttt gcaaataaaa acatttcaga    158340
     aggaacgttt ctcactggat gctgatgttg atgttggaat atatgtttta tttgactttt    158400
     aatatactta tttttacttg gtcaacttcc aatacctgtc ccttatttaa ttaggctctc    158460
     taatcatatc attgacctct atcttgtaaa ttatacgttt agggtggttc atttttgtat    158520
     tgcatttatt ttctcagtta tatttatcaa atcttctata tatgatggtt cagtcgattc    158580
     gagattcgac gaccaacata cctggctgtc cattaggatt attaaaattc aattcttgcc    158640
     accctaaatt attggaacct tacaaaacat atactagtat ataactatat attgtcacga    158700
     tacacatgat cgcgcggttt aaacaagatt taactttaaa actaaacgat attttttggt    158760
     attttgtggg aaaaaataaa acaagatttg gagacaagat tttgtcctaa cgataacgat    158820
     gaaaaaatga aatcaagtaa actggaacac atacattttt ccaactacgt actaaaaata    158880
     atgagcattt taatactata tagttgcctt ttaacactaa ttaatttatt tccgatttat    158940
     gtatatctgg tgattcttgt caaatgtaaa agaacgtaga tatctatttc tttcattata    159000
     aaggctcgac tctcctatat acatatagac tcatgactat tgtctgttag ctagatgtac    159060
     attatataat atacacatga ataaacatag atgtagttta caaccaagca aacgagacta    159120
     atttcatatt ttatactacc ttttttataa cattagcgac aaacattcag ttaagaattt    159180
     atataatttt gaaataattg cttccaaaca aacacaagtt gggaaataac cactaataaa    159240
     aagttaaaga aacatcatac acaaaacttg aagttgggca tgtgcatgtg aaggaaattt    159300
     tttatacttt atagaccctt ttttgtcatc atttacactt atagatatta tagagtgagt    159360
     gtttgctcaa aagaaaaagt tattaaagag tatgatcatt tgcaacatgt tactgacatt    159420
     tccttcttcc atattttgta tagttttttt atttattttc tcgatcgaca atgggccgaa    159480
     agttaccaca gatatgagag cttgagaaca gaataagatc ttcaatattt aaactaagaa    159540
     aatgtgaaca agggctccac acttatgttc tttgttctaa aacacgtagg caaaaggttc    159600
     cctctaactc tctaagcatt ttagatcaaa ttgtcatcta tgaaaaacaa agctcaaaag    159660
     acgctttatt tggcttgaat caacaacata tttaggtact tcttgtcaca agttttttag    159720
     aatcacatgt gctaactaca tacaaggaca caattacact atactaatac tacaactgtt    159780
     tgttctttgg gttagaagca acttagtacg ttgaccctca aaagactcgt ttcacgaaac    159840
     acgagttaca ttaatatttt tctaatcgaa ggaaaaggaa cgaaacgtaa taatgccgct    159900
     taacccacaa actcagtctt ttgcttaggt agacccaaat gcatcctttt agttctaagg    159960
     ttccgcaaat cttgtcacaa tctggttcac cgttcacgca tacggaaact catacggcta    160020
     aaaaaatgtt tgcatagatg aattgaacat gatccaatat aatgttatta aacgcatacg    160080
     gctaaaattt tgacatgtca agggaagtga cacgtagaca agtcgttacg ccatgaggtc    160140
     agcgtccttc gtctacgtgg acacactgca catccacgtg tatccatcaa aaagcgagtt    160200
     tcgtaaacct atgcttacac tcgcgcgcgt gatattgaga tgttgatccc tctcaattaa    160260
     gcattcaatg ccactgagcc taatttcccc gcacgaaaca tttactctgt ttttttgttt    160320
     ccctccttct acgtttctct gtacacggct ttcttaaatt gctcacacga agcagataat    160380
     tcgtctctct atctctctct ccttgcatca ttttcttcgt ctcattggta ttgattgatt    160440
     cacgtgactt tgtacattgc ggttaagttc ttccgtcttg gtcattccac atgttgtgta    160500
     gtgttcaacg ccgaattttc cttcacccga ggttagaggc ttgcggattt ttctgtacat    160560
     tggaattagc ttcgatgttt cgagattagt gttagaaata atagtttgcg tgttaaagtt    160620
     cttatctttc ctgatttggt cggttacctc agttttgtct tgttgtgaga tgaatccatc    160680
     tcttgctata ttaaggacaa atcttcaaat cggtgatatt ttgcttcttt tttttctcgg    160740
     ccacagatta aaatcgtcaa attatctgat ttttgatgcc ctgaagcttt agcttgcatc    160800
     tgtagtcatt tgtcaaagat aattgaacag aggctttcta tattcgtcgt caagggttta    160860
     ggagattctg ggttttggcg tgattttgag gggaaagatt gaaactttcc ccgtgaatgg    160920
     taagacagtg agagatgtct gggtacgtgg gtgttgtcgt ttctgatcca tggctacaga    160980
     gccagttcac tcaagtcgaa cttcggactc tcaattccaa ggtttcttct ttttcactgt    161040
     tagtccttta tatatacatc tcttgtatgt aatcttgttt gatttgtggt gtagtatgtg    161100
     tcggtgaaga atcagaatgg aaaggtcact attgaagatc tccctcctct atttgcaaag    161160
     ctgaaggcac ttagtgcaac atttaaggaa gacgaaatca agggtatgct aggggaattg    161220
     ggttctgata caagcactga tgtgagtttt gaagagtttc tcaaggtata tggaggttct    161280
     acgtttcatt ggggaatcga ggattggact gagtatgaat gtgatatgta tataatgtag    161340
     ttttggattg atccttatgt gcagatatat ctcaacttac taagtaaagc agctgagaaa    161400
     tctggtggtc atcataagaa ctcatcctcg tttctgaaag cttgtacaac gacacttctt    161460
     cacactatat atcagtcgga gaagggtcct tttgttcagc acatcaatag atatctaggg    161520
     gatgacccct ttttgaagca gttccttcct cttgaccctc attctaatca attgtatgaa    161580
     cttgtgaaag atggtgtcct tctatggtaa ggtgcactag agtccatctc tacacagaat    161640
     gcatctgatt tctgcctttc acgtgtttct ctccctttat ttccggcgta gtaagcttat    161700
     aaatgtagct gttcccggga caattgatga acgagcgatc aacactaaga gggtacttaa    161760
     tccgtgggag agaaatgaga atcacacgct ttgtctcaac tctgctaaag ctgttggatg    161820
     ctctgttgtt aatattggca cacaagacct ggccgaagga cgggtatgtt ttctctgctt    161880
     agtattcagt gtacgtttga aaatatttca acacacatca ataagtgtaa ttatgtgcac    161940
     cgttctgacc agtgagcttt tatgatgttt tgcagcctca cctggtgctc ggattgattt    162000
     cacaactcat aaaggtccgc acacatccac ttgtccgctc tgtatatctt agttttattt    162060
     tttttgtgtt aaccaaataa tgttggaaac tgcagattca agtacttgct gatctcaatt    162120
     taaagaagac gcctcagctt gttgagttgc ttgaggacag cgatgtaagt gagctatacc    162180
     aatcacattt tcagccattt aattgctctt gtacaataat ataacaagtt tctctctgtt    162240
     gcaggatgtc gaggagttgc tgagattacc ccctgagaaa gtcttactga aatggatgaa    162300
     cttccatctt aagaaagggg gttacaagaa aaccgtctca aacttttccg cagatttgaa    162360
     ggtatttggc ttctcaaact acaacttgga ggaaaccttt ctcctttgct tatccagatc    162420
     tttagttagg cggttctcaa ttcaagattg tattgtactt acgttctact gttccttaca    162480
     acatgtagaa gctatatcaa ttcttggata agagaaacaa tatgaactat agaagtcata    162540
     aaagaaacag aaattttatt cttactcaag gttttggtaa tgttatggat ggagtttgtc    162600
     ctcatcaagt tttttctatg ataaagcgtg ttgctggtaa atctgcagga tgcacaagcg    162660
     tatgcctttc tgctcaatgt tctcgcacct gaacactgtg acccggctac actagatgca    162720
     aaggatcctc ttgaaagagc tgaattggtt ctcagtcatg cagagagaat gaactgcaag    162780
     cgatacttga ctgcagagga gatcgttgaa ggatcttcaa ctttgaatct tgcctttgtg    162840
     gcacaaatct tccatgaaag gtttgtatcg tgatgcactt tcatctccca aaaagctcct    162900
     agatgatggc ttgtcctgtt tgattaggct ggtgatggtt tactcaaaga acagactctt    162960
     gaatgttatg gaaaaaagaa cggggaaatg gttttcaact tttcgtacta ttatcaatga    163020
     ctcatagctt cttacctgaa atccctttac ctgaatattt ttccacttaa gtttttttat    163080
     tgttttgttt tctacgctct caattttact ctgcctgtct gtacctcttg caggaatggt    163140
     ctaaacaagg atggtaagta tgcatttgcg gagatgatga ccgaagacgt agagacttgt    163200
     agagatgaac gatgctaccg gctatggatc aacagcctcg ggattgacag ttatgtcaat    163260
     aatgtatttg aagatgttag aaatgggtaa tctttatttt gagcttatag taaatcaagc    163320
     aattagtaga aaattttcct gcagttgatg acgttgcatt tggaaaatac tgaaaacgct    163380
     ctttggtcct gatgcctttt gtttgttcca tttactattt tatgcagatg gattcttctt    163440
     gaggttcttg acaaggtctc tcccagttca gtcaactgga agcatgcttc caaaccaccg    163500
     attaagatgc cgtttagaaa agtagagaac tgcaatcaag tcataaagat cgggaaacag    163560
     ctaaaattct cacttgtaaa tgtagctgga aatgacatag ttcaagggaa taagaagctc    163620
     attcttggta atcattaccc gagagctcat gtttctctta gcttgataca aaaacatgat    163680
     cgccttgcct tacaaactgg agatttatat ggttgtgtat ctcaggtctc ttatggcagt    163740
     tgatgagatt ccatatgctc caacttctca agagtctcag atctcggaca ctaggtaaag    163800
     agatgactga tgcagatatc ctcagctggg ccaacaggaa agtaagaaca atgggacgaa    163860
     aattgcaaat cgagagtttc aaggttcctt tctttacaac tacttcaaac acttaccaca    163920
     atagtattat ataaagtatg tccacctatc accttctagt gaatcaaatt aaaattctcc    163980
     aggacaagag tctatcgagt gggttattct tcctcaacct tctatgggcg gttgaaccaa    164040
     gagttgtgaa ctggaatctt gtcaccaagg gtgaaacagg ttttcactac tctttttact    164100
     aaggtatagt tacttactcc gtttacctga atcaaagctt atttgattat tatatggtta    164160
     ttgaaacgta cagatgatga gaagaggttg aatgctacat acatagttag tgtcgcaaga    164220
     aagctcggtt gttcggtttt cttgttacct gaagatatcg tggaggtaag aactgagaga    164280
     ctataatgta tcatcatccg aaatagcaat tgctcagatg agatgtgttt tggtatgttg    164340
     tgacaggtga atcagaagat gatcctaatt ttaacggcaa gtataatgta ctggagtctt    164400
     cagagacatt cacgggagag ttcagattcg tcgtcaactc agagcaccac aacgacgtgc    164460
     accagcacag cctcgtcccc tgccccatct gtcacagaag aggaggaagt ctcctcattg    164520
     agcggtgaag tcacgagctt ggccgttggt gatgcggttt ctgaaatcac cacggtctca    164580
     gaggaagcat ccatcgaata gagagagcga gatcacatat atactgatat acatctcttg    164640
     ctatagcaaa gtagctgtta taatagtgac ttctctgtaa tcttttgttt ttttgtttca    164700
     tcaactaaaa ttaccaaaaa taataacaat gttacaaaca ctcaatcaca tcgagaaaag    164760
     taaagtaaaa ttgtgaaaat ttgtttagta cttaaaaagt taggaggagg aaaaagtgta    164820
     catcttattt tgaaaacaga cactacgcaa acaaccatgg atcagacgac gatgatccac    164880
     aacagtcaag gcaaacaaga gatagatagc tcaacagacg atgaagatag agaagatgga    164940
     acgagacatg cagacaaaag aggacttgaa aaccgtggcg ttgggcacct ctaagatcaa    165000
     ctacatggat cctaggatca cggtcgcatg gtgcaaacgt catgaagcac ccattgaaaa    165060
     ggtagttaat tatatacaaa acttgaatat tgatctacca tgaaacaaag agagtcctct    165120
     aataaagttt tttttttgta atggctggtt cgttaatgta gatattcaac aagtcacttc    165180
     tggagaaatt tgcgtgggca atggacgtag aacctcactt cacattctaa tatgcattgc    165240
     actgcagcag ctgatgagag tttctctata aaacagagca aagcaggcta catttttttt    165300
     cttccaagta gataaattct ttttgtttgt atctttattt gagatcatgt cttctttttt    165360
     tttcgtatat acaattgttc attgtttgct tgaattcaaa tttagtctgt tttataaaaa    165420
     atgaaaccat aatctttact attttaaacc ataaaaaaaa agtcaattgt aaatacaaaa    165480
     caccaaaggc caattaagat ttattccaac tggaaggata gagcaaaaaa aaaagaataa    165540
     tctggcgcaa aaatgactta cacaaatcaa taagttttcc aaattttgtt tctttagcag    165600
     aaaatcaaaa atgttatttt ggtcacaaat gtaaaaattg gtataaacaa ggttttaaca    165660
     aaaaaagaaa aatatatata tacaaaggca aaattacccc tgagaaaatc tggggccttg    165720
     acacgacgat cctccatcat cctcttcctc gaggaacttc aattccaatc tgtgagatct    165780
     ctgcacaaca tcttgtctat tttcaatcga aacctctgtg agatcgcttt tgatttttgt    165840
     aattctcgtc gcaggatatc tctctcattg ggatcagaca tggcttttgt tgtaacatcc    165900
     ctgatattcg ctgtcgtagg catcattgct tcgatatgca ctagaatctg cttcaacaaa    165960
     ggcccctcca ccaatctgta tgtcaatttt cattcctttt tgcttcttct ccctttgatt    166020
     tagtcatctt tttgctgtct ttgatccatt gcttcgtcaa agttaataaa gtgttcttcg    166080
     gtatcaattg agatcattat ttatctctct gagcttagaa actattattg gttgatgact    166140
     ttatatttgc tcattgactt ttgctaattt gtttttgaat ttgttccttc ctgtgatggg    166200
     tttttttcaa tgtaagcaac tagtaccgtc acagttctaa ctcttgtgct ggaaaaagtg    166260
     ttgatctttt tccctttttt tatcattgac ttcttatgta cttgtttgtc ttgtttctat    166320
     gaaacaggtt acatcttaca ttggtcatca ccgcaactgt ctgctgttgg atgatgtaag    166380
     tttatgtttc atgcactatg tttcctctac ttgctagcca ctgctttgca ttcacaacca    166440
     tgggaatttg tatccagccc gttatttgtt tatccaaccc tctcttgttt gattgttgct    166500
     gatcaacatt aaccatcaaa ctatcaagat atagatcctt ctagccttta ctacttccat    166560
     ttttgttgtt gataggataa cgtaatatct tgacacttct catttatctg tggaacttat    166620
     ctctagtcaa tgaattagta ttcatgttaa gagaaagttt ctacaacatg aacattattg    166680
     gtcttctact aaacgctgtg caaatccttt ccttatatgc aattcattca ttgtcttaca    166740
     tatcattaca tcgtttttgt ttcttcgcat tggcaggtgg gcaattgtat acattgcgca    166800
     gatgaaccct ctcattgtcc ctatcttaag cgaggtggag tagaaaccat tctactcaaa    166860
     ctaggaaacc aatgcacaaa tttgagtaag agccccgctg ctctttctgt atcttcttca    166920
     aacatatttg ttttcccctt tgtaattctt atcgtggtgt ggaacaacga aactatcccc    166980
     ctctttactc aaacatattc tgtctctcat tcaattcttg aacagttttc atatactcaa    167040
     agactctacc agagagtgag tgtattgttg atgaaataaa aacatttggc agaatattcg    167100
     ccatttccca tcttcatctc ctaccaagga aggaatttta ggattttctt tttgttcatg    167160
     gcaagtttct atcagaacca gttcgatctg acatggctgt caaattgtcc taatgcttcc    167220
     ctgtgaattc tattgatata actgtgagct ccaaaactgt ttgaggtctt atctcctaag    167280
     aaagtacaaa cttgaatcag gacaaaatca ctctttaact accaatacac aaacactctt    167340
     ttgactacag ttacaccaaa accggaaaca acaacaacaa tatctttttt agacaacccc    167400
     agttcgatca gtctttgtgg cctaggtaga gctcgcctga aacaactcta ttgtatattc    167460
     ttctgcactg caacctaaac actgaacgaa tagtaattct cttcctcttc aacggagttg    167520
     aatattgacg ctagttcgac tttgggaata aggttttcga agttttgccc attataggaa    167580
     gtaatcaggg gccggctttt tggcgggagg ccctctcgag tcctgcatat agaaaatatg    167640
     tcagtctact tatctgctca acgagatcag aacgggaagt aacatattac taaaagggtc    167700
     atacctgctg ggctgcatca aacacacgga attctttatt tagattctcg tcaagctcta    167760
     gaattgaagc cacattaccg catctggagc ataagtgaaa taggagtaaa aatcaagcta    167820
     caagaaatga ggatagatag actgaaacag acggctctga gaatcttatt tacctgtaac    167880
     agtaatttgg ggctgaccac actgtcacaa tctggctatc aaacatccat ttgtaaccct    167940
     ccataactag ttgatgggca cgggctatgt agtctatgtt gtttgagtgg ttaaaagacg    168000
     tgacaacact gccaccaaaa aggaatccgg caccacgagg gctcaatccc cagccatcaa    168060
     caatatcttc aggatcagac cataggagat cacacatggc accatcatgt ggtacttctt    168120
     gcttccggtc aattgtccta atctgccata aaggtatggt tccgtcagtt aactaattct    168180
     agttggaaac ttgtaattat cagtagagag agctcttata tcaacctgat caagagtcat    168240
     aatagctgga gaaagaccac catgaacaca gaatatcttg ttctccacaa cagctgaaag    168300
     actataagaa aagacagatt aaagagtcgg aatattccaa agacaagtca aaaactgaat    168360
     ataaagaaag tgaatgctgc tttgaatacc tcatgtagtc aaaaatgtcg gtgcagtatc    168420
     tccagacatt tgaagagcca tatttacgca aacactcatc ataaaatcca taaacctact    168480
     aaaagcagac tttatgaata gtctgaatat atacatacac aaaagcaaaa ttttcaaatg    168540
     agactgcatt cacctgtgtg atttgcctgc tttcatggtt tcctctgatg agagttatgc    168600
     ggtctggata tctaacctaa gaatatcaaa gcaatctact taagcgattc caagaaccaa    168660
     tttagcagaa gagattgtgc aaaacaagga aaccacaaca aagtaaaaca cagtccagag    168720
     agttaccttg agtgcgagta gaagtagaaa tgtctcaacc gaataatatc cacgatcaac    168780
     aaaatctccc ataaacaaat agttggtctt aggacaatca cccccaactt tgaaaagctc    168840
     catcatatca tagaactgcc catggatgtc accacataac tatcccaatg gaaaaagaaa    168900
     gacaagtatt agcaattctt gcaaatcata agaaacatca atggtatcta ctctcacttc    168960
     ttaaccctgt aacttcactg cccgtgaaat cttttgactt gtaacaatag caagaaacaa    169020
     aaacaagtct ttcactggat cctaggaatg atataccatt tgatacaaca ttacgaatcc    169080
     aaattataaa gacacaaaat ctccgcgcct attttcttca gatttattga ttaataagct    169140
     cataattccg aaacccagat cgagaagtaa ggtaaagtaa gaacttacag tgacaggggc    169200
     atcaactctc tgaacattac tctcttcaac aagaatttcc atggctttga ggcaaagagc    169260
     cttcacctcc gattcgctca atggttcgca tcgcttaagc tgccctattt gccgatctag    169320
     gtctgacatt tttacctctc ctctcctctt cttcctcctt ctattactct tcagccaccg    169380
     gaaacgatcc ttaatctgat gaataagaag gaatcaacca accctcgcca aaaagaatct    169440
     gatattctcc actgtcgaat gtattaagct cgtcgtcttc ttcccaagga gagagaatta    169500
     gctcctctcc gcaggaatgt tttttccccc caaggttttt ctttccctcc ttatggttta    169560
     gattattttc aaaatcgcct cacttctttt ctgaaattac atattcgtcc agaatgtgtt    169620
     aagttcacat aatgggccca gaatataact ttataaggcc cggcccacat atatcaaagc    169680
     ggccattttc gtaatttctc cacggcgaga agagaagata acggcatttc gatcggagtt    169740
     ttgatcggcg acgatggaga gaaacgttga gaagatgctg aacagagttt cagtcgtgtt    169800
     cttaagcatc ggaacagtgt taatggtgat tatgattctc cagacgccaa aacttgtatt    169860
     tcaccagaag ctccatcgaa acctcatacg cattttctga gatctacatg cgattcatcg    169920
     cctcgtcagc atcttcctct cccaaagaag aacgctcgaa tctggttctc tggagcttgg    169980
     aaatcgcgtc tatcctcctt ctctacctac ttcctccgat ttcgcgatct cggattcatt    170040
     caaaatcaca ccaaagctct ctgtctttcc gacggagcag gccatgctcc gatggctctt    170100
     tctcagatcg gattatccga cgttaccgca gttgaattgg ttgattcgat tcctcttgtg    170160
     aaaagagctg atcctcataa ccttccgttt ttcgaccgtg tctttgattt tgtctttact    170220
     gcacatctag ctgaagctct gtttccgtgg cggttcgtgg aggagatgga gaggacggtg    170280
     cgacgcggtg ggttttgtgt ggttgcggtt gatgaatgta gtggagatga tgttagagac    170340
     attgctaggt tttttcataa ttccaagatc gttgatgttg ctaatgtaac cttagaaaga    170400
     gtcaaaagaa ctagtatact attcaaactt caagactcta aaaggactag tatactattc    170460
     aaagttcaag actctctttc atgaaggtgt tttaatcttt tcttcttttc ttttaagact    170520
     ctccttcatg aaggtgtttt aatcttttct tcttttcttt tgattgcgtt gattcatagg    170580
     tcctttctgg attctcagac tgcttcaatg ttcatggagt ggagttaact ttgagttaat    170640
     gtgaccatat atttcgttac actactatag agtaagtcag taataaattt agcaataata    170700
     actaacagtg taaaattgga aataacagaa aaaggggttg gtacaaagag agaccaaggc    170760
     aacaaaacat acagaagctt ttctttagag ctgcaactta tagtataacc atacagaact    170820
     ggaaaaacaa aaacaaacat agatctctta gaccaaaagt ccatactact acccgaacct    170880
     tcatttaccg tataggcaca agcttcacat tgatcgatta ttagcttaaa atggctcgat    170940
     caattactta acataaagga tacttttagt agtatgctgt cttgtcttca ctgataccag    171000
     cgtagatttt ggcacagtac tcgaacaagc ttccatcgaa acaccgccta atagcttctt    171060
     ttgacaaaaa cccttcttca tcccttgcta gcaagtacaa cagtccccac tctattttgc    171120
     ctgcgatcct aatacataca tgtagatcca aacattataa ctacaacaac attgactaat    171180
     actttagttt aacacatgca ttcaataaac taatgaaagg gtaagaaaaa ggaaggctaa    171240
     tgctgtgatt gtaccatcca aaaatgtccc aagcgtcacg gtttccttct gtcatctccc    171300
     atagttctcc aagactcaac ttgtctggca aggttttcgc atatttgcta aatatcaact    171360
     caagattcac cggcataaac ctgaaaagca tacggaagtt ataccatatg catcagtcat    171420
     catattttct atcagtcaac cgtttttttc aagataatat ggtcactcac cttccttcat    171480
     tgtcatatgt ttttgaatca cttccatgct ttgacttgtg tatgttgtgt atgtatatag    171540
     ggaagaaagg tgaaggtaac cacccctgca tataatcaag tagaacacta acaaaatgga    171600
     caacggattt ggatatgata atttccgagt ctagagtaga atcaatcaaa gttttgcgat    171660
     atatgtcagc agaggaggag aggtgttacc ggaagagtgg catagctaag ggtcaggttg    171720
     ataacagcgg ctattataag cgacccaatg atattgaaac caagcattcg cagtcctaat    171780
     caccggttgg gatcaacttt ttgtacatat aatactaacg aaaaatttga agttgaaata    171840
     tctatatata ctatatagac ataccagagt aggtctccca agggtaaatg atgccattat    171900
     catcgatatc gaagaaggag acatgctgtt gaagaacact aagtccgtaa ttcttatggc    171960
     ctggagttcc gtacgggtgt tctctgtctg gtgcttgcaa tgctcttggc atatctatgc    172020
     ataacacata taagatcaaa atctgtatca tttccacgta tgtgtaatgt gtgtatagaa    172080
     ttattcatgc acgttcatgg gtaatacatt attaattacc atcatataca ggatatgtat    172140
     cattttacaa tttatagctt ctataagatc atgaacatca ttctatatgc atgttttaaa    172200
     aattttgagg gtcggcaatt ccatatattt aaaagggttt cttaaattca accatatatc    172260
     aaatattttt tggcatgcaa tatattgaaa tcaattaggg ataaaaaaat gcaagtagcg    172320
     agagaaaggt tttacaaggt ttaggaagtc tatcatccaa gtcaacacga gcacggcgat    172380
     ggtaagtgac cggcgcatag ggagccaccg tagccattgc gtctctctcc atcatctccg    172440
     tctttgaccc catctctctc tcactttgtc tctagactga gtgcaaatgt atgtgtttgt    172500
     cttagagtaa agagtataat gaggtaataa taataagaat cgatttgatt gatgtgcgtg    172560
     gcggacatgc acgcgccgac gaaagcagcg attgacatct ctctttcctt gtctttgacg    172620
     cacatctctt ctctcttcct ctgtcttaca cttgacatga ctctagagac acgttttctt    172680
     ccatgtttca tcactctttc tattcttgtc tgctaaattc agtaattcgg gcctctatgg    172740
     gcttttatat aggcccaacc tcgagtacta acaccacccg ctacatgagt gcgtgtccca    172800
     cactcgctct ttacgtgaag actgaagagg aactccattg cctatgtatg tatgaatgta    172860
     cacgaagttg caaggaaaat tttatgataa taagaataat tcacacaaat tttctttgta    172920
     aacgaagtct gagcctgaaa agttaataaa caaacccaca aatgttgaga acacacacac    172980
     gcactaacat caaccccaag tgtcatagat tagatataaa attcagtgac cggcaccggc    173040
     cgatggattt gttagcaact caagtgactt cttgagatgt tctacagcag tcgagacttc    173100
     atcaaaagcc aaagctccca cagcgaatct agcagccttg agtgcctctg caaccttctc    173160
     aggccctggc tggtagctgc tatcgtaatg gtacttctga gctgaactcg gtgcaggatc    173220
     tagcacggga gcaatattga tacgcccgtt tgatgagtaa ggtggaggag gaggagcaga    173280
     ggagaagctt gtggaagaag gagcaggtgc agagtgcgga gaagaatagt aaggttctgg    173340
     gttttggtag tgagaagggt agtggggaga agtggatggg aggctgctct cactaaagct    173400
     aggataagat tggaaattag ggagagaatt tggagaaggc tcatgagatg agtagttttg    173460
     cggtggcggc atgtgttttg gcgggtcttg gtggtatggt tgatgactgt aaggatgcgg    173520
     gtaaggggag tctgatggtc ctgtgggagg gggaagatga tcgttggaag ggtaagaaga    173580
     cggtggtgga ggtgggacat ctgcgggata atcgttggtc ggattgtcat aaaacctggg    173640
     aggtagaggg tgttgtggca cttcagggaa ttgatggtgg ctggagtcat cattcgagtc    173700
     atggggtgga tcaagctctg ttctatgatg acttgttgtg ttggtatcac ttgcactgtg    173760
     atcctgtaga taattaacat gcacaaacaa tgaatcgatt aagttgatgc agacgtttta    173820
     tcatagtgtt ttgacaattg agaaaacaaa aacctaaaag tacacaggtg ggtgtgaatg    173880
     tgtgtgtctc tagctagatg attttgatca gcgctatgcg aattctataa acatttacgc    173940
     tcctaaacac ttttcgatat tattggacag aatacacgct aagccaatat caagatattt    174000
     ccaatccata aatattcaag aagagaaact tacataggag ccactaggac cgcttgatgg    174060
     gatggataaa tcagtatcat catccacagg atcacctgga gtgggcttcc ttccttcttt    174120
     aatggctttc cttatgtcag cagccttcca agcagcatac ttgtgtttct gctctatctg    174180
     ttaatgggag ccattacata tatacacata tcaatctccc aacacagctg cctcttaagg    174240
     tgatgttaag tgaataaaaa aagaagtagg aacttacatc aggaggtacg ggaccaaact    174300
     ggctcagaat ttcaaagaag atgctcgcag cataaaaagt tttggcagtg cccctgtcac    174360
     aagcacaaca aagttaattt ggataatcca tcgcaactcg gaagcctatg taattgagtc    174420
     aaatgaatgc aggtgttagc acttataaaa taaggataca gacagtaatc gaactaatat    174480
     cagtatccaa ccatgcatag aaacacatca atgctggaga tacaggtatt tcgcaaaagc    174540
     agaacaggta gaagacaaca ggtcgagata agccttggat gcatccaact aattacttaa    174600
     cccgctatct taaacgatgg tagaggaagg tatcacctaa aaacatgtct gccggacatg    174660
     catactcatt gtaaatgtat gtgtacttgc acgctatttc cagtattggc aaacacaata    174720
     atactagaca gacaatgaat ctatagaatc atgctaattc gactcattga gctagtgttg    174780
     acggtgaccc taaaattatt agaaacttga gggcaaaaaa aatgccattc tatatataat    174840
     caaacataag agcaaaaaaa attcttacaa gtctgctctt cctgcacgat cctgcttgtc    174900
     tgccttagca aagacactaa gtgcaaaccc ctccacatgc atattgtcat ctggggacag    174960
     agtcaatgat tttttatcct ggagttacac aaaaaagaaa tcgccataag aaactggaac    175020
     taatcaagaa attgcctcat gaactctgtc aatcacatga acaaacctaa gctaaattta    175080
     gatataagcc tccttaccaa acacaaacat aaataaaaaa actccagctt tgtaacaagt    175140
     aacaacatat aataatcaaa gtcaaacaca tcatgagaat tactaagaac cggtcctttc    175200
     aaatctaaac aagtaaaaaa tcaaacaagc tgaaataaat cagaaaaact cacaatttaa    175260
     aacttcaaag gtaatacctt ttcgagttga ttaatgagag acatgagaat cgaattggtg    175320
     gtcttagttc tctcgctctg cggaatcttc aatcctcgtt ccattgcata tagccgacct    175380
     aatcaatcac aaaattccat gaatacacac aatcgcagga ggcgatcatc taggttagat    175440
     atagataaga aaacgaaact cacagtaata agcaacaagt ggttcatgct tctgcagctc    175500
     atcggcacgt tgcaggtaag gcagaagagc cctggctggt tcgtttgggt tcgacataga    175560
     ttctctcttc tctcgagctc cgtagctttt tctccgattg atttgttaag acaaaacagc    175620
     tcaagaaatt ttcctgtatt taacgcgctt ctgattgcaa actagaaacg acgtcgcaga    175680
     aaggacctct aaaatcccaa accttcttgg aaacttttta aacttttaaa tcatgcccaa    175740
     aagatctttc agtatattac aattttgccc aaatattatt tcgtaattcc aattagaacc    175800
     ttgactttca ttcactaaac cggtcacttc acattagtca tgctaacaag taccaaacaa    175860
     atttgagtga atgaatacag aaacagaaac atctaagtaa cattctactc tcattgtctt    175920
     tgtttctaag tgtttgtttc ttaaacagca ctattagcaa ctaacaaaag tgtaagtaag    175980
     cattataact ctctttcttt tgatattgtc acggtgaagc catcactggg tcagcacgag    176040
     agactggaga tgcagcatca tcttttgtgt tggctacaat gttcgaaggt gaagctatct    176100
     tgttcagact gtctctcttg gacttgcttc cgttctggtt tgagttcata gacaaacgcc    176160
     tcataggagt ttcgttgagc cctcctccat tgactcgtgt tcccaccggt ttcttggcac    176220
     taacgggtct tgcagggctt ggtttagacc caaaggcgga ttcttgatct gtgtgtggct    176280
     gttcttgctg cttcttctgt tcctgttaat gaaaaggcaa gattatttta aaagaagtta    176340
     gtttcaacaa tcggtttaac acaggatgaa acaacttact ttcagcctcc gcttctcatc    176400
     ttctcgttct tgcctaagca tagtgtattc atctagcatg gcgagtaaag gaactccatc    176460
     gtactcaaag gacatactgt tctcctcttc ccatgcccgg gttttagcaa tcaacgtgtc    176520
     aaccatagct tgcacaaaca aagtatgata tattcttcag tctcagttta attctatgtg    176580
     tagtaataac taagagagac ttttggaagt tcttaccagt aatcttgctg accagaatcc    176640
     gagctttctc agctctcttg agattcaaat gcgcacctcg gcttgcacta tacctgttct    176700
     gatcctgttt ttccagaaca aaaacccaaa agaatcatca attgaactct atgcttaata    176760
     agtaatgtgt ttattaacat agccaatgtt agcatactcg attgtaatct tcgagccagc    176820
     tctcttcctc acaagctgac atccatttct ctacacggtc taaaatttct tttctactaa    176880
     aggcttcctc cttggccttt gcgatctggc tatccatgtc agccagtaac tcagtaggtt    176940
     cagtattccc agcatcaatc aacgacatga tcctctcacg aacaacctct ggttttattt    177000
     ctatgtgagc acgagcatat atctcctcaa gctctgattg ctttttgaat gcaatttcct    177060
     tcattctgct agatttcagt tgatcaagcc tatccacttc cacctcagcc ttcaagagtt    177120
     cacagaagat ttttaaaagc agtacttatc atacacattg attgatacat tacaaattta    177180
     cgatacctgt tcgataagat caagtgcgag agcaccagag gcagtcactt catgaactga    177240
     agctgaaatg ttagaggtaa catggtcaaa aagctccctt tcctcatcag aagtatccat    177300
     cagattccat agatcagtta gctgagtagc tagttcttga agctgcataa aaccaagata    177360
     cattaatgaa atccacaaac aagaatggtg cagagaaaag ttacaaactt tcagcgcaat    177420
     taatcagaaa ggatttcaac atatgtgcag cctaaactga ccaagctcat gtcagagatc    177480
     acaaagacca tgattttgac taaccttctt aagtctttgc attttatctt ctttaagagt    177540
     caagacagtc ttagccaacc ttgcaagtgt ttcattgcta atgctcttgg tttgaacacc    177600
     atttgcctca tctaagctcg gatgaacttc ggtgacagtg cttaagaaat ctaaacgaag    177660
     gacggcacat agatcatgca ccgtgctcac aaactcgagc accttctgta acctatcact    177720
     ctgctcaaac acaaagcagt tttagttctg gtttgaacat aggccacaca taaccatatc    177780
     ccaactaata ttttaccttc tctttctgga gctcttggag tttcctctgg aagtcatcta    177840
     atctctttag agacaagtca gtctcatcaa ccacatgagg tccattgttc aatccgccag    177900
     cgatctcctc acatatcttc tgaatctgtg attgtacatc agaaaatgcc cggacccttt    177960
     cctctttctg ttgccaaagt tgttcaagcg caggtgctat tgcagaaagt tgttctttga    178020
     tcgttcctga agtcttatca ggctgcaatg gaaacaaaga cattgaatca cactacactg    178080
     taaccatctc atctctttac cacttgtaag acgtgagatt acttacaatg tcgatatagc    178140
     ttttttcccc gagagcagtt gtgagattgg aaagttcaac agtggcatct gacaaagtct    178200
     gaagaagctc tgcacgagat tttgcggcta gctcaacttt ctttttgtaa acattcagac    178260
     actcttcctc aatctgtaga agcagtttgt ctcgttcttc atcactctcc ccaacctcat    178320
     cccagatttc ctgtaacaag tttgtacatt gagtttgtgg aaccatatat taaaaggata    178380
     agtgtgtatg ttgcgaaatc tacctgcaac ttctgtagta aggtgccaca agtgatttca    178440
     ccaagaagag gattttctgc ttctgtcact gccattcttg tgaagtcaaa aggtttccta    178500
     caaaagtaga aacaacgaac atatttagtg aagatccaaa ctaactatac actaaaagaa    178560
     accaaagttg caatcttttt tagaaaacca aattgaatca gaaacaacat tttgaacttg    178620
     ggaacaaaaa cacatcaaag aacttagtga agctaagaat gtgaaactaa gctcaagaaa    178680
     agctcgaaag gaacttcaaa gaaatcaaac agcattggtg ataaaaccaa agccaaagca    178740
     agaaatcaac attgaagaag taaagaggca atgagctgaa atgaaactaa tcgaatccaa    178800
     caagtagaag atggctttct taccttaatc gatattgaat ccaaatggtt tatcttcctc    178860
     tcttttagat ctgaagcgac gaatagtcac tgtgagagta agagagagag agagcatagg    178920
     aaacagagaa atctccaact ttggttatgg aggttgggaa atgggaaaag tgggacccat    178980
     tttacggaac tcaataatta atgaggaaaa aacaacagca aaaaggtgag agaccctgtc    179040
     ttttcgcgtt atttactgat ttgaccactg atctcacaga cctcgttgac tcctcatgct    179100
     catgtctgaa tagttaaaag gctttcctta atgggcttaa atatctgacc cagcccaaac    179160
     agatcaagac aacacgtgtc actcattccg ggtttaaaca tgaagcagcg acatgaatag    179220
     tttattggtt ctctcttccg atgatttgat gaaacctcac cgctaagtgc tcatccacca    179280
     ccttcctcct cctccttctt ccctcacctt ttgagtttct ttcttcacgt ttcttttcat    179340
     taattagggt ttcgcatttt caatcaccat catcccacca cgttttcgtt aatgtaagtt    179400
     cattctcttt tttctacttg tcatgatccc attttgttgc aatgttcact tatgaaattt    179460
     atcctttgta tgtgaatcat cacgttttgc tttgatgaat catttagatt tctaggctta    179520
     cacattcaaa tctaaatcct ctattatatg cttgttacac aagtaatctc tcatcagata    179580
     tcaatgtgtg tgtttcatta agacgtgtat aagctcgagt tatggttgac attttgaaat    179640
     tatagatcaa ccccaaattc atttcctcgg atgtataaag aaacccagat catcatgatt    179700
     aactgaattt caagaactca atccaggaac tgagagcatt tcctagggat ctcaatggca    179760
     atggagaaag atctcagtcc aaattctcca cggattagaa agctaaggga tactagttac    179820
     cctactacac caacgtctcg aatgaatact aataaccaga gagataacca ttatcccaac    179880
     attcctaatt caccaaggga ttacaattat actcctagct ctccaacagc tcgcattcga    179940
     caccgcaggc gatcaagcga ggtatctata caatgtcata ctctcttttc cggttgaatc    180000
     caaaatttga ttgtcttttt caatattgat cagaatttag ctgaggtgaa cagaagcaat    180060
     gtaagcagag taagcaattt gttacttggt gataagaaca agtacagatc aatgtggata    180120
     aggacatgct catctctctg gatgctcggt ggagttgtgt ttataatcta catgggtcat    180180
     ctctacattt gggctatggt tgtggttata cagatattca tggccaaaga gctcttcttt    180240
     cttcgcagaa gagctcatga agaacgtcgc ttacccggtt tctggctctt gaattggcac    180300
     ttcttcttca cggctatgtt gtttgtctat ggacgcatca ttcaacagca gctagtcaac    180360
     acggtttctt cagatagatt catatacaag cttgtgagtg gtcttatcaa gtaccagatg    180420
     gttatttgct acttcttgta catcgcaggt ttgtctgttt cttttttctt cacaaaaaca    180480
     atactctctt tcttgattta ttaacagctt aagttggatt caggtctcat atggtttatc    180540
     cttacattga agaataagat gtataagtat cagtttgggc aatacgcttg gacacatatg    180600
     atccttatcg ttgtctttac tcaatcttct ttcaccgtcg ccaatatttt tgaagggatc    180660
     ttctggtaca atggactctt atatatatcc actgaagcat aatagttttc ccgagtgcta    180720
     atttctttta aatatgcagg tttcttctac cagcagcact gattgctatg aacgatgtag    180780
     cagcttactt cttcggtttc tatttcggga aaactccgct catcaagttg tctccaaaga    180840
     aaacatggga aggtttcatc ggagcatcag ttgcaactat aatctctgca tttattgtaa    180900
     taaccttctt ctatcattta ttcattcgtt cgtaactctt tcttttggtc tcaagactga    180960
     tagattatta tctgcttcgt acaacagttt gctaatgtct taggccagtt ccaatggctt    181020
     acatgtccaa ggaaggtaac aaaaagtgat atctccatca caatattttg tctcggcctt    181080
     tacttcatcc ttgtgttgca tatcttttgc aggatttttc aactggttgg cttcattgtg    181140
     atccaggccc tctcttcagg ccagagtatt acccatttcc ctcttggatt actccatttg    181200
     taagcaatta actgtcctct cgtgaaaacc agccgatgat gttgtcttgt tttgaaactg    181260
     agctccgttg tgaactttgc ttaacagtct ccatggaaag ggatctcgac cctgcctgtc    181320
     caatggcatg ctttttctct cggtctattc gcatccatta tggcgccttt tggtggcttc    181380
     ttcgcaagcg gtttcaaaag agctttcaag atcaaggtta acacattttt caaacattaa    181440
     aaggttttgt atctacagat ccaagaacaa atatttacta gtttatgtcg ctttgacagg    181500
     atttcggaga cagcatacca ggacatggag gatttactga cagaatggat tgccaagtaa    181560
     gagtcactaa cgtcgaaaag tgcaatatga tctttgcatc gttttaaacg aatcttgttg    181620
     cctaaatgca gatggttatg gcggttttcg catacatcta catccaatct ttcattgtta    181680
     atcgggacta cagtgtcgag atgatcctag accaggtaag aatcatcata taagccaaga    181740
     atacggaggc attgtaaata attgattgta ttatacctgc agatatcgag gagcctggga    181800
     cacgaggagc agaaaatgct ttatgaaaag ctcggagaca ttcttcaaca taagttgcaa    181860
     gggaggtttt aaatagtgag tgcaagtttt gtgactctgt tttcagcttc tttctctatg    181920
     gttagtttct ggttgtatca gaccatgtaa aaccttgatt tgtatctgat ttaactaatc    181980
     aaacagagac ttggtaatag tgtgcgagta gaagagatgt aaaatgatat tttcctcgtt    182040
     caattatagc atggagatag agaaaacaga cacagaagca ggatttcccc tgcaaatgcc    182100
     atgtccagca acttatggga gatcttgttc atctaatgaa taaccaaacc acaaaagaaa    182160
     actatgactc gaagactcga gaagatgtta atggaaacat agaaccgtaa caaaatttat    182220
     gaaaaccagc tgacttcttc ttaagcatca gactctttct tttcttcttg gttctctcct    182280
     ccctgggtaa caccaacctc agctggtctt ataactcggt catacagcgt gtatccagac    182340
     tgcacatatt gacacccatc attactaatt ggtatttaag actatacaat atgaaataaa    182400
     gagacaaaga attgagcaag ctttatatat ttaccttcaa gacatgagca actgtgcctt    182460
     ctggcttaga agcatcaggg acttggaaca ctgcgttatg tctgtttgga tcaaatggct    182520
     cgtttatagg atcatacttc tccataccaa atttcttaaa tacctgcagc ggcacacatg    182580
     tttaaccggt ctcatctgca ttgcttactt aaggtcttat aattacattt ctcgatattt    182640
     acctcagcaa gctgtttctc agtcatctcc actccttcta aaagggtctt taatagtgga    182700
     gctgctccag cagaatcttc tgaggtgtca agctttgaga agctttcttt gacaaccgaa    182760
     gaagctcttc caagattatc cgccacatcc aataggctct ttgcaaaatt ctgcatacat    182820
     atatagtgaa tatatatatt tcagaaaact attatatgaa acaaaagctg caaaccaagt    182880
     tcttaaagac taacctgtac ggcatacttt ttggtgtttt cagcatcacg tcttgttctg    182940
     tccatgacat tctccatctc agcataagtg cgaagaactt tgtctttcaa ctgcttaatc    183000
     tcttcttcct tctcagacag tagctcttcc ttctcagcta cgagcttcac caaatcatcg    183060
     gctgacaatt catcatcatc actctcagaa tctgattcag aagatgaaga tgcagctcct    183120
     ttagcacctt tccgctttct ttttgcagaa tctgtcacag aatctttaga ttcagagtca    183180
     agacctggtt ggtttgcctc agctgtaggt ttctcttcac ttgtctttga ggcctcagtg    183240
     tgggtcttct tctcatctga ttcaggcgag gtagaggaag aaaaattgaa cctttgcagt    183300
     gcaaacgaat ccatcataga catctgagct ggaacaagct gcccccaaaa aaaaaagtaa    183360
     aatgggttaa actcagtgaa atgatacaga gcaaaaacct atagagaatc taaaccattc    183420
     ttctattgtt tattcatata tctgaagatt caaacataag agatcaagga aacagtatca    183480
     gaagatagca atcatttcta gaaactcaaa tgagggaaag ccttaaaccc taacaaaacc    183540
     ctgaattgca atttcggcat gaatagtgat taatttgagt gaaaatcgaa ccttatgcga    183600
     gaaatcgtga gctagggagt gaaaccggct cgagaaaaca ggagtctgat tcctcgccgg    183660
     aagagtgacg gcggatagag atgagcgtat gcccgcgttg cgggttactc gcgacaaaat    183720
     tctcaaaacc aacatctgga gatccaccac agatgaacaa acagagatca agaagataag    183780
     agaatcgaat cgaatcgaaa tgtaattgtt ctgaggaaat tgttaatttg cagaggcaca    183840
     cagagtgctt ggtggatgga tagtagaatt cacaattctc tctttcgggg tttttagtaa    183900
     tttacgtaaa tagccttacc gctgcacgag cgggctgagg ctaaaatgat cgctttgatt    183960
     cggcgagcct gtgagggtat tattgtcatt atagcaaatg ggagattttg aaagctaatt    184020
     tgagaagcct ctagaaagaa ccaaaggtac ttgtatatct ttgggacaga cgaagtccat    184080
     ttatctcctg ggcctgattg gtacagtcct accaaacaga acaagcagca gtatgttact    184140
     gttgctaagt ggtttggctt ttttagtttc attcttgtgt ttaattaaaa ttgctggatt    184200
     aatatagagg ttgtgtagat ttgacgtcat ttggatggga gaatttggaa attaatgttc    184260
     aactacttaa tctataattc aacaaacgat aaatgaccac ttaattgcta atagcctcta    184320
     gttaattcaa aacgcaaacc tatgttatga accacttgtc aataaattta taaatcttta    184380
     gttgagactc aaaaaacaaa gttactttat cggaaatgtc acatttgacg catgagagac    184440
     actttcttgc cgttacttgt tattgtcgtt gcaacaacca aaactatggt tgaactaaaa    184500
     agccccaaaa cgtgcgacac agttcaccca aagtgcaaat aatctttaca ttcaagactc    184560
     tagactcagt aagcaataaa aacagtaagt gatacaagaa cagagagttg agttttgagc    184620
     gtgaatccgg taaaaaggaa gatgcgttac atatacatct gaagcttgca atggtacgaa    184680
     tccttctatt ttaaaatatt ctgtctttct ctctttttta gtagctataa atacggctct    184740
     ctgctgcaca actattattg aaactctcaa tcattttcag ctcattactc acctcaacta    184800
     actctctgtg gccaaaaata aacagagaca tatcagacta aggagtattt aataagcatc    184860
     atctaacaac aggccaaggt attaactaca cgagctaaat ctgttttagt caggtttgat    184920
     agaagatacc tatctttctc catcttaaat gcttgctcca attgttcttc ccaattaatc    184980
     gtgaggttct tgttttgcag aagcaaaaaa ttgaaaaaac ttgtgtaaaa agcatgcagc    185040
     gaaacagagt tcttgcgttc ttgttgctag cagctcagct cttggtgaag atacctgaaa    185100
     cgtgtgcaaa atttcccgca cttatcgtat ttggtgactc aactgttgat tcaggcaaca    185160
     acaaccagat ttctactgtt ctgaagagca atttccagcc atatggccgg gattactttg    185220
     acggcaaagc gactgggaga ttttcaaatg gccggattgc accagacttc atttctgaag    185280
     gtttgggact caagaacgca gtccctgcct acctagatcc agcatacaac attgcagact    185340
     ttgccactgg tgtctgtttc gcttcagctg gaaccggctt agacaatgca acctctgccg    185400
     tgttagtaag tcaagcatag ttatatatct tacaacatat atatattcta ctgtactgga    185460
     cttagatttc tgacatgctt tctctgaatt gtcatcgatt tctaaagtct gtaatgccgc    185520
     tatggaagga agtggaatac tacaaagaat accaaaccag gctaagaagc tacttgggtg    185580
     aagagaaagc taatgagatt attagtgaat cactttacct gattagtatc ggaaccaacg    185640
     atttcctgga gaattactat cttcttcccc gcaagttacg gaagtactca gtgaacgagt    185700
     accaatattt cctgatagga atagcagcag atttcgtgac agatatatac agactcggag    185760
     ctcggaagat gtctttgtcg ggactctctc cttttggatg cttacccctg gaaagaacaa    185820
     ctcagctctt ttatggaagc aaatgtattg aagaatacaa cattgtggct agagatttca    185880
     acatcaagat ggaagagaaa gtcttccagt tgaacagaga tctgaacgga atccagctgg    185940
     tgttttcaaa tccatatgac cttgtttcag aaatcatata ccatcctgaa gcattcggtt    186000
     agtacaaagt tctaacaaaa atattttccc aaccattgca accctgcaaa gacatagggc    186060
     taagtttcaa tatgtaccaa atgctcttaa atcaagaatt cttatgataa tattcctatg    186120
     tgcattgcag gtttcgaaaa cgtaagaagt gcgtgttgcg gaacgggata ctatgagatg    186180
     agctacttgt gtgataaaat gaacccattc acatgttcgg atgcaagcaa atatgtattt    186240
     tgggactcat ttcacccaac agagaagaca aacgccatcg tagcaaatca tgttctgaaa    186300
     tacgacttat ctcggtttca gtgataaaat aagaaattgc tacaccacaa gcactatagt    186360
     tattagttaa cctactaaat tctttcctcc acaacatata tatttttttc tgtgagtttc    186420
     ttgtctagat atcactcaaa tcaagcttcc aaaatgttgt acaagaacca ttcttcttac    186480
     tctatgttcg tgtgactaca taaagatgct actgtgatgt tataaaaatg gacaagatca    186540
     aactttaaaa tactaaaaca gaaatggaag tgaatcatga agccagaaac caaaaaagct    186600
     gacatttgtg actcagcgtg acaactaaat caaccatttt gctcaccaaa atcaccggag    186660
     gaatggccca gagctaagaa gatgcgaaag ccaggttcat aaaagaagat gaagaagaaa    186720
     tcaattggga tcacagtgag agaataacaa atgcgacatt ttcgacaaat cctttccgga    186780
     cgagacaaga ggatgccatt agagaaaagg aggatcgaat cgaaattgtg caatccggtt    186840
     cggtttcgtc gaaccgtttt aagcgtttgg ttattaattt tgtacggttt tcgattattg    186900
     taaaccaaaa acctaaaaag gctcgattgt ttctaaaccg gttaaagttg tatttcttct    186960
     ctgttcaatt ctttcagttc tctcaagtct caaacacttc aacactgtag ggtttagggt    187020
     ttatggtcaa aatccctgag acagaatttg ggaacgaacc caaatcaagc tgaagtcgaa    187080
     acgattggat gcggtggtcg attgcgactg cgattgcttc aacggctaag gggtttcttc    187140
     atcttcatca ccattttctg aagaacagta atcctgggat tgttctttct ccgtcgttga    187200
     gatttcgttt ctgggtacga gctttttctg gtactactat tgattatcga gaggtattga    187260
     gaagtgggct tcacaatatt aagttcgacg atgcatttca tttgttcgta ctcatggctt    187320
     attcttaccc tctaccttca attgttgaat tcaataaagt attgactgct attgctaaga    187380
     tgcagatgta tgatgttgtg attaatctct ggaaacgtat tgagaatgct gaaggtattg    187440
     aaatttcacc tgatctctat acttgtaaca ttttggtgaa ttgtttctgc cgctgctttc    187500
     aaccctcttc ggctttatct tatcttggga agatgatgaa gcttggtatt gagcctgaca    187560
     ttgtgactgc tagctcgctg gtcaatggat tctgtctcag taatagtatt aaggatgctg    187620
     tttatgtggc tggccaaatg gagaaaatgg gaatcaaacg tgatgttgta gtcgatacca    187680
     tactcattga tactctttgc aaaaatagac ttgtggttcc cgcgctggag gttctcaaac    187740
     gtatgaaaga cagaggaatt tcaccgaatg ttgttaccta cagctctctc ataactggcc    187800
     tttgtaaatc cggtagattg gctgacgccg agagacgact gcacgaaatg gactccaaga    187860
     aaatcaaccc taatgttatc actttcagtg cattaatcga tgcatatgca aaacgtggga    187920
     aactgtcgaa ggttgatagt gtgtacaaga tgatgatcca aatgtctata gatcctaatg    187980
     ttttcactta cagttcactt atctacgggc tttgcatgca caatcgtgta gacgaggcca    188040
     ttaaaatgct tgacttgatg ataagcaagg ggtgcacccc aaatgtagtc acttacagta    188100
     ctcttgcaaa tggatttttc aagtcgtcga gggtagatga tgggattaaa cttttagacg    188160
     acatgcctca aagaggcgtg gctgcaaaca cagtctcttg caacactctt atcaagggct    188220
     attttcaagc aggcaagata gatctcgctc taggagtttt tggatatatg acttctaatg    188280
     gtctgattcc caatattagg agctacaaca ttgtgttagc tggtctattt gctaatgggg    188340
     aggtagagaa agcattgagc agattcgagc atatgcaaaa gactagaaat gatcttgata    188400
     ttattacata tactatcatg attcatggga tgtgcaaggc ttgtatggtg aaagaagcat    188460
     atgatttgtt ctataaactc aagttcaaaa gagtggagcc cgattttaaa gcatacacga    188520
     taatgatcgc agaattgaat agggctggca tgcggactga agcagatgcc ttgaatagat    188580
     tttaccaaaa gcacgttcgc caaaacgaaa gcgcaccagc tgaagtatcc taggagaatt    188640
     ttcttgagag acatttacag actcggagct tgcaaagata tctctctaca ggctccctct    188700
     tatcggatgc aagaacacaa atcttgatgg aagccagtgt atcaaaagat accacgatgt    188760
     gtccagataa ttcaatcgca ctgttgaaca aggagctgaa caatgagcgg aaacaatcgc    188820
     atggtcttag aatcatgaaa agtcctgaag tatttggtta gtaataagct ttctatccct    188880
     caaaagacat acactaaggt ttatgagtat caattactct tttttatcaa gaattcttct    188940
     cactgtgttt ttaattctct tgcaggtttc caaactgcat ctggatacta ggggatgcgc    189000
     tacttggatg atagattgaa ccctttcaca tgttgggatg caagcaaata tggattttgg    189060
     gactcctcat gtatcccata ccacaaacat gttccttaac atgctacatt ctttcttcta    189120
     ctaacttgct ctgtttctga gttgtattcg ttaccaatga tcacttcagg ttgcttgata    189180
     ttatttgaat caagcttcca taatgtttgt aaaagaacca gtttttccca ctatatggtg    189240
     gaagtgtgta agtacttaaa gatgatcttt tgatgttata aaaaacacag caccacccga    189300
     caaggagaaa ctgtttacat aagaaaacag aaatagaatt gaatccagaa tccagaactt    189360
     agaagtatca atcatatatc tttaagcatc acagaacaaa acgaccccaa agaagcaaaa    189420
     gttaaatttt ctgagaattc ttcttttgtt ctttgggaaa atgcaacttg ataagagaag    189480
     gaagatcgac tagctccact cgctgcttcc cgagcaaaat gctcttgagc ttctcatcac    189540
     aaatcaccac attcttgttc ttaggatcct gtaagaaaca aaaccaatca gtcaatgaga    189600
     caaaacattt taaaaaaaaa tctttagctt aaataactta atgatcaaac ctgaagattg    189660
     ttggtcttga tataggacca gacacgcatg aaacaaccca gacgggaaat ctgagattga    189720
     ccaacaaagt tccgtagagt agatggaaga ttcacgaggt caatcaaatt cccaagcttc    189780
     tttggattat ccgttatagc cttcttcaac ctctggggca gcatcctgat tctcaaccca    189840
     cgagtaaacc agaaattcga ctgccgcgga aaagcaaaag agaaaaaacg ttaattacca    189900
     ctgacaatcc ctttggggaa tttcatcgag catgtggcgt ccaaatgaaa agcaaacgac    189960
     cctacgtaca aaaagctttt taagaaagct tacccgtgga aatggtagag gaaattgaaa    190020
     gcaacaagtc cgtgtaaacc aactgactcg cttttaaccc gtaatgcttg cgatgtttta    190080
     cgcttcgacc ttggaggtat tctcgcgttt gaacgctgga gctgcgatag agtcaaaaag    190140
     tcttcttaag aacaaggaag agactacatt gtgttacttt gtgacttgac tattgggccg    190200
     cgttttcttt tacatttggg ctgaataata atatatcctt gtgacttgga atgattgttg    190260
     tggatgacgt gtaatgcaat aatttagttt aaacaacaaa atcgtcatac tccaaatctt    190320
     caaaatctca attcttccgt ttagtttgtc aaaatcaatt ggaaaatcca aaacaaatca    190380
     gcgtgataat tattccatta agattctcac aacaactgtt ttctctgctc ttgtggatat    190440
     gaatgtatca agcctaattt ctaaaggtca tcgattgtca tcaaattaag catatcacta    190500
     atattgtcat caacaaaaaa acatacataa ttaaacatca ttgaccagcc gtaagtcatc    190560
     taacatcaca catccctaac aaattgcaaa aacaaactct aattgaccat tgttaaatat    190620
     ctaagaccta aggatattta gggagacgta cactgcatac tagtcgacca tcgaatgaca    190680
     aaaccgatct atttgtccca tagatctcgt catcaacatt atacaacttg gcacttacat    190740
     tctcacaaac ggctgacatg tactgttctc cccataaagc agaagttcct ggataaaacc    190800
     ctactctccc agaaaacacc atatcaagac ccaccacacc tcctgtcacc gccacttcat    190860
     cctccatttc ccaagccgcc tcttcatcga taacttttgt ttcgtttctc ttgacaataa    190920
     cctcgttctt ctctccgcct ttctgccaga acgaatcagc tcttgcggtc gacacgagct    190980
     ttccccggtg aaccagccac actgaaggat tctcgtacgt gacatggagt ttctcgttag    191040
     ggtttttgat agagaacgtt gcggaccaga ccgggagatt gtggttggcg aacgatatat    191100
     gcattgattg tacgtgtact gtggggggag ttggcgtaat caatatgaca aacgtcacac    191160
     ctgctacaca agcacccatg atcgtgatgg ctagaaagag tttgaaaagt agtgaccagt    191220
     gtgagatatt agctggttcg gattcttggt ggctccgtga tgatattggt cggagttccg    191280
     ggactttttc ggtatcaatg acggttatca gaagctgttg attcatttct tcaaccaggt    191340
     tttgttcatc atccatattg ggatttatac aagtgctgat aatgtttact tgtttatatg    191400
     atgatatctc aaaacaatta gagaaaaaga tttatctagt agagattata aaaattaaag    191460
     atattaataa ttaaaatctt tatcattttt tctgattgta tatataatag ataaaatgat    191520
     taataaaatc attgatttct ataatctcaa ctagatgaat cttttagttt ctatagaatc    191580
     attttatcca ctatacaaga ttttattcct tctaatatat ataccctgaa attctaataa    191640
     taatatacta gaataaaata tactattttt gcaacataaa attcattttg tttattatgt    191700
     caaacttcag cattcatgca agattttgag aataatctag tgatgatata attttaaatt    191760
     aaaatatata aaatagttca acaaagttaa tatattttat acacaatata aaatatatat    191820
     atattcccga ttagcaaaca atgtacttaa taaatcaggc aaaaaaaaaa acacagaaaa    191880
     ttgctgccaa ctattccgcc tcaatgtccg gtgggaaact cgcattttcc atatcctgca    191940
     atcaacgaaa aaataatttt gttagaatta tataaaaata ttaaaggtca ccatatatat    192000
     cgatcttaca gaaacgtgaa catcttaaaa ggccaaaatg acccaatata gctcaacttt    192060
     cacaaccgcc aactactaaa ccatttgcca ctatcttttt ctttttttca ataaacatac    192120
     caaatgaatt tttaagcata aataacagct aaatatacac ttctgaattg aactaaagca    192180
     aaatatgtaa tgttatgata aaaacagagg agagattaga ttaacgtacg aggaggttgc    192240
     gtgacgacgt gagcagctcc accaaagaag cacgtaccaa cacgacgtga gttcttctgg    192300
     tagtaactat tgaaggcgta cgaagcgtga gcttctaacg actcaggatg ataacacgtg    192360
     gcacctggct gaatcgggcg gcaatcagct cctccttctc cgcaagcgta atcaagagcc    192420
     tcctgaagtt tctccttcgc tacctctccg ttcgaaacgc accatgtatg tccctcgtgc    192480
     gtcaccggaa ctttacctct gttaccgttg accggcgtcg ttgacttttt agtgaacgga    192540
     acgttgtaca ctttcccttc gtttgggtaa aacaaaccgt agtttctctc agacgttggc    192600
     cccggtttct ggttttcgtt gaataaagcg aataaataga cgttaagtgg ctccgtcggt    192660
     cttaacggtg ttcctttacc cgttaacact ctcttcacaa gtccggcgtt atacgccgcc    192720
     gcgttagatt cgcttgcacc aatctcattc tcatctccaa cggaaggcca ccctgtttcc    192780
     gtcaccatca ccttaacgcc tttaaatccg acggcggaca atgccgcgta aacggcgtct    192840
     atttgagcgt caaagagact gttgtacttc aatccggtac cggaatctat attcccggcg    192900
     ttttctttaa acagagcgta gtctaaagag attttatcgg cgtttgctgc gtaagcgaaa    192960
     aacggataag catttaccat aagatacgac gacgtttgtt gaagcagagc aagcattggt    193020
     ttaacaaccg gttcgattaa ttccggttta aaagaaccag aggaaggcgg gtacgaatta    193080
     gcaagcgcgc taagagcaat aggagacgag atcttgatgg ctttgtcgag tttatactta    193140
     accagagagg tgtgaatgtt cttcatcgca ttgacaagat acggcgtgat cgtcggatcg    193200
     acgaatactt cgttaccgac ggcgatagct tcgatctccg tcgctgggaa gtatggcatt    193260
     atgtgggttt taatccagtt gtcggcgaat gattggtggg aggcggcgga ggagagaagc    193320
     tcgttaggga gagcgacgat tactttgatt ttggaatttg caagtgcggt tagtacattc    193380
     ttatcggtgt cgaagatttt gatacggttg attccttgag atttcaggag gttcactact    193440
     ttctccggcg acgggagatt gttagctatc cgaccataat tgactccgac cattccagaa    193500
     tctgtggaaa caaaaacaaa aaaaacgcaa aataagaaca acgtagtaga cacggcaaat    193560
     acagagacag acataggtat atgaagagat taaaaactaa cgtgcgtcaa tggctgagag    193620
     gaaggaaaga atcagaaaat aaggtaagaa agaaacggcc atggttattc tcgagtgtat    193680
     cttcagaaac agagcattaa acgcatagat gagtgtcgtt tgatagttat ggagacgaag    193740
     gaaagttttt gttgcgtttg ggacggagct ggtctacagt atttatacga tttaggtgta    193800
     aacaagtgcc aagtgggggt tgtgggataa ctaataacac ggaagaatag ctgaaataat    193860
     agatttaact aaaactgtat aattttaaag ctctatttat agcaaaaagt tttactttac    193920
     cataatcttc agttaaagga actctctata attttgatgt ttttctaaca tatgaatgtt    193980
     ttcatagttg attttggtta taacagaaac ctaacaaaaa ccttgacttt tattgtttct    194040
     taaacaagag tcaagaccta ggttctttat atgttgcatt gcgcatattt cgttaattca    194100
     tcatcatttc tttcttttgt gaagagtgtg tgacagactt tatctccttc aactaatcat    194160
     tttgttaata cacaaagtga catgatttat agatttaaca atttatttat ttcttctatg    194220
     tcaaattgtc aagtcttcaa cagatgatga aatcatggag agtggtggat aggaggactc    194280
     acgtcacgtg agatcaggaa ctgcaaccta aaatatttaa ccaaatgaaa ttgtctagtg    194340
     ggttagatgt ggcccaataa aaatataagc ccattataac gaaacgacag atttgaacat    194400
     aactagcagc cgttggatta aaagagaacc tagagagaat atgaaccgtt ggatagatgc    194460
     cctacgattt atgatagaga ggaatccgat gcgtccaagt acaaaagcca cggccaatta    194520
     gagagatttt cagagtcagt ctttttatat tcatctctca gcatcattct ttgattgtgt    194580
     gaatctctca tcgttctctc aaatttcgtg tttttgtaac cggacggaga acctttcacg    194640
     atgtctgcaa accaggagga agacaagaag ccaggagacg gaggagctca catcaatctc    194700
     aaagtcaagg gacaggtatc tctctttctc cttctcatcc ttgtgtgttc ttgtgaatgt    194760
     ttgggtttct gatttcgtgt agctgcgatt agggtttttc attctccaat ttggtttaat    194820
     tttagggttt cgtactacta gctcagtctt aatggtcttc ttcctctttt gttttacagg    194880
     tttaaagtat cctgctttat gtttacacgt ttgcttgttt ttgctaattg tttatcaaat    194940
     ttctgaaatt atataagtct tgtttaggtg taagttgtta ttgagctttt ggttcctgtt    195000
     gttgtttgag ggttttatag ttttggaagg gataagttta cttagttgtt gaatgttcta    195060
     aagactgtga acgatgctgt ctctgtacta agttgttata tatcttctga tgaagttgta    195120
     gtctctgtac taagttttca attagtttgg ctgatgtttg tgcttcaaat tctcatagac    195180
     gaagccttaa actgaatgtt tgttgatatg tgtttaattt ttcgactctt tcaggttact    195240
     accaaaagag agccatgtga tttagttatt gtttcatatg cggtctctaa cgtttattgt    195300
     tccttctata tgtttgtttt ataggatgga aacgaggttt tctttaggat caagagaagc    195360
     actcagctca agaagctgat gaatgcttac tgtgaccggc aatctgtgga catgaactcc    195420
     attgctttct tgtttgatgg gcgtcgtctt cgtgctgagc aaactcccga tgaggtataa    195480
     cattcattct acatgcttta tttcttacct tttgaagttt atagtttctg atactaataa    195540
     ttcttgacac tacagcttga catggaggat ggtgatgaga tcgatgcgat gctccatcag    195600
     actggtggca gcggtggtgg tgctacggcc tgacacttcg tccaggttta gggcttgtgt    195660
     gtgatatgaa tggttaagga gtaatcggca ttaggatttg cagacttgtt tttttatcgt    195720
     gaccattctc tttagaaact aagttattat ggtcacgaag gttaaagaac cctttggttg    195780
     attttttgtc ttgttcgttt ggtatcggat cctatgatac tactatttcg gcttaaaggt    195840
     gttattaacc caattatcta aagtttgttg gtatggtaac ggtaaaaagc tattaattat    195900
     tgaaagtgtg actcttaaca tatacgtagc tcattgagct aatggcgagc aaagataaaa    195960
     tccatctagt caactaaaca aaatattact taaacatgaa ctagcatcga gttagtgaat    196020
     tatagtctat agaggacgac ttcataacca gagcttgtgg tggttatagc caagacaata    196080
     atcagtatta ttactctctc tcgagtctcg agctgtaaaa actaagtgtc tgaatcttaa    196140
     catggttgtt gatggtagaa agacttggtt acaagtaatt agttggctga acctgaaccc    196200
     cttcttaaga catatccttt gaataatcaa atctatacaa ataataatca tattagtgaa    196260
     gaacatatat aattcataaa caccaactca taacaaaaaa caaagaacca gaagtctagg    196320
     cacaaaatgc ccacaaccat catacataaa ccaagaagct tcaaatgcaa ctacaaagag    196380
     agtttgctta tttaggcttt taattataca tacaaaccac caagtcacca tattgttcac    196440
     tgaaggacaa ggcactcggc ggccgtccca tttgtgatcg gacctccatg ggttctgttg    196500
     cttttctggt taacattgcc actagagttt tgctgatgaa ctatggttcc ttcaagatcc    196560
     tcctcttggt tactacaacc tatggcttca aaggcgagag cagtaacctc cttaaacctt    196620
     tcctccgaca gagaagcttc cgcaaggagc ctccacgcgt tatcctctga agcaccttcg    196680
     taatcctctt tcctcttcag taccatgtga ccacttatct cccacacggc tgggttcact    196740
     tgtgtttcca atacctccgg gctcacttca cctagagcct gtttctctgc gtaacactgc    196800
     aatttttaca ttcaaactgt tattcacttt tgattaagta attcaaaaca tgtattcatc    196860
     caacggtgta gttatatacc tgtggcatta agaagatctg ccttccacaa tcagagatga    196920
     gaatgttgaa aggaatgttg ttgttttgaa ggcaaacaca gcagtctgaa acagtatcag    196980
     atagttcttg catagagctt ccaccttcaa agagaagact tctcacaggg taacttagaa    197040
     gctctgagat tttgacacca ctaacagtgg tagttatctt cttggtagga gctttctcca    197100
     gtgggaaagg catggccaag taataagcct gtttccaaaa acaatcacca ccaaaacaat    197160
     cagaacaaac atcttagatg agcaagggtg aaaaggttat gcttggatca cttttggata    197220
     tacctgaaag tggagatgat tgatagtggc aaaagcaccc aagctgttgt aaccgagtct    197280
     gaagtatgga ttagcagcct cagcagccat gtgaactgca agcaaaaggc ttttgtgatc    197340
     gatcctttga ggcaagcagt caagaacacg aggaatcagc agcacatggc catactctat    197400
     cggactaacc tgttaaaaac aacaataaag aattaatctt ttgctagcga aaccaataaa    197460
     aggaagaaag aaaaaaccaa gctctctgca caagagtctt tacattgatg gcaacaacac    197520
     tgggagaatt ctcagggtca ataggcatgc aagggaagaa ctgaacttgg gcatcttcac    197580
     cagcttcaaa ctggaagagc aactcttctt ggccaacttt agtgaagttg aatttgctgc    197640
     catcaaaaga ctgcaacacc ttatctacac ggaactcagt tggcctcttc ttcaagtgac    197700
     gaccctcgtt aagctgagca acgaaaccat acttccccgg gataacctat aacatcaaga    197760
     gaaacaatct taagaacaat gtaaaacata tctcggattc ctcagcaaca aacaacccaa    197820
     cataactaga ttgtcaaaca aggtaagaaa gacaattact ttggtttcgc aggcagtgac    197880
     atcatagcga aaaagtcctc tttggaacct atcctcccac taaacataag aatactgatt    197940
     agactcttcc aagctacaga aaccattatc agaatatcaa aatcagtggt ctatgattta    198000
     cctctccgag aacaagggac tcgagaaaag ctacaggagg ctctatagcc tcatgactga    198060
     ttacaagctt ctctccggat tttaccagat tcttacatgc atacaatgga agcctagccc    198120
     ctgaacaaac acatcataag gtgaataaaa aaaaagtgat aaaatttaaa catgattaaa    198180
     aaagacgatt caggtttcca aaacgtaccg ttaaggcaac aagcgccgag gcaattccgt    198240
     ccacagccga cgggatcctc cgctccatcg tccttctggt agttcgaaac aacggtcgga    198300
     actcttttga ttttcaacat                                                198320
//

If you have problems or comments...

PBIL Back to PBIL home page