(data stored in SCRATCH zone)

EMBL: AL161746

ID   AL161746; SV 2; linear; genomic DNA; STD; PLN; 83499 BP.
XX
AC   AL161746;
XX
DT   21-MAR-2000 (Rel. 63, Created)
DT   23-OCT-2008 (Rel. 97, Last updated, Version 5)
XX
DE   Arabidopsis thaliana DNA chromosome 5, BAC clone T10O8 (ESSA project)
XX
KW   .
XX
OS   Arabidopsis thaliana (thale cress)
OC   Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
OC   Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae; Pentapetalae;
OC   rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis.
XX
RN   [1]
RP   1-83499
RA   Bevan M., Pohl T., Weizenegger T., Bancroft I., Mewes H.W., Rudd S.,
RA   Lemcke K., Mayer K.F.X.;
RT   ;
RL   Unpublished.
XX
RN   [2]
RP   1-83499
RA   EU Arabidopsis sequencing project;
RT   ;
RL   Submitted (23-MAR-2000) to the INSDC.
RL   MIPS, at the Max-Planck-Institut fuer Biochemie, Am Klopferspitz 18a,
RL   D-82152 Martinsried, FRG, E-mail:
RL   lemcke@mips.biochem.mpg.de,mayer@mips.biochem.mpg.de Project Coordinator:
RL   Mike Bevan, Molecular Genetics Department, Cambridge Laboratory, John Innes
RL   Centre, Colney Lane, NR4 7UJ Norwich, UK, E-mail: michael.bevan@bbsrc.ac.uk
XX
DR   MD5; 532f94e7d72d655c0496ed8f4f4347dc.
DR   ENA-CON; BA000015.
DR   EuropePMC; PMC111135; 12006661.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00218; SNORD46.
XX
CC   Information on performance of analysis and a more detailed annotation
CC   of this entry and other sequences of chromosomes 3, 4 and 5 can be
CC   viewed at: http://www.mips.biochem.mpg.de/proj/thal/
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..83499
FT                   /organism="Arabidopsis thaliana"
FT                   /chromosome="5"
FT                   /variety="Columbia"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:3702"
FT   misc_feature    1..11148
FT                   /note="overlap to BAC F7J8, please also refer to
FT                   EMBL:AL137189 for analysis and annotation"
FT   gene            9701..10506
FT                   /gene="T10O8_10"
FT   CDS_pept        complement(join(9701..9775,9875..10169,10388..10506))
FT                   /gene="T10O8_10"
FT                   /product="putative protein"
FT                   /note="similarity to several hypothetical proteins -
FT                   different bacteria"
FT                   /db_xref="GOA:Q9M042"
FT                   /db_xref="InterPro:IPR005247"
FT                   /db_xref="InterPro:IPR008914"
FT                   /db_xref="InterPro:IPR036610"
FT                   /db_xref="UniProtKB/TrEMBL:Q9M042"
FT                   /protein_id="CAB81913.1"
FT                   /translation="MSSEELRLVSPTIDNDGKLPRKYTMAGQGVKKDISPPLEWYNVPE
FT                   GTKTLALVVEDIDAPDPSGPLVPWTVWVVVDIPPEMKGLPEGYSGNEDQTTGIREGNND
FT                   HKIPGWRGPLLPSHGHRFQFKLFALDDKPKIGHTVTKERLLIAIEGHVLGEAILTCLA"
FT   exon            complement(9701..9775)
FT                   /number=1
FT   intron          complement(9776..9874)
FT                   /number=1
FT   exon            complement(9875..10169)
FT                   /number=2
FT   intron          complement(10170..10387)
FT                   /number=2
FT   exon            complement(10388..10506)
FT                   /number=3
FT   gene            13362..17018
FT                   /gene="T10O8_20"
FT   CDS_pept        join(13362..13863,14283..14560,14726..15597,15675..16272,
FT                   16358..16528,16701..17018)
FT                   /gene="T10O8_20"
FT                   /product="putative protein"
FT                   /note="first exon could be a separate protein"
FT                   /note="similarity to different hypothetical proteins -
FT                   different species"
FT                   /note="Contains ATP/GTP-binding site motif A (P-loop)
FT                   AA234-241"
FT                   /db_xref="GOA:Q9M041"
FT                   /db_xref="InterPro:IPR002589"
FT                   /db_xref="InterPro:IPR011146"
FT                   /db_xref="InterPro:IPR011598"
FT                   /db_xref="InterPro:IPR019808"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032566"
FT                   /db_xref="InterPro:IPR036265"
FT                   /db_xref="InterPro:IPR036638"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9M041"
FT                   /protein_id="CAB81914.1"
FT                   /translation="MDDFNLRSENPNSSSTTSSSSSSFHRHKSETGNTKRSRSTSTLST
FT                   DPQSVAARDRRHRISDRFKILQSMVPGGAKMDTVSMLDEAISYVKFLKAQIWYHQNMLL
FT                   FINDHETTSSCTYSPGAGEFGPKLFGYDDDYAPIMDTYSQGVPLTVADSKYTPWFGSVD
FT                   DEQEHVTYFKYRRATRHALRGHCNCIIGETEEFADQREKMEVQIEESGKNQTSPESIEA
FT                   DKAKQIVVLLIGPPGSGKSTFCDTAMRSSHRPWSRICQDIVNNGKAGTKAQCLKMATDS
FT                   LREGKSVFIDRCNLDREQRSEFIKLGGPEFEVHAVVLELPAQVCISRSVKRTGHEGNLQ
FT                   GGRAAAVVNKMLQSKELPKVNEGFSRIMFCYSDADVDNAVNMYNKLGPMDTLPSGCFGE
FT                   KKLDTKSQPGIMKFFKKVSALPASSSNEATNTTRKADEMTANVRVSPVKLGSADIVPTL
FT                   AFPSISTADFQFDLEKASDIIVEKAEEFLSKLGTARLVLVDLSRGSKILSLVKAKASQK
FT                   NIDSAKFFTFVGDITKLRSEGGLHCNVIANATNWRLKPGGGGVNAAIFKAAGPDLETAT
FT                   RVRANTLLPGKAVVVPLPSTCPLHNAEGITHVIHVLGPNMNPNRPDNLNNDYTKGCKTL
FT                   REAYTSLFEGFLSVVQDQSKLPKRSSQTAVSDSGEDIKEDSERNKKYKGSQDKAVTNNL
FT                   ESESLEDTRGSGKKMSKGWNTWALALHSIAMHPERHENVVLEYLDNIVVINDQYPKARK
FT                   HVLVLARQESLDGLEDVRKENLQLLQEMHNVGLKWVDRFQNEDASLIFRLGYHSVPSMR
FT                   QLHLHVISQDFNSDSLKNKKHWNSFTTSFFRDSVDVLEEVNSQGKANVASEDLLKGELR
FT                   CNRCRSAHPNIPKLKSHVRSCHSQFPDHLLQNNRLVARAET"
FT   exon            13362..13863
FT                   /number=1
FT   intron          13864..14282
FT                   /number=1
FT   exon            14283..14560
FT                   /number=2
FT   intron          14561..14725
FT                   /number=2
FT   exon            14726..15597
FT                   /number=3
FT   intron          15598..15674
FT                   /number=3
FT   exon            15675..16272
FT                   /number=4
FT   intron          16273..16357
FT                   /number=4
FT   exon            16358..16528
FT                   /number=5
FT   intron          16529..16700
FT                   /number=5
FT   exon            16701..17018
FT                   /number=6
FT   gene            17542..19683
FT                   /gene="T10O8_30"
FT   CDS_pept        complement(join(17542..17712,17780..18086,18187..18837,
FT                   18915..19078,19165..19683))
FT                   /gene="T10O8_30"
FT                   /product="pyruvate decarboxylase-like protein"
FT                   /note="strong similarity to pyruvate decarboxylase (EC
FT                   4.1.1.1) pdc1 - Arabidopsis thaliana, PIR:T05315"
FT                   /note="Contains Thiamine pyrophosphate enzymes signature
FT                   AA463-482"
FT                   /db_xref="GOA:Q9M040"
FT                   /db_xref="InterPro:IPR000399"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR012110"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9M040"
FT                   /protein_id="CAB81915.1"
FT                   /translation="MDTKIGAIDTCKPTTGDIGSPPSNAVATIQDSAPITTTSESTLGR
FT                   HLSRRLVQAGVTDVFSVPGDFNLTLLDHLIAEPELNNIGCCNELNAGYAADGYARSRGV
FT                   GACVVTFTVGGLSVLNAIAGAYSENLPVICIVGGPNSNDFGTNRILHHTIGLPDFSQEL
FT                   RCFQTVTCYQAVVNNLEDAHEQIDKAIATALKESKPVYISISCNLAATPHPTFARDPVP
FT                   FDLTPRMSNTMGLEAAVEATLEFLNKAVKPVMVGGPKLRVAKASEAFLELADASGYPLA
FT                   VMPSTKGLVPENHPHFIGTYWGAVSTPFCSEIVESADAYIFAGPIFNDYSSVGYSLLLK
FT                   KEKAIIVHPDRVVVANGPTFGCVLMSDFFRELAKRVKRNETAYENYERIFVPEGKPLKC
FT                   KPGEPLRVNAMFQHIQKMLSSETAVIAETGDSWFNCQKLKLPKGCGYEFQMQYGSIGWS
FT                   VGATLGYAQATPEKRVLSFIGDGSFQVTAQDISTMIRNGQKAIIFLINNGGYTIEVEIH
FT                   DGPYNVIKNWNYTGLVDAIHNGEGKCWTTKVRYEEELVEAIKTATTEKKDSLCFIEVIV
FT                   HKDDTSKELLEWGSRVSAANGRPPNPQ"
FT   exon            complement(17542..17712)
FT                   /number=1
FT   intron          complement(17713..17779)
FT                   /number=1
FT   exon            complement(17780..18086)
FT                   /number=2
FT   intron          complement(18087..18186)
FT                   /number=2
FT   exon            complement(18187..18837)
FT                   /number=3
FT   intron          complement(18838..18914)
FT                   /number=3
FT   exon            complement(18915..19078)
FT                   /number=4
FT   intron          complement(19079..19164)
FT                   /number=4
FT   exon            complement(19165..19683)
FT                   /number=5
FT   gene            20596..22865
FT                   /gene="T10O8_40"
FT   CDS_pept        complement(join(20596..20766,20848..21154,21427..22077,
FT                   22151..22314,22380..22865))
FT                   /gene="T10O8_40"
FT                   /product="pyruvate decarboxylase-like protein"
FT                   /note="strong similarity to pyruvate decarboxylase (EC
FT                   4.1.1.1) pdc1 - Arabidopsis thaliana, PIR:T05315"
FT                   /note="Contains Thiamine pyrophosphate enzymes signature
FT                   AA452-471"
FT                   /db_xref="GOA:Q9M039"
FT                   /db_xref="InterPro:IPR000399"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR012110"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9M039"
FT                   /protein_id="CAB81916.1"
FT                   /translation="MDVRSLPSNGVATIQDSAPTAATILGSSAATLGRHLSRRLVQAGV
FT                   TDIFTVPGDFNLSLLDQLIANPELNNIGCCNELNAGYAADGYARSRGVGACVVTFTVGG
FT                   LSVLNAIAGAYSENLPVICIVGGPNSNDFGTNRILHHTIGLPDFSQELRCFQTVTCYQA
FT                   VVNHLEDAHEQIDKAIATALRESKPVYISISCNLAAIPHPTFASYPVPFDLTPRLSNKD
FT                   CLEAAVEATLEFLNKAVKPVMVGGPKLRVAKARDAFVELADASGYPVAVMPSAKGFVPE
FT                   NHPHFIGTYWGAVSTLFCSEIVESADAYIFAGPIFNDYSSVGYSLLLKKEKAIIVHPDS
FT                   VVVANGPTFGCVRMSEFFRELAKRVKPNKTAYENYHRIFVPEGKPLKCKPREPLRINAM
FT                   FQHIQKMLSNETAVIAETGDSWFNCQKLKLPKGCGYEFQMQYGSIGWSVGATLGYAQAT
FT                   PEKRVLSFIGDGSFQVTAQDVSTMIRNGQKTIIFLINNGGYTIEVEIHDGPYNVIKNWN
FT                   YTGLVDAIHNGEGKCWTTKVRYEEELVEAINTATLEKKDSLCFIEVIVHKDDTSKELLE
FT                   WGSRVSAANGRPPNPQ"
FT   exon            complement(20596..20766)
FT                   /number=1
FT   intron          complement(20767..20847)
FT                   /number=1
FT   exon            complement(20848..21154)
FT                   /number=2
FT   intron          complement(21155..21426)
FT                   /number=2
FT   exon            complement(21427..22077)
FT                   /number=3
FT   intron          complement(22078..22150)
FT                   /number=3
FT   exon            complement(22151..22314)
FT                   /number=4
FT   intron          complement(22315..22379)
FT                   /number=4
FT   exon            complement(22380..22865)
FT                   /number=5
FT   misc_feature    23889..29345
FT                   /note="similarity to fragments of non-ltr reverse
FT                   transcriptases"
FT   gene            31298..32619
FT                   /gene="T10O8_50"
FT   CDS_pept        complement(join(31298..31837,32230..32619))
FT                   /gene="T10O8_50"
FT                   /product="putative protein"
FT                   /note="similarity to ACR1-protein - Saccharomyces
FT                   cerevisiae, EMBL:SCACR1PRA"
FT                   /note="Contains Mitochondrial energy transfer proteins
FT                   signature AA33-42;Mitochondrial energy transfer proteins
FT                   signature AA128-137;Mitochondrial energy transfer proteins
FT                   signature AA230-239"
FT                   /db_xref="GOA:Q9M038"
FT                   /db_xref="InterPro:IPR018108"
FT                   /db_xref="InterPro:IPR023395"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9M038"
FT                   /protein_id="CAB81917.1"
FT                   /translation="MATRTESKKQIPPYMKAVSGSLGGVVEACCLQPIDVIKTRLQLDR
FT                   VGAYKGIAHCGSKVVRTEGVRALWKGLTPFATHLTLKYTLRMGSNAMFQTAFKDSETGK
FT                   VSNRGRFLSGFGAGVLEALAIVTPFEVVKIRLQQQKGLSPELFKYKGPIHCARTIVREE
FT                   SILGLWSGAAPTVMRNGTNQAVMFTAKNAFDILLWNKHEGDGKILQPWQSMISGFLAGT
FT                   AGPFCTGPFDVVKTRLMAQSRDSEGGIRYKGMVHAIRTIYAEEGLVALWRGLLPRLMRI
FT                   PPGQAIMWAVADQVTGLYEMRYLRNAPL"
FT   exon            complement(31298..31837)
FT                   /number=1
FT   intron          complement(31838..32229)
FT                   /number=1
FT   exon            complement(32230..32619)
FT                   /number=2
FT   gene            33867..34969
FT                   /gene="T10O8_60"
FT   CDS_pept        complement(join(33867..33940,34024..34086,34175..34236,
FT                   34890..34969))
FT                   /gene="T10O8_60"
FT                   /product="putative protein"
FT                   /note="EST GB:T21390 marks non-coding 5' exon"
FT                   /db_xref="UniProtKB/TrEMBL:Q9M037"
FT                   /protein_id="CAB81918.1"
FT                   /translation="MAGGGNFIARVISYVANEFIVNGLANSHAFQRFAVRTSKRIENLS
FT                   KMAAENREKVAQQMEEFAKNIDVIHEETLIILVWNLKTSVNHMGQLK"
FT   exon            complement(33867..33940)
FT                   /number=1
FT   intron          complement(33941..34023)
FT                   /number=1
FT   exon            complement(34024..34086)
FT                   /number=2
FT   intron          complement(34087..34174)
FT                   /number=2
FT   exon            complement(34175..34236)
FT                   /number=3
FT   intron          complement(34237..34889)
FT                   /number=3
FT   exon            complement(34890..34969)
FT                   /number=4
FT   gene            35666..37374
FT                   /gene="T10O8_70"
FT   CDS_pept        complement(join(35666..35999,36076..36434,36519..36564,
FT                   36822..37060,37192..37374))
FT                   /gene="T10O8_70"
FT                   /product="putative protein"
FT                   /note="similarity to several hypothetical proteins -
FT                   Arabidopsis thaliana"
FT                   /db_xref="GOA:Q8LED3"
FT                   /db_xref="InterPro:IPR025846"
FT                   /db_xref="InterPro:IPR026057"
FT                   /db_xref="InterPro:IPR029962"
FT                   /db_xref="InterPro:IPR029972"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8LED3"
FT                   /protein_id="CAB81919.1"
FT                   /translation="MSFLIPNRGVGGTKIPLSIIVLVLCGFMFFILLYTERISLLSSSS
FT                   SSSSSFFKLKSCPRKDEKIRKERSEILEVLDDRFEFDPEECNVAAGKWVYNSSIEPLYT
FT                   DRSCPYIDRQFSCMKNGQPETDYLRWEWQPDDCTIPRKGTLSDGSLRYNANLEYNATIE
FT                   FYWAPYIVESNTDIPVISDPKKRIVKVDSVKDRAKFWEGADILVFNTYVWWMSGLRMKA
FT                   LWGSFGNGESGAEALDTQVAYRLGLKTWANWVDSTVDPNKTRVFFTTMSPTHTRSADWG
FT                   KPNGTKCFNETKPIKDKKFWGTGSNKQMMKVVSSVIKHMTTHVTVINITQLSEYRIDAH
FT                   TSVYTETGGKILTAEQRADPMHHADCIHWCLPGLPDTWNRILLAHL"
FT   exon            complement(35666..35999)
FT                   /number=1
FT   intron          complement(36000..36075)
FT                   /number=1
FT   exon            complement(36076..36434)
FT                   /number=2
FT   intron          complement(36435..36518)
FT                   /number=2
FT   exon            complement(36519..36564)
FT                   /number=3
FT   intron          complement(36565..36821)
FT                   /number=3
FT   exon            complement(36822..37060)
FT                   /number=4
FT   intron          complement(37061..37191)
FT                   /number=4
FT   exon            complement(37192..37374)
FT                   /number=5
FT   tRNA            38413..38485
FT                   /note="tRNA predicted as a tRNA- Ala : anticodon agc"
FT   gene            40633..42353
FT                   /gene="T10O8_80"
FT   CDS_pept        join(40633..41581,42019..42353)
FT                   /gene="T10O8_80"
FT                   /product="hypothetical protein"
FT                   /db_xref="GOA:Q9M035"
FT                   /db_xref="UniProtKB/TrEMBL:Q9M035"
FT                   /protein_id="CAB81920.1"
FT                   /translation="MTQRANPKTGCLTAVVRRLLCSGSQQTHPSDNILDSDETLQLLIS
FT                   YEENEEPKKEIKTETETQNDDVSLHPPPPPPPPNVVAKLMGLDHPAPGSKRFRYFDDSG
FT                   SAVTRSKSVNFMDYILKGHEEEEENEDEKDGQRQCRRVKASVSFREIVPTSARWSSNNQ
FT                   QKKHDFLLLYLDKLDEKRELVGSSSFSRSKRFEKVVEDSKKPPLPPSAPKKKENEKVAK
FT                   KFKDEPRKVAKKKKSENRNDVNGAKKVRWFLSPSKSKSSSEKTALLGESKNIRADEFIG
FT                   KESESPENKSNASPVSVLDRDLYDYLILDDDYYFSGGDSESASELSTKQVETATKSSCS
FT                   SSPAKTKTSTKKENNNSTNNDSEETEFITKLMNMLSDLSEEDMKSSTWVSTSSTKPVDF
FT                   TQVEDFCVEFGQEILDLVMDQLVDELCI"
FT   exon            40633..41581
FT                   /number=1
FT   intron          41582..42018
FT                   /number=1
FT   exon            42019..42353
FT                   /number=2
FT   gene            43842..45509
FT                   /gene="T10O8_90"
FT   CDS_pept        complement(join(43842..44477,45174..45509))
FT                   /gene="T10O8_90"
FT                   /product="transcription factor GT-3a"
FT                   /db_xref="GOA:Q9SDW0"
FT                   /db_xref="InterPro:IPR001005"
FT                   /db_xref="InterPro:IPR017877"
FT                   /db_xref="InterPro:IPR027759"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9SDW0"
FT                   /protein_id="CAB81921.1"
FT                   /translation="MDRRNPFQHHHHHHQLHHHLIQQQQLPPPPLSTTATMDPGGGGGG
FT                   GERIPQWSIEETKELLAIREELDQTFMETKRNKLLWEVVAAKMADKGFVRSAEQCKSKW
FT                   KNLVTRYKACETTEPDAIRQQFPFYNEIQSIFEARMQRMLWSEATEPSTSSKRKHHQFS
FT                   SDDEEEEVDEPNQDINEELLSLVETQKRETEVITTSTSTNPRKRAKKGKGVASGTKAET
FT                   AGNTLKDILEEFMRQTVKMEKEWRDAWEMKEIEREKREKEWRRRMAELEEERAATERRW
FT                   MEREEERRLREEARAQKRDSLIDALLNRLNRDHNDDHHNQGF"
FT   exon            complement(43842..44477)
FT                   /number=1
FT   intron          complement(44478..45173)
FT                   /number=1
FT   exon            complement(45174..45509)
FT                   /number=2
FT   gene            48558..50257
FT                   /gene="T10O8_100"
FT   CDS_pept        complement(join(48558..48996,49604..50007,50093..50257))
FT                   /gene="T10O8_100"
FT                   /product="heat shock protein 40-like"
FT                   /note="strong similarity to heat shock protein 40 - Mus
FT                   musculus, EMBL:AB028272"
FT                   /note="Contains dnaJ domains signatures and profile
FT                   AA47-66"
FT                   /db_xref="GOA:Q9M034"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR002939"
FT                   /db_xref="InterPro:IPR008971"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:Q9M034"
FT                   /protein_id="CAB81922.1"
FT                   /translation="MGVDFYKVLEVDRSANDDELKKAYRKLAMKWHPDKNPNNKKEAEA
FT                   KFKQISEAYDVLSDPQKRAIYEQYGEEGLNQAPPPGAGGGYPGGSDAGASFRFNPRSAD
FT                   DIFSEFFGFTRPSFGTGSDSRAGPSGFRYGDDIFASFRAATTGGEASIPSRKSAPIERQ
FT                   LPCSLEDLYKGVSKKMKISRDVLDSSGRPTPVEEILTIEIKPGWKKGTKITFLEKGNEH
FT                   RGVIPSDLVFIVDEKPHPVFKRDGNDLVVMQKISLVDALTGYTAQVTTLDGRTLTVPVN
FT                   NVISPSYEEVVKGEGMPIPKDPSRKGNLRIRFIIKFPSKLTTEQKSGIKRMLSP"
FT   exon            complement(48558..48996)
FT                   /number=1
FT   intron          complement(48997..49603)
FT                   /number=1
FT   exon            complement(49604..50007)
FT                   /number=2
FT   intron          complement(50008..50092)
FT                   /number=2
FT   exon            complement(50093..50257)
FT                   /number=3
FT   gene            50861..59130
FT                   /gene="T10O8_110"
FT   CDS_pept        complement(join(50861..51563,51673..51776,51867..51950,
FT                   52054..52098,52179..52250,52353..52433,52575..52670,
FT                   52743..52817,52903..52950,53054..53137,53225..53332,
FT                   53410..53443,53528..53727,53848..53946,54028..54075,
FT                   54323..54565,54640..54756,55046..55114,55449..55994,
FT                   56109..56663,56769..56888,57093..57264,57703..57871,
FT                   57982..58057,58140..58232,58342..58501,58928..59130))
FT                   /gene="T10O8_110"
FT                   /product="putative protein"
FT                   /note="similarity to symplekin - Homo sapiens,
FT                   EMBL:HSSYMPLEK"
FT                   /db_xref="GOA:Q9M033"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR022075"
FT                   /db_xref="InterPro:IPR032460"
FT                   /db_xref="UniProtKB/TrEMBL:Q9M033"
FT                   /protein_id="CAB81923.1"
FT                   /translation="MASYSRARLKDLANSAKSATELPPKLQRLRYMRRDLQKDDSVFPT
FT                   ELLPHLFDLLSDQFGAVRKFVAEILGEIGLKYVELIPEIVPLLIKSLEDETPAVARQVI
FT                   ACGADLFRSTLERVAVQGLHSSELNDLLESSWTWLIKFKDEICSVAFKQGNSGVKLCAM
FT                   KFVEALILLYTPHEGIEADFNISILRGGHPVLKIGDLSIEASQKLGLLLDQLRHPAAKS
FT                   LNSSTIIVLINSLSSVAKKRPAYCGRILPVLLSLDPLSFLKGVYAAATNLALKTVFLSC
FT                   LKCTHPAAAPDRLTSALKEIEGGGQAAKAKDLFYKTNGSIQDKDSVEDTKVSVEENPLC
FT                   ASSDVAESNLSRKRSGSEYNIDLNGDASDGKRARITPSVSEESTDGLNGNDGVSLPRVA
FT                   STSTGPSDSRGVSDSGPAQQLVGLFGTLVSQGEKAIGSLEILISSISADLLTDVVMANM
FT                   HNIPPNCSSYADGTDELVMNMCIVGSDAQIKYPPSFVAGVLSLSTAFPPIAALINPHNE
FT                   DEEVYSVHVDQQMFPAEDARTPPGLLATCDTSFPENEESNTVSPQNVHYIGNRESGIPG
FT                   LESSAQHDGSGALVTNVLSSTNVEAASKNQNASFSGKLLVDVIPSMSVDKLEEFSPKAV
FT                   GTVASASQFVLPKISAPVVDLSDEEKDSLQKLVFLRIVEAYKQISMSGGSQLRFSLLAH
FT                   LGVEFPSELDPWKILQEHVLSDYLNHEGHELTVRVLYRLYGEAEAEQDFFSSTTAASAY
FT                   ESFLLTVAEALRDSFPPSDKSLSKLLGDSPHLPKSVLMLLESFCCPGSGEVEKDLQHGD
FT                   RVTQGLSAVWSLILMRPGIRNDCLNIALQSAVHHLEEIRMKAIRLVANKLYSLSFITEQ
FT                   IEEFAKDRLFSVVSDDCDKMDLDLKSPPNKPQHSISGMSMETPSEATSSSTSVTEAQRC
FT                   LSLYFALCTKVLRIFTILRLMTNLVFNIYKNASDPVKQAIHLQIPILVRTMGSSSELLK
FT                   IIADPPSGSDNLLIQVLQTLTEGPTPSSELILTIRKLFDTRIKDVEILFPILPFLPRDD
FT                   VLRIFPHMVNLPMEKFQVALSRVLQGSSQSGPVLSPSEALIAIHSIDPARDGIPLKQVT
FT                   DACNTCFAQRQTFTQQVLAGVLNQLVQQIPLPMLFMRTVLQAIGAFPALSDFILEILSR
FT                   LVSKQIWKYPKLWVGFLKCTQTTQPQSYKVLLQLPPLQLGNALTKIPALRAPLTAHASQ
FT                   PEIQSSLPRSTLAVLGLVPDSQGTQTSQVQANETQTSQEQQQQQASEPQQTSQSQQVSV
FT                   PLSHSQVDHQEPSQVVASQSQSSPIGTVQSAMSQSQNSPIDTGRSEMSQSQNSPIDTGR
FT                   SEMSQSQNSPIDTGRSEMSQSQNSPIDTGRSEMSESQSSPIGQSQSSPIGTGQSDMSQT
FT                   PQVSDSSAPEPTSHTRTSDPQASSQTLRDDDEKIDDTATSENEVTEIEKSKESSEEEEE
FT                   EEEEEE"
FT   exon            complement(50861..51563)
FT                   /number=1
FT   repeat_region   50865..50894
FT                   /note="30 bp TCT tandem repeat"
FT   intron          complement(51564..51672)
FT                   /number=1
FT   exon            complement(51673..51776)
FT                   /number=2
FT   intron          complement(51777..51866)
FT                   /number=2
FT   exon            complement(51867..51950)
FT                   /number=3
FT   intron          complement(51951..52053)
FT                   /number=3
FT   exon            complement(52054..52098)
FT                   /number=4
FT   intron          complement(52099..52178)
FT                   /number=4
FT   exon            complement(52179..52250)
FT                   /number=5
FT   intron          complement(52251..52352)
FT                   /number=5
FT   exon            complement(52353..52433)
FT                   /number=6
FT   intron          complement(52434..52574)
FT                   /number=6
FT   exon            complement(52575..52670)
FT                   /number=7
FT   intron          complement(52671..52742)
FT                   /number=7
FT   exon            complement(52743..52817)
FT                   /number=8
FT   intron          complement(52818..52902)
FT                   /number=8
FT   exon            complement(52903..52950)
FT                   /number=9
FT   intron          complement(52951..53053)
FT                   /number=9
FT   exon            complement(53054..53137)
FT                   /number=10
FT   intron          complement(53138..53224)
FT                   /number=10
FT   exon            complement(53225..53332)
FT                   /number=11
FT   intron          complement(53333..53409)
FT                   /number=11
FT   exon            complement(53410..53443)
FT                   /number=12
FT   intron          complement(53444..53527)
FT                   /number=12
FT   exon            complement(53528..53727)
FT                   /number=13
FT   intron          complement(53728..53847)
FT                   /number=13
FT   exon            complement(53848..53946)
FT                   /number=14
FT   intron          complement(53947..54027)
FT                   /number=14
FT   exon            complement(54028..54075)
FT                   /number=15
FT   intron          complement(54076..54322)
FT                   /number=15
FT   exon            complement(54323..54565)
FT                   /number=16
FT   intron          complement(54566..54639)
FT                   /number=16
FT   exon            complement(54640..54756)
FT                   /number=17
FT   intron          complement(54757..55045)
FT                   /number=17
FT   exon            complement(55046..55114)
FT                   /number=18
FT   intron          complement(55115..55448)
FT                   /number=18
FT   exon            complement(55449..55994)
FT                   /number=19
FT   intron          complement(55995..56108)
FT                   /number=19
FT   exon            complement(56109..56663)
FT                   /number=20
FT   intron          complement(56664..56768)
FT                   /number=20
FT   exon            complement(56769..56888)
FT                   /number=21
FT   intron          complement(56889..57092)
FT                   /number=21
FT   exon            complement(57093..57264)
FT                   /number=22
FT   intron          complement(57265..57702)
FT                   /number=22
FT   exon            complement(57703..57871)
FT                   /number=23
FT   intron          complement(57872..57981)
FT                   /number=23
FT   exon            complement(57982..58057)
FT                   /number=24
FT   intron          complement(58058..58139)
FT                   /number=24
FT   exon            complement(58140..58232)
FT                   /number=25
FT   intron          complement(58233..58341)
FT                   /number=25
FT   exon            complement(58342..58501)
FT                   /number=26
FT   intron          complement(58502..58927)
FT                   /number=26
FT   exon            complement(58928..59130)
FT                   /number=27
FT   gene            60634..61563
FT                   /gene="T10O8_120"
FT   CDS_pept        complement(60634..61563)
FT                   /gene="T10O8_120"
FT                   /product="pyridoxine biosynthesis protein-like"
FT                   /note="strong similarity to pyridoxine biosynthesis protein
FT                   pyroA - Emericella nidulans"
FT                   /note="Contains Uncharacterized protein family UPF0019
FT                   signature AA221-239"
FT                   /db_xref="GOA:Q8L940"
FT                   /db_xref="InterPro:IPR001852"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR033755"
FT                   /db_xref="PDB:5K2Z"
FT                   /db_xref="PDB:5K3V"
FT                   /db_xref="PDB:5LNR"
FT                   /db_xref="PDB:5LNS"
FT                   /db_xref="PDB:5LNU"
FT                   /db_xref="PDB:5LNV"
FT                   /db_xref="PDB:5LNW"
FT                   /db_xref="PDB:6HX3"
FT                   /db_xref="PDB:6HXG"
FT                   /db_xref="PDB:6HYE"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8L940"
FT                   /protein_id="CAB81924.1"
FT                   /translation="MEGTGVVAVYGNGAITEAKKSPFSVKVGLAQMLRGGVIMDVVNAE
FT                   QARIAEEAGACAVMALERVPADIRAQGGVARMSDPQMIKEIKQAVTIPVMAKARIGHFV
FT                   EAQILEAIGIDYIDESEVLTLADEDHHINKHNFRIPFVCGCRNLGEALRRIREGAAMIR
FT                   TKGEAGTGNIIEAVRHVRSVNGDIRVLRNMDDDEVFTFAKKLAAPYDLVMQTKQLGRLP
FT                   VVQFAAGGVATPADAALMMQLGCDGVFVGSGIFKSGDPARRARAIVQAVTHYSDPEMLV
FT                   EVSCGLGEAMVGINLNDEKVERFANRSE"
FT   exon            complement(60634..61563)
FT                   /number=1
FT   gene            62944..64149
FT                   /gene="T10O8_130"
FT   CDS_pept        complement(62944..64149)
FT                   /gene="T10O8_130"
FT                   /product="putative protein"
FT                   /note="similarity to hypothetical proteins - Arabidopsis
FT                   thaliana"
FT                   /db_xref="GOA:Q9M031"
FT                   /db_xref="InterPro:IPR002109"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q9M031"
FT                   /protein_id="CAB81925.1"
FT                   /translation="MKSSRMKFAKKLKSIRAGEYLNQDRILQVLSAADEFLPKISNHIP
FT                   QITSAASIWRTPQKSENQIANVTELLENVRQGEEEASGNFVGDEENVRPPVNQIPRVPC
FT                   DRKESKLAVSCGSDTGIGRKSFGSGFRRPDLNSTTLFDPKLLEAFELAALCFRKIKDFS
FT                   REARVNDEDDIVFPEEEEIRKDGNSIPPVISVVEYRRKDENVVVLHKDDGNALQIVNAI
FT                   REEVIGEEDIGKDGNTLMDPLLEFEERCPPGGEESVVFYTTTLRGIRKTFDDCNMIRFL
FT                   LDSFKVKYYERDVSMHREYREELRRISAAETEVLPPVLFVKGRCIGGAQRVLGLHEQGK
FT                   FKILFEGIPITGDERCRRCDGFRFLMCDGCRGSRRIISGDGSRIQCLICNENGLIVCVG
FT                   CS"
FT   exon            complement(62944..64149)
FT                   /number=1
FT   gene            64855..66068
FT                   /gene="T10O8_140"
FT   CDS_pept        complement(join(64855..64893,65152..65233,65316..65413,
FT                   65535..65615,65715..65806,66038..66068))
FT                   /gene="T10O8_140"
FT                   /product="putative protein"
FT                   /note="similarity to hypothetical proteins - different
FT                   species"
FT                   /db_xref="GOA:Q9SCL4"
FT                   /db_xref="InterPro:IPR007305"
FT                   /db_xref="UniProtKB/TrEMBL:Q9SCL4"
FT                   /protein_id="CAB81926.1"
FT                   /translation="MMSFEMNDRKKIGLGLTGFGVFFSFLGIVFVFDKGLLAMGNILFI
FT                   SGVSLTIGFKSTMQFFMKRQNYKGTISFGVGFFFVIIGWPILGMMLETYGFFVLFSGFW
FT                   PTLAVFAQKIPVLGWIIQQPYIRSFFDKYRGKRVPV"
FT   exon            complement(64855..64893)
FT                   /number=1
FT   intron          complement(64894..65151)
FT                   /number=1
FT   exon            complement(65152..65233)
FT                   /number=2
FT   intron          complement(65234..65315)
FT                   /number=2
FT   exon            complement(65316..65413)
FT                   /number=3
FT   intron          complement(65414..65534)
FT                   /number=3
FT   exon            complement(65535..65615)
FT                   /number=4
FT   intron          complement(65616..65714)
FT                   /number=4
FT   exon            complement(65715..65806)
FT                   /number=5
FT   intron          complement(65807..66037)
FT                   /number=5
FT   exon            complement(66038..66068)
FT                   /number=6
FT   gene            67880..69379
FT                   /gene="T10O8_150"
FT   CDS_pept        join(67880..67972,68053..68156,68269..68413,68500..68603,
FT                   68771..69019,69094..69248,69306..69379)
FT                   /gene="T10O8_150"
FT                   /product="putative protein"
FT                   /note="similarity to insulinase - Homo sapiens, PIR:SNHUIN"
FT                   /db_xref="GOA:Q9M030"
FT                   /db_xref="InterPro:IPR011249"
FT                   /db_xref="UniProtKB/TrEMBL:Q9M030"
FT                   /protein_id="CAB81927.1"
FT                   /translation="MSLREREIFPCAKRKTDVKVKNKFESNSLAKVYFRIKCEKAQEAR
FT                   QTALLNLFVSIISDSVYNKLRIEEKLGYLVECETRLIHGVGFYVCVVSSDYNPCHLVRR
FT                   IYKFMNGIRLEGLFDKMFKDFKNGVSSKLPHDSGKTKWSEIVRESCIFDFYSEEKKELS
FT                   LITKNDLIEWYKRYVRLSSPKCCSFVVSIWGCNTKNGLEKVKILRLRRKMKVKKKQFWL
FT                   TQKIPLYLGKSRDEHIITYASCKKNGILLQANESKTDTELCRGKKLCVIKKAMDCRDGG
FT                   YTEQRIDREKIEKVKIEAARPSWPTI"
FT   exon            67880..67972
FT                   /number=1
FT   intron          67973..68052
FT                   /number=1
FT   exon            68053..68156
FT                   /number=2
FT   intron          68157..68268
FT                   /number=2
FT   exon            68269..68413
FT                   /number=3
FT   intron          68414..68499
FT                   /number=3
FT   exon            68500..68603
FT                   /number=4
FT   intron          68604..68770
FT                   /number=4
FT   exon            68771..69019
FT                   /number=5
FT   intron          69020..69093
FT                   /number=5
FT   exon            69094..69248
FT                   /number=6
FT   intron          69249..69305
FT                   /number=6
FT   exon            69306..69379
FT                   /number=7
FT   gene            71751..74302
FT                   /gene="T10O8_160"
FT   CDS_pept        complement(join(71751..71826,71949..72252,72356..72428,
FT                   72573..72719,72877..72955,73034..73121,73477..73570,
FT                   73649..73774,73922..73967,74049..74302))
FT                   /gene="T10O8_160"
FT                   /product="putative protein"
FT                   /note="similarity to hypothetical protein At2g38190 -
FT                   Arabidopsis thaliana, EMBL:AC003028"
FT                   /db_xref="GOA:Q6DBH0"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR032008"
FT                   /db_xref="InterPro:IPR032010"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6DBH0"
FT                   /protein_id="CAB81928.1"
FT                   /translation="MSLPDSLPSSSSSPPVTREETGFHRFEHHGNDSGFDHRDRPPWNR
FT                   SEYDYRHGSVVASENVRNNSTSEDPWSCVVVVATFCIFGNVDDFDSGALWNNECLVEEL
FT                   GNKGSGLILYGLNQAPQLDVLTKWSEVHYLAVPNDSYKYWIQYLNKGSRVKVSYNVESV
FT                   GSSLYLVIAQGVDGLSEWVQDPTRPDTTLSWHIISGKCPSGYIEQDITKSSSYYVAVGN
FT                   VYLNEVKATIDIQVEGVLYDTTNAYYNCSFPNDKCTLSVPLFGTNAAVLTSPGPKLNNS
FT                   KNEFCAKLSYEPRWIAYIVCMGVVTALLLIVSSLFNKRQPVTEDETVDENDDVAPLIPG
FT                   KDDDNSSWCSSYSSILTSTEELEGAHGEGHSSTRYLCAICYDAPRDCFFLSCGHCVACF
FT                   QCGTRIAETSGFCPVCRKKIRKVKKIFNV"
FT   exon            complement(71751..71826)
FT                   /number=1
FT   intron          complement(71827..71948)
FT                   /number=1
FT   exon            complement(71949..72252)
FT                   /number=2
FT   intron          complement(72253..72355)
FT                   /number=2
FT   exon            complement(72356..72428)
FT                   /number=3
FT   intron          complement(72429..72572)
FT                   /number=3
FT   exon            complement(72573..72719)
FT                   /number=4
FT   intron          complement(72720..72876)
FT                   /number=4
FT   exon            complement(72877..72955)
FT                   /number=5
FT   intron          complement(72956..73033)
FT                   /number=5
FT   exon            complement(73034..73121)
FT                   /number=6
FT   intron          complement(73122..73476)
FT                   /number=6
FT   exon            complement(73477..73570)
FT                   /number=7
FT   intron          complement(73571..73648)
FT                   /number=7
FT   exon            complement(73649..73774)
FT                   /number=8
FT   intron          complement(73775..73921)
FT                   /number=8
FT   exon            complement(73922..73967)
FT                   /number=9
FT   intron          complement(73968..74048)
FT                   /number=9
FT   exon            complement(74049..74302)
FT                   /number=10
FT   gene            74881..78066
FT                   /gene="T10O8_170"
FT   CDS_pept        join(74881..75230,75328..75413,75600..75715,75833..75943,
FT                   76128..76226,76349..76471,76753..76815,76898..76962,
FT                   77062..77171,77273..77387,77482..77547,77650..77760,
FT                   77850..77916,78019..78066)
FT                   /gene="T10O8_170"
FT                   /product="putative protein"
FT                   /note="similarity to unknown protein T16O11.13 -
FT                   Arabidopsis thaliana, EMBL:AC010871"
FT                   /note="Contains Prokaryotic membrane lipoprotein lipid
FT                   attachment site AA220-230"
FT                   /db_xref="GOA:Q9M028"
FT                   /db_xref="InterPro:IPR006876"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9M028"
FT                   /protein_id="CAB81929.1"
FT                   /translation="MGDFNLALVIVAIVVCVIVFISSIYLLVNYQHPDDANQAYFPKFV
FT                   VVFGLSIAMISILMLPADVANRHACRHSIYNGACNLTLPMKDLWLAVYIVDAVLVFFII
FT                   PFAMFFYEGDQDKALGKRIKSALIWVVTTAVVCALVLGILYGVIGKVDFSVRHLSSATT
FT                   TFPTSWQFSNNQPCIGNTARQCSAYTANAASEKTWSMRTTFPEYVVALATIVGSVLFTI
FT                   FGGVGIACLPLGLITAFIRRPKAVITRSQYIKEATELGKKARDLKKAADALHQEERSGA
FT                   KGRKWRKNVKAVEKELLQLEEDVNLLEEMYPQGEQAETAWAFTVLGYLAKFVLGILGLI
FT                   VSVAWIAHIIIYLLVDPPLSPFLNEVFIKLDDVWGLLGTAAFAFFCFYLLLAVIAGAMM
FT                   LGLKLVFITIHPMKWGATLMNSFLFNVGLILLCSISVIQFCATAFGYYAQATAAQEIFG
FT                   HTLQSLRGIKYLYKYNVFQIGFVVLAGLTFLYYIAFGWRRKKPSGRFQLST"
FT   exon            74881..75230
FT                   /number=1
FT   intron          75231..75327
FT                   /number=1
FT   exon            75328..75413
FT                   /number=2
FT   intron          75414..75599
FT                   /number=2
FT   exon            75600..75715
FT                   /number=3
FT   intron          75716..75832
FT                   /number=3
FT   exon            75833..75943
FT                   /number=4
FT   intron          75944..76127
FT                   /number=4
FT   exon            76128..76226
FT                   /number=5
FT   intron          76227..76348
FT                   /number=5
FT   exon            76349..76471
FT                   /number=6
FT   intron          76472..76752
FT                   /number=6
FT   exon            76753..76815
FT                   /number=7
FT   intron          76816..76897
FT                   /number=7
FT   exon            76898..76962
FT                   /number=8
FT   intron          76963..77061
FT                   /number=8
FT   exon            77062..77171
FT                   /number=9
FT   intron          77172..77272
FT                   /number=9
FT   exon            77273..77387
FT                   /number=10
FT   intron          77388..77481
FT                   /number=10
FT   exon            77482..77547
FT                   /number=11
FT   intron          77548..77649
FT                   /number=11
FT   exon            77650..77760
FT                   /number=12
FT   intron          77761..77849
FT                   /number=12
FT   exon            77850..77916
FT                   /number=13
FT   intron          77917..78018
FT                   /number=13
FT   exon            78019..78066
FT                   /number=14
FT   gene            78939..80520
FT                   /gene="T10O8_180"
FT   CDS_pept        join(78939..79068,79157..79218,79523..79580,79822..79959,
FT                   80044..80115,80187..80273,80360..80520)
FT                   /gene="T10O8_180"
FT                   /product="putative protein"
FT                   /note="EST GB:AI994631 marks non-coding 3' exon and
FT                   overlaps putative gene model T10O8_190"
FT                   /db_xref="InterPro:IPR019410"
FT                   /db_xref="UniProtKB/TrEMBL:Q9M027"
FT                   /protein_id="CAB81930.2"
FT                   /translation="MGTHYINRWRNTASRLANNNSTSDMDIALFSPASLFAADGDSSDG
FT                   ETTETSQNFVERNHQFPGIELQIREFGFHQLNANLLWPGALAIFLKKEFNLDITTSDYN
FT                   DQEIEDNIVHNCIANKIIPSLPHIKHTWGDEFPISEPDWDLIIASDILLYVKQYPNLIK
FT                   SLTFLLKKYKPTNVVSPAEDTELPRPVFLMSWRRRIGKDDESLFFTGCEEAGLEVKHLG
FT                   NRVYCIKLRESNL"
FT   exon            78939..79068
FT                   /number=1
FT   intron          79069..79156
FT                   /number=1
FT   exon            79157..79218
FT                   /number=2
FT   intron          79219..79522
FT                   /number=2
FT   exon            79523..79580
FT                   /number=3
FT   intron          79581..79821
FT                   /number=3
FT   exon            79822..79959
FT                   /number=4
FT   intron          79960..80043
FT                   /number=4
FT   exon            80044..80115
FT                   /number=5
FT   intron          80116..80186
FT                   /number=5
FT   exon            80187..80273
FT                   /number=6
FT   intron          80274..80359
FT                   /number=6
FT   exon            80360..80520
FT                   /number=7
FT   misc_feature    80400..83499
FT                   /note="overlap to BAC F7A7"
FT   misc_feature    80500..83499
FT                   /note="basepairs from position 80500 to 83499 are not
FT                   integral part of BAC T10O8 but stem from BAC F7A7"
FT   gene            81048..82289
FT                   /gene="T10O8_190"
FT   CDS_pept        81048..82289
FT                   /gene="T10O8_190"
FT                   /product="putative protein"
FT                   /note="similarity to several hypothetical proteins -
FT                   Arabidopsis thaliana"
FT                   /note="Contains Cytochrome c family heme-binding site
FT                   signature AA250-255"
FT                   /db_xref="GOA:Q9M026"
FT                   /db_xref="InterPro:IPR001965"
FT                   /db_xref="InterPro:IPR004146"
FT                   /db_xref="UniProtKB/TrEMBL:Q9M026"
FT                   /protein_id="CAB82264.1"
FT                   /translation="MHHLDHTPSDRLLCPVERIQKDKDGKVTTISGGIHYIIKSSYFIS
FT                   NAEDEKPVHLLSLILRNRKEDKVLSFTFCYVCQIALLGEAYYVYFCSYCPNYYHKECVE
FT                   SPSVFHSSDHPKHPLQLLWIPDMSLEEERDKRCCSCKRGVDALFYYCSICDFAVHMACA
FT                   GNPTSPTIDNPKRHKHTLHYFPRKSGLFCDVCALVDDSDYLYVCLLCDFIVHKRCVYLP
FT                   YVIKVSRHNHRLTFTPNLPYEEPTVTDCGVCHAKINENYGEYSCTKKGCVYAVHSRCAM
FT                   QSDVCDGKKLEGEPEEVYEDTKMFEEKGDGIIQHQSHPRHQLRLEKIFHDESHHCQACR
FT                   RPSYDHGGNVYRCMQCDDFIFHESCAYLPRTKQFMLHVHPLTLDPSYNFIDWFQCGKCY
FT                   RYSCGFRCMCSCAV"
FT   exon            81048..82289
FT                   /number=1
XX
SQ   Sequence 83499 BP; 26110 A; 15808 C; 15715 G; 25866 T; 0 other;
     cttgcatcga acggcaaaag aagcaatcgt ctgaagaatc gcgagcggag gacatctctc        60
     accagccgga gatagatggt ggattcgaat ctcatcgttc gggaatcgaa attcatgact       120
     tgaagataca tggttcacat caagttcccc caaacgtaaa tctccgtgat aaaccacgga       180
     tttatgaccc aaacgattca tcgtgaattc gttcaattca cacttctgaa ggacgaatca       240
     ggtagtgaag ataaacagtt tctgggaaaa tgcgtgagag aatctgcaga ttcaatttct       300
     ctcaaacttc gctacttttc tctgtgattt ttctccgcaa atgagggttt ttctgggtct       360
     ccttaaacat gagaaccaaa gtaggctcag atatatattt ataggcgaga gaagcgtttt       420
     attgttacga catcgatttt aatgtaaatt acgagaaaac ctgagacttc tttacacgtg       480
     gcgtcagatg cattatcctg ttttcaccaa catcgcttgt cagccgtcaa ttaccgttcc       540
     taacaaaata aaatattcga gaattatttt ttgtgtgtat gacgaaatcg gattaggtcg       600
     ataattttgg ttgacttcga acaaatggat agttaatgtt tacaactata tattgtaaaa       660
     tgtggaaacg tattcaataa cttactttag aagtaaataa aaattgtgaa aaaaaaacgg       720
     aagaggatat atatatggta aaatcacaaa aatcaaataa gaacataaag ttggttggca       780
     aaaaaagaga agacatcaag ttgcgagtct tgtgacgttt gagtaagaaa gggacaaatc       840
     aattttatac aatctgtatc atcatattat tatgggtgtg ttggcaaatt agtcactttt       900
     gaaaacataa ttatggagtt gggcaagtta ctatttataa ttggcaaaac aggtaactca       960
     ctttgggcgt gtaatagacg agcgtgaaat agaggtttgg ggtggggtaa gtgatgtgtt      1020
     ttgaaattac cgaactatcc ttttgacaaa gaagaaagat aaaagtgaaa tattcttttt      1080
     tttttttatt tctttttaat aacccctcca atttaataat tgaaatactt atcaatataa      1140
     atttattttc taaactaatt catatacata aaaatctatg tatttttctc tataatttga      1200
     tatgcatttt gttaatattt tttaatatat tacagacatt ttatcagtag tcggtacact      1260
     taattatgtg tacagacttt attttgtatg ttgcattagc tgtacagagt atataattgt      1320
     atggagtata caattatcag aagtcacttt tcactgttga ttcgtacact tagacctgta      1380
     caatattttt agtgtatata tatatatata aatatacaca acatacactt acatctgtac      1440
     actaaaaagt gttgtacaga tctaagtgta cgaatcaaac agttaaaagt gactactttg      1500
     caaattgtga atagtaaaat gactattttc ccaattatgg ctggacgatt tcaatttgta      1560
     cttattaaat aagttgtata aataaaaatc tgtacacata attaactgta ctgactacta      1620
     ataaaaatgt ttatataata tatttaaaat tattaacaaa atgcatatca aattatagag      1680
     aaaaaaatat agatttttat gtatctgaat taatttagaa aataaattta cattgataag      1740
     catttcaatt attagattga agaggttatt aaaaaataaa taaatatata tatatataaa      1800
     gaaatacaaa gaatgagagt atgaggagag agaaatgttg aatctaaaag cacaaatccc      1860
     aattgctttc aacgacatta gagaagaaga agattagtgg catatttgta aataatagag      1920
     ttggtatggg gtatatttga ttttgtctgt aatagggtca aaggtcagtg actaaaaatc      1980
     caattataaa tagtaacttg cccaattcca taattaagtt taaataagtg actactttgc      2040
     aacttaaccc tattattatc aagattctaa gagacagatg tttattgcaa gtcggaaaac      2100
     aattgcctct tcggtccaaa attaacatgt aaatcaaaat tcatggccat tctaatagtt      2160
     gagaaccttc atgagagtat ttaaatatgt atctcaactt atgtcgctta aagttatagt      2220
     tacttgttgt aagttgtaac tcttaagagc aactcatgtc gctgagatta tcgtcgctac      2280
     cgtctaagca caaaatgttg acacttgatt ccgagcttcg gctgctgctc accggccggt      2340
     ttcgacatga tctcacactg tacaccgaag tcgccggtgc tttcgtcact gaatgtcgga      2400
     aattccccgc catgcttcct tttctaacat cctattaaca cataaacaaa agtactccaa      2460
     agttgaaagt cgttgaaatt catggttgat gacctttaat atcatttcat ttgttaccgt      2520
     accatgtgtc tcaaggccat gtcgatggag cttttagata ggtttctacc aaacccaaaa      2580
     ccaccagatc cagagctcga cttcccagcg gaggagtctc cgccacctcc accaagtcgt      2640
     cgactgccgc tttctgtcag tcgcggtgta gcaagttttc tcatattcac aactttctcg      2700
     accttttgat tccccttagc cgcatgactt atcaatctac catcatcgtt gttagtcttt      2760
     gctcgttgtc cacgtaacga aggaacagca ccatttacgt ttccattagg agctcggctt      2820
     ctagaaggcg aacacgattg cctctttgca acatcgcgtt ctgtggacgc tgatcttgaa      2880
     ctacttgacg catcaaaggc tctggttctg ctacttgaag cggtttgtgg cctatctggt      2940
     aacgtagttc tgagattcga tggcgcttct actgagaatc caggcatctc gtaaggttcc      3000
     catggccttg atctcacgat cggagaagct tctaaagaca gagccggttt actcaaaggc      3060
     ttagttggtt tacttctcag tacagtcgat gaaccgttcg gagttgatgg acggcgagtt      3120
     ggagtacttg acctcgatcc cggttttgaa ttaggagccg acatcggcct gttattggat      3180
     cgagtagagg tggctgaacc ggtagtttgt tggtctgttg aggtggtggg cctggttgca      3240
     cgtgcagcgg ttaaggtaac acgtgaggtt ccagttccgg agctagagga aggtctgctc      3300
     catgatcttg ttgagctagt agtagaggac gaggttaatg tcgcacgtgt agttgttgag      3360
     gtggcacgtg aggtcggcgt tgatggcctt ttggctggag ttttagactt tctggttggc      3420
     gtgggaggtc tactcgttga tcttgagcta ctagaggacg atggtcttct gattccagaa      3480
     acagaggagg aactgtgtaa cgacgtcgtt tggtgctcgg actcttcttt gctatagttc      3540
     tctaactgca cataaaaaaa aaaaaaaaaa aacagagatg agcaagagtg tgacgtatat      3600
     gcagacactt aaaaacaaag agattgacga gattagacca cgagatatac tgagtccgta      3660
     cccgagatat aagagtcatc aggttatcat cgggtgcgtt gaggtggttc gttacgtttc      3720
     tactcggtga gcctggtggc gtgaccagcc tgaacaataa gaacaatcaa taaagatcga      3780
     tggcaacaaa tatataaatc gattatgttg aaacattggc aaaaggtcca attttgaaaa      3840
     atatatattt gagatatgta acatcaataa aagtgattga aaagtacaac cataactagt      3900
     taacaaaaac aaataaaaat ccatagctag tgaattgttt tttagaatgc tttaccaact      3960
     caaattctga tgaacaagat cagacatcaa actactgtct agcaagaaga ataaccgaga      4020
     aaattgatca aatttactct ctttttgttc ggtggaatgt gtgctacgtt ctatacgaac      4080
     acaaatattt ttaatgcaaa aatgtaacaa aacataataa aaagggggga aatgtttcaa      4140
     ggcaagattt ttaaatcatg atcagacttt tagagagcat gatcaaatta attaaaaggg      4200
     ggaaatgatt accattcgta atcggacttc tcgccatcgg agtacaataa gttctccccg      4260
     gcagttctcc ggacagggta ttgttgagac gacatcgccg tcgtactact agtattatca      4320
     gattctgcca aaaagataaa tcagaacaaa aaagaagata atttttcgac aacatatatt      4380
     aacacatata cgaacacgga cccattaaaa gcgtaggtcg gtgacgtttc tcgcaacgac      4440
     gcatctccag gaacaaaaga agctcttcat ctttgttttg ggtcaacatt ttaagacatt      4500
     ttttaaatta aattgctgat gctggaagaa agtggtgaag atgttctttt acgtgttttt      4560
     tcttcttctt attatttgaa aatgtcagat tatcattcac acccctacta atgatatatg      4620
     tataagcaag taatatttat tattaaaaag taaggaaagt aattattgtt gttttttact      4680
     tatatcatat taatgtattt tggctactac taagagaatt tttattattt tctccagcaa      4740
     aaatttaaga gatttttttt ctcaatgata ttattagttt atatctttac tttaaaaaag      4800
     aaatacaaga ttatttctca atctccacta aatttctgga aatggtatta ttaaatttca      4860
     ttagattttc ttaaagcatt caattttatt atatctttag aaaaaaaaaa tgccatgctg      4920
     gaaataaaac taaaaattta caatacatta atccaaggtg ccgaaaaaat tctcacgagt      4980
     aaaatcaatg catctgtgtg aaatatatgt gaatctcgcg tatagatgag tttgtcttac      5040
     attgaatcct tccaatgttg tgatatattt ttaagtttag catgttaatg caaaaatgac      5100
     ttatcgatct cccccatgtc acaactacaa gcctcaactc tgctaataag aaataaacga      5160
     aggattccat ggaggatcaa tatgtcgtta tgtgtccaat tcccgattct acttaaatga      5220
     agttggtttg agagacatta ttcttattta agtggattta aagctcaagg cccaataccc      5280
     attttcaaag gcccaaacat taactaggtt ctaggtatcc ccccccttat gtttttattc      5340
     agcaacagtt tcgaatatgt ttcgtctaga cgagcgagac tctctctgct aggtttcgat      5400
     ttcaatttcg atatcaggga ccattttcct gattcttcga attctgcata gagaagcgaa      5460
     attgggatag atctcgttta ctttgatttg tcaatttcct gcattctatt atacgggttt      5520
     tgtgtttcct cgcaaattga tacagactgt tgctttgcca ttgaattatt tgctgcgatg      5580
     gacctaaatg cttcaccaca acccgaagaa gacgatgaac cctttaagag acgtcatgaa      5640
     gatcgaatgg aatctgctgt tgagatcgct agacgggtac aataacccat atatatgaat      5700
     tgattcatgt gttactcgta cttgtttgaa tatgtttgga gcaagtttga tacttttgga      5760
     tgatgatatc gcaaattcgt tatctttttg gcgttatagg agcgtgaaga acgaaagaaa      5820
     cgaatgagat ttgataggcc aacacgagtc tctcagccgg cttttcgtga tcagtataga      5880
     gatactagag tttatgatca aagcaagctt cctcagggta aattatatgc tttgccactt      5940
     cctcaaaaga tcattttagg ttcattggta tgtggttttt ttcttaacag gttggctaga      6000
     ttgtcctggt tttggtctgg agataggatg tattattcct tctaaggttc cacttagtga      6060
     atcttacaac gaacatgttc ctcctggtaa aagatactct ttcaaacagg tggttcgtaa      6120
     ccagagaatt aatggaagaa aagtaagtga aaaaaataca tgaatcaatc tttttctttg      6180
     ctatgttaac tctctaaagg taatgggtct tttgcagctt ggtctagtca ttgatcttac      6240
     taatacaact cgttactacc ctacattaga cttaaagaag gatggcatca agcatgttaa      6300
     ggtgactaga atacattttt ttcttagtgt ttgtatcgtc tgcaccagtg ttagccgagt      6360
     gctttatcct ctttttcctg tttgtagatt gcatgcaggg gtcgtgatgc tgtgcctgat      6420
     aatgtctctg taaacacctt tgtcaacgag gtacttgttt cataagttca gttctcttct      6480
     tgactgacga ataagttcaa ttcacgtgaa gtttattttc tcctcttgcg ttttaattga      6540
     agctcataat tatagctcat ttgaggacac tgtcttcagg ttctgcagtt cgtccttaat      6600
     caaaaacacg caaagaagta tgtcctcgtc cactgtacac atgggcataa tcggacaggg      6660
     ttcatgatag ttcattatct catgcgctct atgccaacga tgaacgttac acaggttcaa      6720
     ttctttcttt cacatttgta cttgttcact cgttttatta atcctcttta gaatggagat      6780
     tcttacctct gtgtggcctt tggcaggcat tgaagttgtt ttctgatgcc cgcccacctg      6840
     ggatttataa accagattat attgatgctt tatacacttt ttatcacgaa ataaagcctg      6900
     aaagtgttac ttgcccacca actcctgaat ggaagaggtc tgccgagctt gatcttaatg      6960
     gtgaagctgt tcaagatgat gatgatgatg attctccgcc tgaccctgtt caagtaagcg      7020
     tggtgcaagc aagtgcttat tctttaataa gctcttatgt ttaaccctca tattacagaa      7080
     ttatccgttc caatgaatat catgcatgca ttgttaagct cttacccttg tgaatacaga      7140
     gctcataatt ttacgaacgg ctaatttttt ttaaattcta gcttcataac tattgtttcg      7200
     aggtcatata ttcactacac agtgatcttg gaaaataacg gtatcatcta aacaaatgaa      7260
     ctgttctaaa gattatctat ttgtgcatgt tgatgggtgc agttgagtct ttcaaagcta      7320
     acaaatttca taaagtgtca atctcatttt gcttgagttt tctaatgggt ctcttgctga      7380
     tactgccttt ctttactgtt ttgttgtttc aggaaatcaa tcaggagaat gtgaagatgt      7440
     caaatgatga cactttgggt gatgaaatac cccattatca ggaggaagct taccggcaat      7500
     tctgttataa aatgcttatg atgaatgttg gggtatgata tcaacactgc ttatatgttt      7560
     tcctagtttt gttcttctct atctatgttc tcctatggaa tattatgttg agcccaaatg      7620
     ttgtttccgg catgtatgtt tcattaaaag catgctaaat gtttttttag actaatgcaa      7680
     taatactaat cttcattgat tggaaataat gtgagatatt agtcatttga tggactaaaa      7740
     tttctctgat ccagggaaga ggatttatgc aattcccagg ttcgcaccct gtatcattag      7800
     acaggtcaga atctctgctt tacttttggt attgcgtaca aagaggattt agcaagtgta      7860
     tgttctgaat tccagaggtt cattagtcct agtttctcaa tgtagttaaa tctttacgat      7920
     ttttgcatac acagggagag tttgcaactt ttgaggcagc gatactatta tgcgacatgg      7980
     aaggcagatg gaacacgtta tatgatgctc ttaactatag atgggtgcta tttgatagat      8040
     aggagcttta agtttcggag ggtacagatg cgttttccct gtaagcactc acgtgaggtc      8100
     agtaattttc tgtcattgct tttgtgttga tatctaaaac ttgtgaattc cctgacttat      8160
     ttggttttgg gtggtaggga atttctgata aagtgcatca ctacactttg cttgatggag      8220
     agatggtcat agataccccg acaggtgagc aaggggaggc aaggaggagg tatctcgtat      8280
     atgatatggt agcaatcaat ggtgaatcag ttgtagaggt tggaactgtc gatccattat      8340
     attatcaatt tctttggaat gagttcagta gcacgagatc ttagcattca ttgttttcca      8400
     tcatgtcact gtcatttcta ctcggtatca accagtatta tagatgctaa agataactta      8460
     cagttgattt aaatatctac cagcggactt tctgtgaaag atggaacatg ttcgtgcgtg      8520
     aggtgatcgg acctcgagca gctgagaagc tcagaagtca ttgctacaga tatgaccttg      8580
     agccttttgc ggtgagtttg cattttctgt tccatgccat attttccttc tcctttatat      8640
     aaatttgttg gtaaaatttc attgttgccc aggtacggat gaagggtttc tggttacttt      8700
     ctactgttga gaagctgttg aagaatacca ttccatcgct ttcgcatgaa gcagatggct      8760
     taatatttca ggtaaccaag agatgtttat atttcaggtc ttagtcaata ttttttcctg      8820
     aacgcagaca gacacaaatt taagagatta gtattatttg tttccctgga taaagtagga      8880
     agattgcatt acttgagcat gacttacatt tggtttatta gggttgggat gatccgtatg      8940
     ttccacgaac ccataaaggt ctactgaagt ggaagtatgc agaaatgaac tcagtagact      9000
     ttctgtatga gatgggtgag gaagaggggc gtggtttcct cttcttgcat gaaagaggga      9060
     agaaaaagct tatggaagga tattcagttg agtttagaga tgattcggac ccgtcaagtt      9120
     acaatgggaa gattgtagaa tgtgcttggg ataaggataa gaaagtttgg tttagcatga      9180
     ggatcagagt tgacaaaact acaccaaatg atatcaacac tgctcgtaag gtcagttgaa      9240
     ggattttcta tatatttagg tattgctttt gtcaaatggt tatattctct acatgatttc      9300
     taatgtgatg ttgtaacaca ataggtgata aagagcataa atgataacat cactgaggag      9360
     gttttgcttc aggaaataag agagatcatt cgtctcccaa tgtacgctga ccgcattcga      9420
     aatgatagtc aagctgcccg ccgccggtag agattacatt tttcaatttt gtttagtagt      9480
     aatacactag aacgaactaa taattgtttt gggcggtttc tcttctctca cacttgtaca      9540
     gctaaataat ctacatggtt atacacatta catctagttt gtttcccaac ggaatttgaa      9600
     actagaatta tttcattgat aatcctcaat acgtgatatg gaattattaa ctatgataca      9660
     tatccaacgg tgttatgact ataacgacga acgacatatt ttaggccaaa cacgtcaaga      9720
     tggcttctcc tagcacgtgc ccttcaattg cgatcagcaa tctctctttc gtcacctagc      9780
     tcatattcag aacaactatt tataaaaaaa agtactacat aaagtactac atatcattca      9840
     aatcagatag gaaaataata aaacgatgta gtaccgtgtg accaatcttg ggtttatcat      9900
     cgagagcaaa aagcttgaac tgaaaacggt gaccgtgact aggtaagaga ggtccacgcc      9960
     atcccggaat cttgtgatcg ttgttccctt cccgaatacc ggtagtctga tcctcattgc     10020
     cggaatatcc ttccggtagg cctttcatct ctggtggtat gtcgacgaca acccacaccg     10080
     tccatggcac cagcgggcca ctaggatcag gcgcatcgat gtcttccacc accaaagcta     10140
     gcgtttttgt accttctgga acgttgtacc tacaccatat caacattctt actaattcaa     10200
     tgcaatcctt tgggtcggtc aataaaccac aaaataatta aaaaatggaa acatgttact     10260
     tcaaacagaa aaaaacaaac aactaggaag ccttgtgaat tgtgataatt aacaaatcga     10320
     caaaattaat aatctctgtt tcagcatcat gaatcaaagt cataaataaa gagcgatcga     10380
     tcggtaccat tcaagaggag gagagatgtc tttcttaaca ccttgacctg ccatcgtata     10440
     ctttctcggc aacttcccat cgttgtctat cgtcggcgaa accagcctca actcctcact     10500
     cgacattccc ttttactttt atgctatttc ttacttagtt ttatcacaaa gagtctcttc     10560
     ttttctactt tcgtacatat gaatgctctt ttcgtgtttg ttactgattt gtatggatcg     10620
     cctatgtgta gaaacaacgc cacgtgacgg tcttgaatga cacttggcgt catgattgac     10680
     acacggcgtc ataggaaatc tggcgaagac ctgtgtttga gcacaactct atattgggct     10740
     ttattgggcc taaattgtat tttttcctct ctactatatt agcctgtctc gttctttttt     10800
     aaatcacgtt atcttattat taaaggacca cttaacagta tactaattat tgttttaaca     10860
     attcccacca aaaaaataat tattgcctta acaataaaac aaagataatt ttaatataaa     10920
     ttaaatttgt ttaattttaa aattacaata aaagatattt cttattttat aaacaaaaac     10980
     tcttctcatc tttttttctt ctatttttta atttattaaa taagaatatc taaattaact     11040
     accttctaac taaaattaaa gtgatttcca tgtaatattt atcaattttg aagtcatagt     11100
     aggatgctct aacgtgagcc gttttaacca atcgttaaca aagaattcgt ctattaagac     11160
     ataaccatga tcaagtccga tgaatctaat agacatgtta tccggtttgc gttccatgac     11220
     agaatatagc caattgtcta tatcattgtt tctatttaag tatacgttca tgacatctgg     11280
     tgtgttgcat aggtcaaaca cgcgcgatag ttcaaggaaa gtgcgttagt gatgaccacg     11340
     acacaatact gcactttgtt ttcatatcgg gatgctccaa gctgagtcac tatagccatt     11400
     tactgtcaaa gaattcgtcc ataaaacaat atttgtgatc aagacggatc aacataacat     11460
     gcatcaactt actattaaaa tttaagagta agttaaagaa aatgttaaaa atttcttagg     11520
     ttggcccatt aaattatatt caaattaatt ctttattttt cacattatat attaaatcta     11580
     atagaaattt attctagatt cgccattgcc gtgtaataca tgaacaaatc ttttaaagat     11640
     ggacatcgca tatgatctac cgagatcata tcatgatagt ctagctgcac aataatccct     11700
     tatacgaaat cattttcagc tggatgcttt ataacacaac attatattag gttagtgagc     11760
     ctatagctaa cttgttttct tttttcatta atcattgttt agatactcat agtaatgatt     11820
     ttgagataag tatctatttt tcaaatgata tatcaatttt aaaaactcat tacatcatgt     11880
     cacaacgtta aaagtataat tatacatata tacaaaaaat tgtatgtatg ttacaaagaa     11940
     aacattgcta attttactat gtctgagtca ctatatgcgg ctggaaagta ccaaaataaa     12000
     tgaagacagt aacatgagtc catcaccatc accaatatcc aaaacttggc tttcacattt     12060
     attttactta tgtaactact atacctttat ttatttattc atttttaatc cttagctttg     12120
     ttgatctagt ttggcaaggt aagtctataa cgtccatcgg cccgaatcct tctttttcat     12180
     ttatttcaaa attaacattt tcttcttcgg aaactatgac aaagcttttt atgtaaccca     12240
     aaaataactt aattacactg tatatccttc tacaaattta cctatatcaa attatgttat     12300
     tatatattgt aatggctttt aagagacaat ggagacattt tctagaacat agcatttagt     12360
     tagatttgta caagccattt caaaactttt caaaaacaaa atcagcaaat aaccagtttt     12420
     gtctttaaag aatcgttctt tcgtaggaac tagcaactgg gaaggtgtaa ataggcgatt     12480
     taaggaaaat atataattga agaaaaataa atcaaatggt cgggactttt tatctcacgt     12540
     gaaagtaacg tcgcatttac tcaacagtcg agacgacagt tacatatttc acagttttaa     12600
     acttgtaagt taaatttaac aaaaaaagaa atacaacttc aaacataatc gttgttaaga     12660
     aatttcatat atatcattcg tttctatatt aatacaaaaa gaatggtatg ggaaataaaa     12720
     tagaaagaat agaatgacta aatcatggaa catgacatga atacggtcac tgtttcaagc     12780
     tcatgcgtct tttccagcat agtagtagta gtagttgttg ttgttgttgt tatccggtct     12840
     tttcaaagca acgtacttcc tatttttctt acttgtataa atccacaatt gttttactca     12900
     aaaggaaaaa aaaactatca attttgcaat ttggctagtt aattcaattt atatctattt     12960
     gttttaaaac tatatttgat ctgtatgtgc aatttattta ctgatttgag gcttttgagc     13020
     atatatattt agtgaatcga ttatagaatt tgtattgaac aatgagagaa gaacgaagac     13080
     atggattggg acaagtacta tacataaacg tgggtaatgt gctatgaagg tagttgtttg     13140
     agaagacagt acgtagagtt tgagctgtaa gaaatgatta gggtttgttt ttcgtctgca     13200
     cttcagtcca atgttttcac cgaaccccac tactacgtga aacccggagc ctcacgtgct     13260
     cttgagatct ttttaccact aaattaacca gttcgtatgt aactatgtct atatatatgt     13320
     ataaccatat catgtaacag ttataaacca cgacaatcac aatggatgat ttcaatcttc     13380
     gtagcgaaaa ccctaattca tcatccacca cttcctcatc ctcttcctct ttccaccgtc     13440
     acaagagcga aaccggaaac acaaaacggt caaggtcaac gtccacgtta tcgacggacc     13500
     ctcagagcgt ggcggctcgc gacagacggc accgaattag cgaccgtttc aagattttac     13560
     aaagcatggt ccctggtggt gcgaagatgg acactgtatc tatgcttgac gaagccatta     13620
     gctacgtcaa gttcttgaag gctcagatct ggtatcacca aaacatgctt ctcttcataa     13680
     acgaccacga aactacatca tcttgtactt actctcccgg cgctggagaa tttggaccga     13740
     aactctttgg ttatgatgac gattatgccc ctataatgga cacatattca caaggcgtgc     13800
     cacttacggt tgcggactcg aagtatacgc cgtggtttgg ttcggttgat gatgagcaag     13860
     aacgtgactc gtcctagtcg ttgccatata tgcaacatta tgtgatttac atatccagaa     13920
     tctaccgtct tccttattct cgcaatactt agtaactata gtttaaggat tatattatat     13980
     gcgtctacta tatatatctg agtgtatcta atttagagat tgtaatatac atgagtatga     14040
     gactaattaa cctatagtat ttgtattgac gtatggataa tcacttggaa acacgaaaaa     14100
     gagagtatac aatactgtat attaattatg gactttaaaa aaaaatcagc attttctaga     14160
     caactttttc attatcttca cacaaaaaat agataaacat ggattaccaa aaaaaagaaa     14220
     aaagataaac aggcgtttta atgtaaattt gggaaacagc acgtcgtttt catgatgcga     14280
     agacgtcacg tatttcaaat acaggcgtgc cacacgacac gcattacgag ggcactgcaa     14340
     ttgtataatc ggagaaacag aggaattcgc cgatcaacga gagaagatgg aagtgcaaat     14400
     tgaagaatct ggtaaaaatc aaacctctcc ggaatcaatt gaagcagaca aagcgaagca     14460
     gatagtggtg cttctgattg gtccaccagg aagcggcaaa tcgacgtttt gtgacaccgc     14520
     aatgcgttcc tctcaccgcc cttggtctcg tatctgccag gtctctcttt tttatcgatt     14580
     gttttatatt gcacataagc tgactgatga aattcttcaa cgagactaag tatttacaaa     14640
     acttatgtaa gaaatatctg tcttggttgc tatcaatgta agaattttgt gttggcttag     14700
     atttcatttg tttaacttat ttcaggacat tgttaacaat ggcaaagctg gaacaaaggc     14760
     tcagtgttta aagatggcta cagattctct tagggaaggc aagagcgtct ttatagacag     14820
     atgcaatctt gacagggagc aacgttcaga gtttattaag cttggtggtc ctgagttcga     14880
     agttcatgca gtggttctgg agcttcctgc tcaggtttgt atatctagat cagttaaaag     14940
     aactggtcat gaaggaaatc tacaaggtgg aagagctgca gctgttgtga ataagatgct     15000
     tcagagtaag gaacttccca aagtgaatga agggttttct cggattatgt tttgttacag     15060
     tgacgctgat gttgataatg ctgttaacat gtataacaag cttggtccaa tggataccct     15120
     tccttctggc tgttttggcg aaaaaaaatt agatactaaa agccaacccg gtataatgaa     15180
     gttctttaag aaagtcagtg ctctgcctgc ttcatcttct aatgaagcta ctaacacaac     15240
     tcggaaagct gatgaaatga cagcaaatgt ccgagtttcg ccagtcaagc ttggttctgc     15300
     tgatattgta cctacactgg cattcccatc aatttcgact gcggattttc agtttgatct     15360
     tgaaaaggct tctgatatca ttgtggagaa agcagaggag ttcttgtcta aacttgggac     15420
     tgcgcgtctc gtcttggtgg acttgagccg cgggtcaaag attctatctc tggtcaaggc     15480
     taaggcttct cagaagaaca ttgattcagc gaaattcttc acatttgttg gggacataac     15540
     taagcttcgt tctgaaggtg gtctacactg taatgtcata gctaatgcta ctaactggta     15600
     agcttccatt attttcttga tcttcagtat atacatcttc actggatagc taattttgaa     15660
     agctaaatgt gtaggcggct taaacctgga ggtggaggtg tgaatgcagc aatattcaaa     15720
     gctgctggtc cagatcttga gactgcgaca agagtacgag caaacactct tcttcctgga     15780
     aaagccgtgg tagttcctct tccttctact tgtccattac acaatgcaga aggaattaca     15840
     catgtcatac atgttctagg accaaacatg aacccaaacc gaccagacaa ccttaacaac     15900
     gactacacca aggggtgcaa aactctccgg gaagcttaca catctctatt tgaaggtttt     15960
     ctatcagtag tacaggatca atcgaagttg cccaaacgaa gcagtcaaac agctgtgtca     16020
     gattctggtg aggatattaa ggaagactct gagagaaaca aaaagtacaa aggatcacaa     16080
     gataaggccg taactaataa tttggaatca gagtctctgg aggacacaag aggcagtgga     16140
     aagaagatga gtaaaggatg gaacacatgg gcattggctc tccacagcat cgcgatgcac     16200
     ccagagagac acgagaatgt cgtgcttgaa tatttagaca acatcgttgt cataaacgac     16260
     cagtacccaa aggtaaaaaa gtcttgatgc tgatttataa atatagtatc tttcttcatg     16320
     tgacaaatga caaataggat ttttcaactg agtttaggcg cggaaacacg tgctagtact     16380
     ggcgagacag gagagtctag atgggctaga agatgttcgc aaagagaatc ttcaacttct     16440
     gcaggaaatg cacaatgttg gtctgaaatg ggttgataga ttccagaacg aggatgcatc     16500
     tcttatcttc cgccttggat atcactcggt acttaagtca tcctttacat tcaaagcact     16560
     gctgaatttt ctgtttcccc tgagtgtaga cttcagattt gcactttctg ttcggtcgtt     16620
     ttagaggtta aacctaagag ttcattagca aaatcattga aattgatatg tttaacatac     16680
     attgagtttt tctctttcag gttccctcga tgcgacaact acacttacac gttataagcc     16740
     aagactttaa ttcagatagt ttgaagaaca agaaacactg gaactctttc acgacctcgt     16800
     tcttccgtga ctcagttgat gtacttgaag aggtcaacag ccaaggcaag gccaatgtgg     16860
     cgagcgaaga tctgttgaaa ggtgagctgc gttgcaatcg gtgtagaagc gcacacccaa     16920
     atattccaaa acttaaatca catgtcagaa gctgccattc tcaatttcca gaccatttac     16980
     tccaaaacaa tcgccttgtg gctagagcag agacgtagta gttataacga ccggttctat     17040
     ttcggttagg attttttttt ctttgttatc taattgttac gggtaatata tattgtgatt     17100
     ttggttcaga ttcagtctct gtaaaaattc atctctgttc ttaggttttc atcttcttct     17160
     ggttattaag tttttgattt tgttcttgag ttataaactt aaatggcaag aaaacaagac     17220
     agataaaaag aaaaaaaagt caaataaatt ttaacccaat tgagatgtaa gatggtttaa     17280
     aaatgtttga tttaggttga atcaattgat ttttttcgga ctttacatat aagaaaaagc     17340
     acaaatattg aagaatatta gggaaaaagg gaattgtatt acaccatcaa tggtaatggt     17400
     acagtacaac taactggaaa gtatcaaaag caattaaaac caacggtcga aaattcgaaa     17460
     attcgaacag aaaacaatct aattcaattg caaagaaacg agagatgctt gagtcacact     17520
     caagattctt ttctcttgct tctactgagg attgggagga cgaccattag cagctgagac     17580
     gcgagatccc cactcaagca actctttgct tgtatcatct ttgtgaacaa tcacttcaat     17640
     gaaacaaaga ctatctttct tctccgttgt cgcagtctta atcgcttcca ctaactcctc     17700
     ctcgtatctc acctgccaaa cacaatgtta cttcaacacc aaattcatac gttagttact     17760
     agttgtaatc attaattacc tttgtggtcc agcattttcc ttcaccgtta tgaatagcat     17820
     cgacaagacc agtgtagttc cagttcttga taacattgta aggaccatca tgaatctcaa     17880
     cttcaatggt gtagccaccg ttgttgatca agaagatgat cgccttctgt ccgttacgaa     17940
     tcatcgtgga tatgtcctga gcagtcactt ggaaactccc atctccaatg aaagacaaca     18000
     ctctcttctc cggggttgct tgggcgtatc ctagagtcgc accaacagac caaccaatgg     18060
     atccatactg catctgaaac tcgtacctac aatatagaga acaacttttc tcaaaacttg     18120
     tgtttgtttc gctattgtca caatgttaga aatgtcaaag attcagtttc tttgttagac     18180
     acgtacccac atcctttagg cagctttagc ttctgacaat tgaaccaaga atcaccagtt     18240
     tcagcaatca cagcggtttc actagagagc atcttctgaa tgtgttggaa cattgcgttg     18300
     accctcaatg gctctcctgg tttgcatttc aatggcttac cttcaggtac aaagatcctc     18360
     tcatagttct cataagctgt ctcgttacgc ttaaccctct tagccaactc cctgaagaaa     18420
     tcgctcatca gaacgcaacc aaacgttgga ccattagcca caacgactcg atcaggatgc     18480
     acaattattg ctttttcttt cttgaggaga agagagtaac ctacggagct gtagtcgttg     18540
     aagattggac ctgcgaagat gtaagcatcc gcagattcga caatctcaga gcagaaaggt     18600
     gtgcttactg ctccccagta agtgccaatg aaatgaggat ggttctctgg tacaaggcct     18660
     tttgtagaag gcatcactgc gagagggtag cctgaagcat cagctagctc caaaaaggcc     18720
     tcacttgctt tagccacacg caactttggg ccaccaacca taactggctt cactgccttg     18780
     ttcagaaact ccaatgttgc ttccaccgca gcttctaaac ccatcgtgtt gctcatccta     18840
     agaaacaata catacaatag tgagaaatct aaaacaaacg ttgattcgat gagtctgttt     18900
     agagtaatga ttacctagga gttaggtcaa aagggacagg atcacgagca aacgtaggat     18960
     gaggagttgc agctaagttg caactgatgc taatgtacac aggcttgctc tctttcaaag     19020
     ctgttgctat cgccttgtcg atctgttcat gagcatcctc caaattgttc accacagcct     19080
     gaaaacaaac acatagttaa aatctaagca aaggagatat atatgtgatg atcaagacta     19140
     gttgatattg aaatgtgtta atacctggta gcaagtaaca gtttggaaac acctaagctc     19200
     ttggctaaag tcaggtaaac cgatggtgtg atgaagaatc cggttagtgc caaaatcgtt     19260
     ggagttagga cctccaacga tacatataac tggtaggttc tcactgtacg caccagcgat     19320
     agcgttcaaa acgctgagtc caccaacggt gaaagtcacg acgcaagcac cgactccacg     19380
     agatcgagcg tatccatcgg cggcgtaacc ggcgttaagc tcgttacagc atccgatgtt     19440
     gttgagctct ggctcggcga tgaggtggtc gagaagagtt aggttgaaat caccgggaac     19500
     agagaaaaca tcggtgactc cggcttggac aagacggcgg gataagtgac gtcctagagt     19560
     cgattcggag gttgtggtga tgggagcgga gtcttggatt gttgcgacgg cgttgcttgg     19620
     tggacttccg atgtcaccag ttgttggctt acacgtgtcg atggctccaa ttttggtgtc     19680
     cattggaaag cttattatga agaaaatgaa accttttagt atttatttta gtggtgatga     19740
     tgagtaataa attggaatta ttagatgggt tatatagttg tacatgttga ttagtgcaaa     19800
     ttacattcgg tttctgactt ccttgtgcca aaagcataaa gatttactga aatatttttg     19860
     caattttctt gctgtcatct tacatttagt tactttttta cagatagaaa tttacttata     19920
     taaattgata cttatataca cgaaacacgg acgttttatt ttgcactaaa aaatttataa     19980
     ttttttgtga tacgaaaaga cattttacgt tagaagatga tgaaaataaa tttattttca     20040
     aactatatta gagtataaca tggatttttt attttatttt tgttattaac tatatatgta     20100
     tctttgaact tgtttgccaa gatgaaccat taatgcagca ttaagtctct gattttcgtc     20160
     ttaactatga tataacttac attaagtagc tgccaaagaa acgaaaaaga acctaaagaa     20220
     atactagatt cgtattgttc aagaatttta ttaccttata ttgagaagtt agtataatta     20280
     ttggaactca ataatttaca tgcacgtaaa ggcattaata agattagaat attccatcct     20340
     gattccatca acaattttca tttcacgttt aagaaaaagc agaaatattg aagtttataa     20400
     tgaaaacttt gtcaacaagg ggttccctaa tatgaaggat attaaaagca aaatcaatta     20460
     aaaccagcgg tcaaaaaatc gaaaccagta cttaattaga cataagagaa agaacaaaag     20520
     tagcgatgtg attagattgc caataaacga tagatgcttg agcgacactc aagattcgtt     20580
     tcttttctct tgcttctact gaggattggg aggacgacca ttagcagctg agacgcgaga     20640
     gccccactca agcaactctt tgctcgtatc atccttgtga acaatcactt caatgaaaca     20700
     aagactatct ttcttctcca atgtcgccgt gttaatcgct tccactaact cctcctcgta     20760
     tctcacctac caaaaacaca acattcataa tgttactctt caaccctgga ctcatatgtt     20820
     taatttccaa ctgtaaacat caattacctt tgtggtccag catttgcctt caccattatg     20880
     aatagcatcg acaagaccag tgtagttcca attcttgatc acattgtaag gaccatcatg     20940
     aatctcaact tcaatggtgt agccaccgtt gttgatcagg aagatgatgg tcttctgtcc     21000
     gttacgaatc attgtggaaa cgtcctgagc cgtcacttgg aaacttccgt ctccaatgaa     21060
     agacaacact ctcttctccg gtgttgcttg agcgtatcct agagtcgcac caacagacca     21120
     accaattgat ccatactgca tttgaaactc gtacctacaa tatagagaac aacgactttt     21180
     taaaactctt gtgtgttttt tcttttccag agaattacta aaaagttctg gggatatcta     21240
     tataggccca taaatcatct caggctaaat accaaggcat tttatatcgt ttccaaccaa     21300
     gtacatatat accaccactc tttaaccagc aatttctaga tgttgacttt actagatgag     21360
     cttatattga ctgcttcaac aatgttaaaa ggtaaaagat ttagtttcct ttttctagat     21420
     acgtacccac atcctttagg cagcttaagt ttctgacaat tgaaccaaga atcaccagtt     21480
     tcagcaatca cagcggtttc attagagagc atcttctgaa tgtgttggaa cattgcgttg     21540
     attctcaaag gctctcttgg tttgcatttc aaaggcttac cttcagggac aaagattcta     21600
     tggtagttct cataagccgt cttgttaggt ttcaccctct tagccaactc cctgaagaat     21660
     tcgctcatcc gaacgcaacc aaaggtagga ccattagcca caacgacact atcaggatgc     21720
     acaatgatgg ctttttcttt cttgaggaga agtgagtaac caacggagct gtagtcgttg     21780
     aagattggac ctgcgaagat gtaagcatcc gcggactcga caatctcaga gcagaaaaga     21840
     gtgctcactg ctccccagta agtgccaatg aaatgaggat ggttctctgg gacaaagcct     21900
     ttggcagatg gcatcactgc cacggggtag cctgaagcat cagctagctc cacaaaggca     21960
     tccctagctt tagccacacg caacttggga ccaccgacca taacgggctt cacggccttg     22020
     tttagaaact ccaatgttgc ttccacggca gcttctaaac aatccttgtt gctcaaccta     22080
     atttaagaaa caatccacac atctttgagc ttgattcttg aagagaacag gattgatcag     22140
     ttatatttac cttggagtta ggtcaaaagg gacaggataa ctagcaaatg taggatgagg     22200
     aatggcagct aagttacagc tgatgctaat gtacacaggc ttgctctctc tcagagctgt     22260
     tgctatcgcc ttgtcgatct gttcatgagc atcctctaaa tggttcacca cagcctgaaa     22320
     acaaacacac tgtcaaaatc taagaatgtg atgatcaaga ttcgataatg tggttatacc     22380
     tgatagcaag taacagtttg gaaacaccta agctcttggc taaaatcagg taaaccaatg     22440
     gtgtgatgaa gaatccggtt agtgccaaaa tcgttggagt taggacctcc aacgatacat     22500
     ataactggta ggttctcact gtacgcacca gcgatagcgt tcaaaacgct gagtccacca     22560
     acggtgaaag tcacgacgca agcaccgact ccacgagatc gagcgtatcc atcggcggcg     22620
     taaccggcgt ttagctcgtt acagcacccg atgttgttga gctccgggtt ggcgatgagc     22680
     tggtcaagca gagataggtt gaaatcaccg ggaacagtga aaatgtcggt gactccggct     22740
     tggacaagac ggcgggataa gtgacgtcca agagtcgctg cagaggagcc gagtatggtt     22800
     gcggcggtgg gagcggagtc ttggattgtt gcgacgccgt tgcttggtag acttcggacg     22860
     tccattggaa aatgagctta ataattagga tatgatgatg aagctctctt tgtttttctt     22920
     gtgagcagta taatgctgtt ggattatata gttgtttgtg cgttgtagta gattcaaaac     22980
     actaccagtt tatttcgtaa taaaattgtt tagtaattat atagtttttt atacgaataa     23040
     tgcatacgat tatattataa aatgttcaat tagacataca gaattaatca tctgattttc     23100
     ctctctggac ttacatttaa ttcaacgtgc aaagaaacga aaataatata ttttaattgt     23160
     ttataaagat atactgatca gttgtattat tgttcaagac gacttgtatt aacttgaaat     23220
     aaattattag aattcaataa tttacatgtg atgcgcgcaa gggtagagtt acatcgtgat     23280
     cccataccat aatacttcac atgtgtatgt ggccatattt aacaacattg cgagtctttt     23340
     tgttccttgc ttcttatata gttaaacgat tcatactaat tctgttactt gggatttggg     23400
     aacaaattgt tcttgttctc ataaattaca ctcttatcta tgttagtaaa cttacgacgc     23460
     tcattataaa gtatcacatg aacaacaaaa agtctccatg gtgatggaac attgctattt     23520
     cattaatatt taaatggatt attaatgtgt taacgtggga gcacatgtta acgcgtgaga     23580
     acaagttgtt atgttttcat aacattaaaa ccaaaaaaaa gggttaataa catgttgtta     23640
     aacaacaatg tatatttcaa cgtgtaaatt ttttttttgc cagacattct aacgtgttta     23700
     gtgattacct tgaaaactat ctcttcgaat cattgttaat atctcaaacc aacagagtcg     23760
     ccggtaatat attcccaaca ttcattttga gtacataaac aatgtgacca acttttaggc     23820
     gattagggtt tttccgtttc tgccgccgcg ttgctggtcg ccggcttctc gccggttgag     23880
     atcttgtcat gtctaagaag aaaaagaaga tccctctcct tcctgtcagt tcaaagttcg     23940
     ctcgggtttt ggcttgcgct cagtccggct ctgtccccct gtcgtcgtct gctccttccg     24000
     gatctgcttc gcctccttcc tctggtcttc cctgcgctgg ctctttggct ctggttctcc     24060
     ctgttcctct ggttttcgac ttggaagaga attccttgtc tcccgaggtt atttcggaga     24120
     ctgtttctct catcccgaag tcgtctactc ttactcctct ggtagctatt gaagcgaatg     24180
     ggtcatccat tcagcctctg cctactgtaa tttcctcctc ggttggcttg ggatcagtgt     24240
     ccgagatctc ctccgctggt tcccccattt tgactccttc agttggctca gctcctctct     24300
     tagctccgag ctcagggcct gttggctcct cagatatggt tgctaccaag tctctctctt     24360
     tgggatctgc tattcctcag tcttcgactc ctatttcggg ctcttcctct caggccccca     24420
     gctccgattc aaaaattgat cttccttggg tagctaagtt taaggcttca ctgcataacc     24480
     ttaagcaaat gagtcagcca acttacttgg aagatggtac tccggttgtg atcgctcctt     24540
     cctcggtctt gttgaagtct gctgctttgt ggaagggcca tgtcgtagct caatttcatg     24600
     gctcttgtcc tcctgcaacc cggatcttct ctgatttgaa tccaatttgg ggaaattacg     24660
     gtgatattac cgttcgcatc gtctccgaga ctgtggctct gatttttatt ccggctctta     24720
     atactcgcca atgggtggtg gatgtgggat tctggcaagc tggtaactgt tcttgtacag     24780
     tctacccttg gtcttcagaa ggtctcctta atattgatga gttgaagact gctccaacct     24840
     gggctgtatt gaagaatgtt cctcctcagc tctattcgct tgaagggatt agtgttattg     24900
     ctagtgccat aggggttcct cttcacacag aaaaatcaag attagacccc atcaatatag     24960
     gttcaactaa agttaaggtg gtgatcaagc tggacttgcc tcttccttct tctgttgttg     25020
     taaaggatgt tcagggtaat tctgctaggg ttgatgtgga gtatcctcga cctccgccga     25080
     agtgtttaaa ttgtggtaaa tacggacatt tattgagtcg ttgcctcatc cctcttcaga     25140
     aaaaattgcc atttaagaag gactctcctt caggagccaa agaggtggct cttcctccaa     25200
     tattcttccg gcagctggaa gtagtgactc agttagaggt gtcgaccttt ctcctcctat     25260
     tgcagctgag atacctttgt cgaaatcaaa aaggaggcgc tctagatcaa aaaagcgatc     25320
     ccttagctct cctccacgga ttactgaccc tctattacct ttctctcccc agtcttctct     25380
     ttcatcgcag actttggcta gtaaaaggtg ggttgcaaaa ccaggaacga tctcatctga     25440
     tctcaaggtt ggagtaattc agggttctgg ttctattcaa caagctgctc aacctaagag     25500
     gtctatgcgt gactccatca aagatccaga tcccagtttt cccttgccta tgggttggac     25560
     agtcatgtct actaaggcta agaagaaaga actcaaaaag tggcataatc gtctccgttc     25620
     ttctgaggca ggttctattg atttagctgc tagtaaggac cttgaaggtc cttcttctca     25680
     ttgaaagctg tgctttcacc ttcacctttt gttgtgtata tgaaggtcct tcttctaata     25740
     atcttcttgt cggatgtttt ttggagactc acgtggcaga ggagaatgca aactcggttt     25800
     tggcctcaac ccttcctggt tggaggatgg atagcaacta ctgttgctct gatcttggga     25860
     ggatatggat tgtttgggat ccttccatct cagttttggt ttttaagaaa acagatcaat     25920
     ttatgttatg caggataaag ctgcccaatt tatctcaatc ctttgcggtt gcttttgtgt     25980
     atggaaggaa taatgatatt gaaaggagat ctctttggga ggatatttct gttttgtcta     26040
     ggtcctcccc tctctctcat accgcttggt tgctgttggg ggacttcaat cagatagcag     26100
     cttcttctga gcattactct atcacacagt cagccttcaa tattcgtggt atggaagatt     26160
     ttcagggttg tttgagggac aatcagctct ctgatctgcc tactaggggt gtgttcttca     26220
     cttggtcaaa tcatcaacag gataatccga tcataaggaa gctggacagg gctttggcta     26280
     atgatgagtg gttttcttcc ttcccttctg cattagcggt ttttgatcct ccgggtgtct     26340
     ccgaccatgc atcttgtatt gttatgattg ataaccagcc tgagccttca aaaaaatgct     26400
     tcaagtattt ctccttccta tcctctcatc ctacttattt ggcagctttg gctgttgctt     26460
     gggaggaaaa cacaatgatc gggtctcaca tgttcacctt aaggcagcaa ttgaaacagg     26520
     ctaagttgtg ctgtaggaag ctgaacaggt tgcggttcag taacatccaa cagaggacgg     26580
     cccaagcgct gtctcgtctt gaagagatcc aagtagatct tcttactgtc ccctcagact     26640
     ctctttttcg acaagagcac gttgcgcgta aacaatggga tttcttcgct gctgctcttg     26700
     agtctttctt taggcaaaaa tcaaggataa gatggcttca tgaaggggat gctaatacga     26760
     gattcttcca taaagctgtg atttctcatc aagcaaataa tctcatcaag ttccttagag     26820
     gagaggatga ctctagagtt gagaacgttg atcaaattaa agggatgctg gtcgcctatt     26880
     actctcattt gctaggttct ccgtcggaga atgtcactcc ctttcctgtt ggcaggatca     26940
     aggatctgct atccttccac tgcgactctt ctcttgcgac tcagttgact ctggttccta     27000
     ctgacgaaga aattacgcag gtccttttct ctatgtctcg gaacaaagct cagggccctg     27060
     atggttttcc ggttgagttt ttcattgaag cgtggcctat tgtgaaggtt agtgttgtgg     27120
     ctgctatcag ggaattcttt ttgacttgga tcctctctaa aggctttaac gctacaaccc     27180
     ttactctcat tcccaaggta accggagcgg accgccttac tcaattccgt ccggtggctt     27240
     gttgcactac tatttacaag gttatcactc gccttatttc gaggaggctg aagctcttta     27300
     tggatcaggc ggtccaggct aatcaagttg ggtttataaa agggcggttg ctgtgtgaga     27360
     atgtcctcct tgcttctgag ttggtggata actttcaggc agagggtgag accactaggg     27420
     gttgtcttca ggtggatatt tctaaggcat atgataatgt aaactgggag ttcctcatca     27480
     atattctcaa agccttggat cttccttcgg tgttcattaa ttggatttgg gtttgcattt     27540
     cttctccttc ttacagcatt gctctgaatg gagagttggt tgggtttttt tccaggtaag     27600
     aagggcattc gtcaaggaga cccaatgtct tcacatcttt tcgttcttgt gatggatgtg     27660
     ttggctaagt ctctggactt aggagcaatc aattgtcttt tcaacctcca tcctaaatgt     27720
     ttggctccca tgattactca cttgagtttc gcggacgatg ttttggtttt ctcagatggc     27780
     ttagagtctt ctattgctgg aattctttct atattggatg actttaagct tggttcaggt     27840
     ctaggtatca acagagagaa aacagctttg cttttggata gaggaaattt tgaaagaaag     27900
     agacagttgg ctgctaacct tggaatcact catggttctc ttcctgttag atatttggga     27960
     gtgcctctta tggctcaaaa aatgaagaga caggactacc agcctttggt tgaccgtata     28020
     agcatgaggt tctcctcttg gacagcgaga cacctttcat tcgatgggcg tcttcagctc     28080
     cttcagtctt tcatctactc caccattaca ttctgggcgt cgatttttat tctccccaac     28140
     cagtgtcttc ggaagcttga acaattgtgt aatgcttttc tgtggacagg tgcgcctaac     28200
     tcagctagag gagcaaagat atcgtggaac attgtctgta ctgcgaagga agcgggcggt     28260
     ttaggtctga aaagactctc ctcttggaat aaagttctag ctctgaaact tatctggctc     28320
     atctttacgg cggctggttc tctttgggtg tcttggatca gattgcatct cataggacat     28380
     cggaacttct gggatcttaa tccagttttg tcaggaagct ggatttggag gaggctgtgt     28440
     aaactacgcc ctattgctcg tcagttctta ttctgtgagg ttggttcagg tgtgaccgcg     28500
     agtttctggc aggataactg gactgtcatg ggcctttcat tcatttgact ggtccagttg     28560
     gacctcttct tgcttgtctt cctttgaact cggtggttag ggatgctctt cggaatgaca     28620
     actggtggat ctctactagt aggagtcgga atcctgtcat tgccttactc aaaagttctc     28680
     tgccgtctgc ctctagccta attgattgtc cgcatgatga ctcttacctc tggaaaatag     28740
     gtcatcatgc accatcaaat aggttctcca catcggatac ttggagattt ctcgagactc     28800
     cgtacagtcc ggttccttgg cacaaggcag tctggttaaa agatcatgtc ccgaagcagg     28860
     cttttatttg ttgggttgta gctcacaaca ggttgcatac tcgtgatagg ctcaggagtt     28920
     ggggcctttc gattccttcg acttgtgttt tatgcaataa tcaggatgag tcaagggatc     28980
     accttttctt tcaatgtcgt tacagctcag agatttgggg tttcttcacg gctgcctccg     29040
     gtctctcttc tcctcctact ccgtttatgc attgtctgct gtggttgatg agtgcatctc     29100
     aggataggaa tgtgtctctt attatcaagc tcttgttcca agcatcggtc tatttcattt     29160
     ggagagagcg taacttacgc gttcattcta ataatattag gccagctcat ctcatcatca     29220
     aagaaattca gctcattgtc agggcccgtt tggacccgct ttcgcggcct tctcgcgtgt     29280
     cccagtctca gtctcagtct caatctcgtt cctcgccgct tgcgacttgg tttggattgt     29340
     tctgagttcc tctcatgtct cgtgacttcc tctgttgcag gtctctctct aagctgggtc     29400
     gtcgcttttc agtcttgggt agtccttccc ttctgtaagc ctttctctgt gttcttttgt     29460
     tggacctctt tctttctttt gggctttgtc tctgttgggc ctgcgtgcca gttttgggcc     29520
     tgcgtgcctg ctgttagcct tcgggccttg taatgtttaa agttttaaat ggaaaaaaaa     29580
     aaaaaaaaaa aacattcatc tacttgatag tcttgattga tcagtttcat acaactactt     29640
     ttcccaaaaa gtatatcatt taatttaagt catatgacta ctactagaac gttttgtcgt     29700
     taaacgaggg ctagtttcca aatcctaaga ccattctctg acagaaggaa attttgttct     29760
     caaatccaat ttttccacaa aaattcataa ccctaacgtt tcatgattat tggacagcct     29820
     atgtccaaat gaattcggac tattaacaga cgggcctaaa tgattttagc ccatattaat     29880
     tagttcagtt ttaggcttaa ctggaaacag acgatttata ttaggacagg tctagcccaa     29940
     ggacattaag cccgtttgac atctctaact gaaggttagg tgccacaagc ccaacaaatt     30000
     tcaaaaatga aacaaatcct tgagcgaaaa tgaatcagct gtcaaggttt ctagttagaa     30060
     ataaacagat tcagtgacga acatttacaa attacaacat aataaaaaca gggttattga     30120
     ttttagtttg tgtgcttcag taatcagaca gaattgacga acttctacga aaccaggtta     30180
     tgcaattcaa tgggtagcca tataagttct aagtgacgaa aattgcgttg atatcatcac     30240
     cctgatgaag aataagaaac ttcaaattgt ttaagatggt gagggcataa aaggatcatt     30300
     aatatcgtat taatctatat cttcaccaag ctactaatat cgatacggac ttaatgtcac     30360
     gcctcctacg aattccaacc attaatcata aatttcaata agattatgta gcagcaaaga     30420
     ggaaaagata ggttatataa aagattgaat aaccaatcaa aaaatcctca cgcagccatt     30480
     acatgatttg ggcaactggg aaaaagagag agatcgatgt tcgattcact cggcaaaaag     30540
     ttgccttctt ttttaaaaca agaagctatc aaaatttgat tttttttata aaaaaaataa     30600
     taataatttc ccatcagagt aactatgaca atatagcatc atatggaact gataaacaga     30660
     tccatagctt tcgataaata tcctcattag gaacaaattg cacaaaactt tttaaccgag     30720
     caaacaaaaa aatattttca aagaattaac tagaggaaga tagatgacaa cagccaaaag     30780
     aagcgtctat ataaaggaga ggttgcgatg atgatgatgg taaagatggc ggcggctaac     30840
     tagggttttg atgaaagccc taaagttgcg ttggcgttaa tagtatatat aagggaattg     30900
     gcgaaggcgg ttgaaaactg tgggcctata tgttccaaat gtggcccata acaaaatgac     30960
     cccagcccaa actaatatgg atgtgacagt tttaagagtg acaaactgaa tttgcctgac     31020
     actgttgcca attttgggcc ttatagtata taaatgataa atcagtggta ttcacttttt     31080
     acgtttttaa gcgtaatttt gctatgcttt gtagtaaaac ttatttagtc agagtcttac     31140
     agacaacaac aaaatggaac tcccaaaatt tgattataga gtaacatcgt tataaaatgt     31200
     gcgattaggt ttatttttct tgatcaaatc aaaatcctaa caagaatttt cagaaataca     31260
     ccaactagaa acactgaatt tcaaaaagtg tctctgccta taaaggagca ttccgaagat     31320
     atctcatctc ataaagacca gtgacttgat cagcaacagc ccacataatg gcttgtcctg     31380
     gaggaatcct cattagcctc ggcaataacc ctctccataa ggccactaat ccttcctctg     31440
     cataaatcgt tctaatggca tgaaccatcc ctttatatct aatcccacct tcactgtctc     31500
     tgctctgagc catcaacctc gttttcacca catcaaacgg tcctgtgcag aacggacctg     31560
     cggttccagc taaaaaccct gagatcattg actgccatgg ctgcaagatt ttaccgtcac     31620
     cttcgtgttt gttccacaag agtatgtcaa acgcgttttt cgctgtgaac attacagctt     31680
     ggttggttcc gtttcgcata accgtcggtg ctgcacctga ccataaacca agtatgcttt     31740
     cttctctcac gatggttcta gcacaatgta ttggtccttt gtacttgaaa agctcaggac     31800
     tcaatccttt ctgctgctga agtctaattt tcaccacctg gagataaaac agagaactca     31860
     acagtgtttt acttgagtaa atgtaagcaa aatctgtgtc agactcaaaa tgcttatgat     31920
     tatgatgaac acgattctcc gaatcaagag ttgccatgaa caatagggac caaagagatt     31980
     cgttggccaa aagcatcaaa acagatctca acaaatcatt ttttatctct ttgactaaaa     32040
     tatactaaat aattgatgaa cagagatgat tttctggtgc aagaataatc taacaatttc     32100
     aattacacca aatctttgac tcaactaaca ctctgatgat taaactatag ttttaaatcg     32160
     attcataatc taataaaata ttagagaagc catgtgattt cattgtctcg aaaaggcaac     32220
     aagacttacc tcaaagggtg taacaatggc gagagcttca agaacaccgg caccgaatcc     32280
     ggaaagaaaa cggccacgat tgctgacctt tccggtctcg gaatccttaa aggcggtttg     32340
     aaacatggcg ttggatccca tccgaagcgt gtacttaagc gtgagatgag tagcgaacgg     32400
     tgttaagcct ttccagagag cacgaactcc ttcggtgcga accaccttcg aaccacagtg     32460
     agcgattcct ttgtaagcgc cgacgcgatc tagctggaga cgcgttttga ttacgtcgat     32520
     tggttggaga caacaagcct cgaccactcc gcctagtgag cctgagactg ctttcatgta     32580
     cggcggaatc tgcttcttcg attccgttct cgtcgccata tctgattcct cggccggtga     32640
     gcgaatcaga aatcgagaag gaagcagaga gaaagagaga gagagatatt cgtccttctt     32700
     ctcgttacag actctctgct atttattctt ttgttatttt ccaaaaatgt ttgctttaga     32760
     aagaaagaaa aagataacaa aaagaaattg agattgtttg ttgtatcctt aaagtgtgag     32820
     aaagaaagtg accttttttt ttttctttta gagatgtcat tggcacaata ttctcataat     32880
     agtgggtttt atttaaaata aatatgcata ttcaatcaaa aaatgaaaat acttttacat     32940
     cttcaaacca cgatagtagt gatcaaacac ctttcaagtt tcaacaacca aggtaagttt     33000
     ggcgtaaatc gatttcatca ccataaaaat ggtagatgtg atttgggcct cttattaaaa     33060
     gggaccatct ttgatttgat gtcttattca acggtcgtaa atgcctaacc aaatgactat     33120
     gcttggtcat tgtttttagt ttcgcaaggc caatagccat tgattattac ccttttcatt     33180
     gcctttttcg ctttgtcctc ttctttggtt tagaatgttg ttgttacgcg tttctttttt     33240
     ctttttctag ggacaatttt gacgacactc gggttccaga ttttattatt caatttttgt     33300
     ttttctagag ctgatatgaa tatatgctta tgttcaaatg agacactatt gtgttagctc     33360
     tgggagacag tagtatataa caatggaagc atgagtggag agtttaggaa agagtgatta     33420
     agctttggga aaaagaaatg cattgtccta aataaataag agctgtgaaa aacatatttg     33480
     actttaatcg aatcctatta tatcctatat tagtatattg ggccgattgg acagtagatg     33540
     attggactat tgggccgata cagaaacgat tatagacatt aattctatac acaagagaca     33600
     tccacagcac cacaagtctg tttcaaaacg ggcccgtaat ttacatattt aaaatcaaag     33660
     ccacagccca aaacgaaaag aatcaataaa tgtgctctac aaataagtag gaagcaaaag     33720
     acgatagaaa ttccttcata cagtggttag tcactccgga agagttgggt ttaagagaag     33780
     agaaacagca ccaaaagatc actggttgtt taatccacaa gcttattact ttttaacatt     33840
     ctttatacaa agataaacag acctccctac ttgagctgac ccatgtgatt tactgaggtt     33900
     ttaagattcc acactagaat gatcagggtt tcttcgtgga ctgcaaaaaa aaagcaaagt     33960
     tgtttagtct taaatgtcaa tatatgtttt gtagaatcaa tgaaagattg tatgcataaa     34020
     aactcacgtc aatgttcttg gcaaattctt ccatttgctg agcgactttc tccctgttct     34080
     ctgcagctgg aaaacaaaca tccacttttt aataagattg tgggttacaa caagcagacc     34140
     aatcattatt gagctaaagt atgaagatgc taacccattt tagagaggtt ttctattctc     34200
     tttgaagtcc tcacagcaaa tctctggaaa gcatggctgc cataacagaa tataaacaat     34260
     tagacatcca ttagcgaatg tccagggagt cactaagact actaaagaat cttatcaatc     34320
     agacaaataa aaaggaatca aacaaaaaca aaacaataaa cagcctcagt ctcttagctt     34380
     cacgtttaac gtcatgtctt taatcaggac aagcctacga aaatcatcac cggcagtaat     34440
     ccacacccca aaaaacaaca taatgaaaaa ccgacaatcc taaacaaagt aaaacctgag     34500
     ttatctaaaa acaaatttga ataaaactca ggacaaaatg ttcacttaaa aatcagcgaa     34560
     tagctttgcg caaagccaaa aagaaatgta caaattgcaa acaccaaaaa atgtagaacc     34620
     taaactataa caattccaaa actaaagcca aacttttttt ttatcacaaa gaaaaaaaaa     34680
     aagtgtctca aacttcctac gctgcagcgt atggtaaatt acgtagcaaa ccagctgaag     34740
     ttgagattaa tcttgcttca atattgaacg agccgataag gaacatattt ccaatccaat     34800
     cagccagaga aagaagctta ctttttgata tctacccaat tcatcattaa aaagtacaaa     34860
     ccctaaatcg ttataaggaa tgaaagtacc tgtttgccaa accattaact atgaactcgt     34920
     tcgcaacgta tgagatcact ctcgcaataa agtttcctcc tcccgccatt ctcgctcttt     34980
     cctatcaaaa acgaaaccct aatgtcaata attatccacc aaatcgcaac aatttctaga     35040
     gaaaactaaa tccaacagga aaataagaga cagaaactcg aaaaatcaca gctttacaaa     35100
     caaaatcaaa caacaattga taaaacctca gatgaatcaa gagatcgtat aagcaagaga     35160
     atcggcctta cctgatgcaa acgaagagga aggttcgaga cccaacaaga tctgcgtcaa     35220
     gtccctattt tacattatac cagatttgtc cattatatag acctcgcatc ttcctcgtga     35280
     cggcgaatga gtttttgcgt aatttgtctt aggtctctca tcggacggtc acgatgttct     35340
     gtaacaaaat cgaacggttc atattaccca ctagtcaaca ttaacctaaa aactcttagt     35400
     tctggaattc ctattttacc cttgtttctc cctctattta caaataggcc agagacgggc     35460
     caggcccatc taggccttgt aatattatta cttttgtttt agtcacttca aggtcatata     35520
     ataaacgggc cgagtctgtt tgatcttatg aaaattgacg acaatcacaa tacactgaaa     35580
     caaacaaatc tccgacaaca caagaggaga aaaacagagg atttgggttt ttcccgttta     35640
     accctcagct tcctcctagc ttgatttaca aatgagccaa taggatccga ttccatgtat     35700
     cgggtagtcc aggtaaacac caatgtatac aatcagcgtg atgcattgga tcagccctct     35760
     gctcagcggt taggatcttg ccacctgtct cggtgtaaac tgatgtgtga gcgtcgatgc     35820
     gatactcaga gagctgcgtg atgttgatga ctgtcacatg cgtagtcatg tgctttatca     35880
     cgcttgacac tactttcatc atctgcttgt tagagcctgt tccccaaaac ttcttatctt     35940
     ttatcggttt cgtctcgttg aaacacttcg tgccgtttgg ctttccccaa tccgcacttc     36000
     tgaacgtttt acataacact ttacgttaat cacaaaccaa acacatcaaa acatataata     36060
     aaactaaatg tttacctagt atgagtagga gacatggtgg tgaagaagac tctggtctta     36120
     ttagggtcaa cggtggagtc tacccaatta gcccatgtct tgagtcctag cctgtaagcc     36180
     acttgtgtgt ctagtgcctc tgcaccactc tctccatttc cgaaagaacc ccacagagct     36240
     ttcatgcgga gaccactcat ccaccaaaca taagtgttga aaaccaaaat atcagctcct     36300
     tcccaaaact tagctcgatc tttcactgag tccactttca ctatccgttt ctttggatcc     36360
     gaaatcacag gtatatctgt gtttgattcg acgatatacg gtgcccaata gaactctata     36420
     gtcgcattgt attcctatga atcaagaaaa acagagaaac ataaaataaa aatctaagct     36480
     ttgcttgtaa tacaaggtac tgtgatatct gacctaacaa ggtttgcgtt gtaacgcaag     36540
     ctaccatcac ttaacgtacc tttgctttaa atacaaagta tttttggcta cgcttcattg     36600
     atttttctcc ttcgggtatt attgattcca ccaaacacac gaacgattcc cattggcttc     36660
     gttgcaacga atctcccaca aaaagtagtc tttttcctct gagtttgttc attgctaact     36720
     tcggactaaa tctgtttgga attgaaatga agctcataaa ggttctgtct caaaccttga     36780
     accaaactag tgttagtttg tgttactaag ttgtatttta ccgtggaatt gtacagtcat     36840
     caggctgcca ttcccaccga agataatcag tttctggctg tccgtttttc atacaagaga     36900
     attgacgatc gatgtatgga catgatctat cggtgtagag tggttcaatt gagctattgt     36960
     aaacccattt ccctgctgca acgttacact cttcgggatc gaattcgaac ctgtcgtcaa     37020
     gcacttccaa tatctctgat ctttcctttc gaattttctc ctctggcaac aaggaaaagc     37080
     aggggaattt catgagacta cttgcacaac aagaaaggaa cactgaaatt ggacaaaaca     37140
     gagttttcag attcgagtat cgcgtatgtg cttactaggt ttcgagctaa catctttcct     37200
     cggacaagac tttagcttga agaaagatga agacgaagag gaagaagaag acaacaagct     37260
     gattctttca gtgtataaga gaatgaagaa catgaaacca caaagaacga gaacgatgat     37320
     ggagagagga atcttggttc ctcctactcc tctattagga atcaagaagc tcatagtggc     37380
     aaatctggta atttatgtaa agaacgtgtc gaaattagga attataggga aagatgtcaa     37440
     gtgagtgtta tggtttttat ttgggaaatt aggaattgag taggagtgaa gctaaaggca     37500
     tgtttggatg tgttgcttcc atctttttgc ccaatttaat aaagatgtgg ttagggaggt     37560
     tatgacttat gattgggttt tgtctattga ttagaacctc taaacgtgaa atgcacattg     37620
     ttattcatta ggtcattgtt tttagaaggc ttccttgtag ttgtattatt tcaatcaata     37680
     atttagaatt tcatgttgaa tattggacca aaaataactg gtgttgttga tcacaccata     37740
     tatacaatct acttacttag tatatttatt tattcaacta atgagttgtt tacacacatg     37800
     aatctcttca actgaaaaga tcttatttat tcaactaaat gtataacata tcaaatttaa     37860
     gtatttaact gttgaataaa tttacttgat taaattctag ttattatatt cgtatatacc     37920
     tagaagacta gaccatatat agagcaactt acaaagttgc aatgacatgg aagttcaaaa     37980
     gaaactgtta atttgatgag gagggttaat caactgattc aaatcgctaa tcaatcatca     38040
     ttcctcaaaa gtcgtttagt gtgaggaaca tatggttaag gaatcgttgt tatcttcgcc     38100
     atcgacatca gattaaacaa cagaaaacaa aaatatcgaa tttatcaatg ggcacatgaa     38160
     aacgaaataa acaggcacca actaaataca atagttggtg ttgcttgtaa aatcaacaat     38220
     agttcatgtt agttattttt agtagataaa ttggtaaagc aattattaaa ggcaaacaca     38280
     aatcattaag tgattaataa tgcaactaat taataatgca tatatagtgg ggagtgttgc     38340
     aacatacttt ccgtcattaa atcagatatt atgttttagt atgaagaaaa aggggttaac     38400
     tgaggaaaaa aatggagatg cggggtatcg atccccgtac ctctcgcatg ctaagcgagc     38460
     gctctaccat ctgagctaca tccccatcgt tgttcaaccg ttcaaatact taaaatatcg     38520
     gcttacaatc aaaagttatt cctgtttgtg tctgggctag taatgggctt tcgaatacgt     38580
     ttcgagattg atgtattagc atctccgtac aaaccaataa gttaatgcca acaacataga     38640
     aacttgccta tattcttgag gttttggaca aaacaattcg atctatatta ttacgtaaat     38700
     tataatgagt tttggtttta aaaacaaatt ttaaagggtt tatatttctt atttttatat     38760
     acaaaaaata gaagtgaaat aatttggaga gatatgctta gatagaagaa agaaacagaa     38820
     atgcataata attggtcgag agttgatagg gaataaggca agtctctttg tggcaatatt     38880
     attcacgcgc gtcagacatt atttagattt gtctctctgc tttcgttgcc tctttttccg     38940
     gtgtgaacta agcgacccaa gtactttctc cttcaccttt gaaaatgacg ccacgcatat     39000
     cagattttct cgtgtttctt attttgaaaa aaagttgaaa aagttgaaaa aggaaaagta     39060
     aaaaagaatc tgtaaatatt ttatactacc attctcttct ttttctttgt acacttcgaa     39120
     ttttgaattt ggaatctttg atcttgacga tcatgccttg caaatattta gctagtgaag     39180
     ccatcaactt tttatagaaa gatattattt aacataacaa tagcatcata tcttaatgaa     39240
     ctaaaagaag tactagctac attgtgttac ccgttgcgca tgtattgtat caacgaatga     39300
     aattataaaa actaacgcta actaaatggc caaatataat caaacagaaa aaacaagaag     39360
     ttctatatta tgaaacagac taatcgtgag taaatgtaat gatcagatta atcatacatt     39420
     attaatctct taaactcgac gacaagaaaa tcaatgaata cctttaagtt agttgctcta     39480
     aagactctct atatatgttt ataatagtaa agcgaagtag ataggtttcg aagaggcctt     39540
     ttgcaacttt ataatattca tcttgtaaag attctaatca ctattcaaaa gattgatccc     39600
     gccaacttat ttagtatctg ataaagattt agtcctctat atcttaaaat gaattgtttt     39660
     accgtgcagt gcacattgag aaataagcta gaagtttctt ttgttgaact gtcattctgg     39720
     ctaaaattat agttctttca aaaaattata gtaacggaaa attttcacat ttcaagtttg     39780
     tttaacatta ctaatctgac tttagctaaa ttctcatttt attttagaat tgcatgtgac     39840
     atattggttt gctaactata tacatctact tcaaaattca agtttcaacc tgaagttata     39900
     ttcagtatgt ttgaaaagta aatcacatat agtaacattt tgttcaaagc tttaaagcaa     39960
     tcagaacaaa gtttgaccat tttaaatata aaacttacgt gaaggaaaaa aagttgttac     40020
     atgaccttta ttttgaaata attgatgagc atatcaatag tatcaaagtt tctttcaaaa     40080
     gtatcaaagt ttcttttcgt ccgttgagtt tcaaaaaaca gaatcatcag agcatatcac     40140
     tttggatata gcttttaaat tgatcctggg tactttttcc tttctatgtt accaataatt     40200
     aatctattat atattatgtc ataagataca taccgataag aaataagtga aatataatgg     40260
     ttacatcatt aactgaaaac atattttatt cactgcaaac aaataaaata acataacata     40320
     gtaattttgg taagatctta aaatatctga agtgacttaa tatgattaat tagattgagt     40380
     taccaattaa tataaactga ataataaacg tttattaaac tacaatttca cttaacatat     40440
     caaaatttca cgatactttt gtttacccat atagttttgc tttaatttaa ttagttggtg     40500
     ggtcctcgca aataatgaga aattgtgtgt tcttcttgtc cttataaata ccaagaactt     40560
     gtttgcacat tttcacacac actccaactt aaagcactat cattatcacc atcatcatta     40620
     tcagccatca ccatgaccca acgagccaac cctaagaccg gctgcctcac ggcggtagtc     40680
     cgccgtcttc tatgctctgg tagccaacag actcaccctt ccgacaacat cctcgactct     40740
     gacgaaacac tccaactact aatctcttac gaagaaaacg aagagccaaa gaaagagatc     40800
     aaaaccgaaa ccgaaaccca aaacgatgac gtctctcttc accctccacc acctcctcct     40860
     cctcccaacg ttgtagccaa actcatgggg ctagatcatc ccgcacccgg atcaaaacgg     40920
     ttccggtact ttgatgattc cggttcggct gtcacaagga gcaaatcggt taacttcatg     40980
     gactacatcc taaaaggtca cgaggaagaa gaagaaaacg aagacgagaa agacggtcaa     41040
     cgtcagtgcc ggagagtcaa agcttccgtt tctttccgtg agatagtccc aacctcggcg     41100
     agatggagct ctaataacca acaaaagaaa catgatttcc tgctgttgta tcttgacaag     41160
     cttgacgaga agagagaact tgtcggatca tcgtcttttt cgaggtctaa aaggttcgag     41220
     aaggttgtgg aagattccaa gaagccgcca ttgccacctt cggcgccgaa gaagaaggag     41280
     aacgagaaag ttgctaagaa gtttaaagat gagccgagga aagttgcgaa gaagaagaag     41340
     agtgagaatc gaaatgacgt taacggagcc aagaaagttc gttggtttct ttctccatct     41400
     aagagtaagt cgtcgtcgga gaagactgcg cttctaggag aatcaaagaa tattcgggct     41460
     gatgagttta tcggaaaaga gagtgagtcg ccggagaata agtctaacgc gagtccggtt     41520
     tcggttcttg atcgagatct ttatgattat ctaatccttg acgatgatta ctacttctca     41580
     ggtgagtcta cgaaataata ttcaaacatt tttatctctc gaacaaatat ttgaacttaa     41640
     ttaattgctt tttgaacctt ctttgaaatt ttgcgaaaag aatcatctca tgtgagtagt     41700
     ttcctacttt aactgcaaat gaggtaaaaa tttggtcatt tggtcaacat tttaaccgat     41760
     tcagtacact ttatttgaaa tactaaataa taagattatt caaaatttga ccaatataag     41820
     aattttcctt aaacgttgga tttatttgaa aaatgattaa atttaaccaa tataagaaca     41880
     ttttcgcttt taacattttt cttgatttta ctgtaaaaaa agctgcgaaa atgagacttt     41940
     ctcaacattt tcgagaaatt ttatttttat ttgcccaatc atattttaaa cgtcacttta     42000
     atttgaaaaa taaaacagga ggagattcag aaagtgcatc ggagttgtca acaaagcaag     42060
     tagagacagc aacaaaatct tcatgttctt catcaccagc aaaaacaaaa acaagtacca     42120
     agaaagaaaa caacaatagc accaacaatg attcagaaga gacagagttt atcacaaaac     42180
     taatgaatat gctctcagat ctgtctgaag aagacatgaa gtcttccact tgggtttcta     42240
     cttcgtcaac taaacccgtt gactttactc aggtcgaaga tttttgtgtc gaatttggtc     42300
     aagagattct tgaccttgtt atggaccagc tagttgatga actctgtatc tagtttaaat     42360
     tcccaattat cagaaatatg tcgttttaaa atcttgtaat ccaaatgtta accagagact     42420
     cacaacaatc gaaattttca tcactccata ttttctaaaa gtgttatgcg gccaatataa     42480
     gttattgacc agaaaaatta tggttaacat ttatgattag tactaaagac tataatgtac     42540
     tcgtcttaaa tagtcctata gacaaatata cctatccaaa acacaagtat gtatatggcg     42600
     aatatcacca aataagcaca aggataatct tagtgactcg aatactcgat cataagaatg     42660
     aaattaaatt caaattcgat atgacgaatt atcaaatgca ttataaatac atgtagtggg     42720
     tccaaaaacg gtcaaatcgg ttttcttctg aattttggag agctccgtaa cttcgaaata     42780
     cgtactgtct cctttatgtc tatttcacat gcaaatcatg gtctccttct aacgttactt     42840
     ctttgacgtt tttttgtact tttctgtgtt ttttttgggg ggttcacatg taaaattcaa     42900
     gaacattttc ccactctaaa ttatttaagt ttcgaattat aattatttca tttagtcata     42960
     aactattttt ttgccaacga aaaagtggta aatattgaag gtccttgtat tcgaactggt     43020
     gacctcacag agttggtcac acggctctat acaattgagc tgacgcggcg tattagtaat     43080
     acgtgttttt taaaatgaac ggatatatta gtgtgaacgc gttataacac ggtttcatgt     43140
     tttcggtatt tttatctgtt ggtagctgtc ttgcaagaga agaaaagaat aaaaataaca     43200
     aattctttct ttacaattta cttatgaaca aaataagttt tatatatcac acaaataacg     43260
     cggtgaagta atgtgggaca aatgtgaatt gaaagttttg gaataaagac ttttgtttaa     43320
     ttcttgttta tcgcctgatt aatcgttatg aaatattctt attaacagaa taaagtagct     43380
     aaaagtattc aaccaatttg gttttggaca cctataacta tgaacaatat aattcaaact     43440
     agcatatcta attaatatct atacaattgt tttatgcatg tacgtaaact attaaatgat     43500
     ttattaattc ttattcttat cgtttagtta attcacatgt taccttatat tatatttagt     43560
     aattgcctgc tcgttttact ccctctctat ttatttttct tcctctaata ttgaaggttt     43620
     atttttctcc accaggattt tttttgtttt tagaaggata aattcatttt cataccacga     43680
     taacatatat caaaatttga acatttatct ttctttttgg aaatttcaat agttcatata     43740
     aatattataa aacaaacatt aatttagata tattatctaa attgatttgc ctaacaaatt     43800
     aactagctaa ttaacttatg cttaacacaa ataatgagaa cttagaaacc ttgattatga     43860
     tgatcatcat tatgatctct attaagccta ttaagcaaag catcgatgag agaatctctc     43920
     ttctgagccc tagcttcttc tctcaaccgt ctctcttcct ctctctccat ccacctcctt     43980
     tctgtggcgg ctctttcctc ctctagctcc gccattctcc tccgccactc tttctctctc     44040
     ttctccctct ctatctcctt catctcccat gcatctctcc attccttttc catcttcacc     44100
     gtttgcctca taaactcctc caatatatct tttagtgtat tacccgcagt ttcagctttc     44160
     gtaccactcg caacgccttt tccttttttt gcacgttttc ttggattggt cgaagtacta     44220
     gtagtaatca cttctgtctc tcttttctgt gtctctacta aagacaataa ttcctcgttg     44280
     atatcttgat ttggttcgtc aacttcttct tcttcatcat cagatgaaaa ttgatgatgt     44340
     tttctcttcg aggaagtgct tggttctgtg gcttctgacc acagcattct ttgcattctt     44400
     gcttcaaaaa tcgactgaat ctcattgtag aatgggaact gctgcctaat agcatctggc     44460
     tcagtggtct cacacgcctg tcccatgaat attcattatg ttatataaac aattatatgt     44520
     aaacacgtaa tagtaccgac gcaaaatatt ttagctaacc aagtatctta actcgaaatc     44580
     atatatcata ggaaaacaaa aacacatgtt catcatctat atcacgtttc ttttacctta     44640
     aataaatgtg tgtatagact ttttcaacta tcttcatgtg ttcatcagta acggttctta     44700
     ttaaatctta tgcacccgtt atataacggt aattatattt ttatggcata ttgtgttact     44760
     tacttaccat gtgatcaacg aacaaaaaga gagatattat ggtataacgg atcaaaatgt     44820
     gaacatagac aatatcatga tgaaagctca ccaataaacg cgtaaaattc tattctatag     44880
     ctcgttacca ttaatgacag gacaatatct aaaaaaccta ggcgattagg ttaagctcat     44940
     taattgatgt atatataatg tagttcacct atacatacac cataaactag gtttccattt     45000
     caatatgcat aatatcagtc taaccacaca aactagtgat gaaatacatg atacacataa     45060
     ttatagtttg tatatacttg taatcatgat catactaaac atttataggt gtatatatcg     45120
     ggactatata tagagagaat catcaatagg attctaaaga gttgaagggt aaccttgtat     45180
     ctagtgacga ggttcttcca cttgctctta cattgttctg cgcttcggac aaaacccttg     45240
     tcggccatct tagcagccac gacttcccaa agaagcttat tacgtttggt ctccatgaaa     45300
     gtttgatcaa gttcttctct tatagccaaa agctcctttg tctcctctat gctccactgt     45360
     gggattctct ccccacctcc tcctcctccg ccgggatcca tcgtcgccgt ggtgctcagc     45420
     ggcggcggag gaagctgttg ctgttggatc aagtgatgat gaagctgatg gtggtggtgg     45480
     tgatgttgga aagggttacg tcggtccatt atttggaatc gaattgtctt tgtgacgtga     45540
     agagaagaaa taagagggag ataattttat ttttttgttg ggttacttat aaatgaagag     45600
     aggtttcatt gaaaaaaaga agagaagaca gagaggaagg agagaaaaga gaagaatcta     45660
     attaatttat aaggatgtgt gaaaagaagg tgtgaaatcg tagagggacg atagaagtgt     45720
     agttttttgt tcttttctct aattaaaatt attaagatga gattttttaa taattattga     45780
     atatactaga acttatagaa ttatttagtt gaataaaata cgaacacgaa tgactctttt     45840
     ggtgaaaagg acacaattcg tgattacatt aaaaataata aagcttagat atcccttttt     45900
     cggatgataa actctagatt taaagcagct aactaaataa ttcatacttt ttttttcttc     45960
     gtattctaga gtttaaaaat agcaatctca aacaattaca ggggtaactt gcatcagtta     46020
     agaatatctt aagtaaaaac aatcgcctta atcttagagt aaaatcaaac aatatgtttt     46080
     tttttgacag attgattatt tgtgtgcatc attctaaaca cgctttcaaa tttgtaaagt     46140
     tgtagaacta tatttttact gtatggttat tgtttttcct tgatgatgat tttgtgacca     46200
     agctcaagta ctcaactgtc tcgtattttt tgcatttggt agttattcgt taataatttg     46260
     tcccaataca tataaatgtt gcgttaatat ttcgtcacgc ttacgagtta cgagtcacaa     46320
     tccgattttt attcttcaat ccgatttagc ctttatggtc aattgaccca ctagattttc     46380
     ctcatcccat aattcttgta tttttctttt gaaaaattca tcgtaacaaa agtaacctaa     46440
     tggttgacag acaaaatata ttaaataagc tattggatca atatgctttt agaagtttag     46500
     attagccccg tgtcatggag gaagagatca gatataaaca aagaattaga gaattgttgt     46560
     tagcaagttt tacataatag atacctaacg ttcctatcaa aataaaaaag aagaagaatt     46620
     aagttacaga aaacaagact accgttatga ttagctaaga aattaatttg attggaattg     46680
     taaattcccc caagaaaaaa agaagactat tcatttatgg attgtatgat atttagtata     46740
     tgaataaatg gaaatcgtta tattcgcagt cggcacaaaa caaataatgc gtacgaacag     46800
     agaaaatgta ctcttgttct gaaatggttt ggatccagtg caatatacaa ctgtcagatt     46860
     cccaaacaca catatggtag tacatattta gaagccgcgt cattgcaatg atataacaag     46920
     taaaacgtac ggtgaatgaa acttgtagga gtaaatattt tttatttgta tctaaagaaa     46980
     gattcgtcgg ggttgtattt ttggctctga tatgtgtaag aaatactagt actactcagt     47040
     agtaaaaaaa aaaacaaaaa aaagtcagcg aagtggtcca aatagcgatg aagcgtgttg     47100
     aaagtaaatc aaaatcttac atgacatgca ctagacttcg ctcccacctg tcatcccacg     47160
     tggattcaca ccttatttat ttatactaaa ttaataataa tgtcgactac tctagtgaat     47220
     gatctttaat ttttctaatt cttatgttca aaatttgtgg tctttaatta tttaaaagag     47280
     aaattgtgaa tgaaggaatt ttctgtgaac aaaagaaaga ataatcagta ttttttaatt     47340
     ttatttaaat ggaatcaaat aatcagcaac gcggagtgtt gttatattcc acgtgtaaac     47400
     gcccaccatg tttgtccacg tggccatctc tctctctgtc tttcactttt tattttaaca     47460
     aagatttttg ttggctgatg tttatccgct caatacaagt aggccacctc atcatccttt     47520
     ttatttccca tccaaatttt tgcttaaaag aattgaagtc ttaaagcaaa gaacaaaaaa     47580
     aaaacgtcag ccaaaagcat atatacaaaa atcagcctat tcgtgttatt tagaactttt     47640
     gaggtgaatg ttgtttaggg tatcgctccg gattattcgg aaatagtaat aagtttagtc     47700
     ttttactttt gccgtaactt ggtgaatgca catgacttcc atttttgaat ttggagtcac     47760
     tgcaacaata cattgttgtt acaaatacca aaaacctttc tcactgtttg taatactgct     47820
     ggttttgaac caagaccatg aaaatgatat ttcagttgat tgcagaaact cttcttgttc     47880
     ttgaaaacat tcaaatattt gactaaacta aactcgatct gtgtttattt ttttgaatct     47940
     ataaatcata ctaactttat gaatgaatat tactaattcg tacatgtgga gatatgcaag     48000
     taatttgcct aaccagaaca atcaaagagg aacatacatt agtctgtttt ttcttcttct     48060
     tattatttga caagtaacaa caattattcc atgtcaacat cagcacgtga gggttgaaaa     48120
     gattttagtg aaggaattaa acgggacaag gtcaagaaga ttgaagaatg tgagaaaaac     48180
     gtagagattt ggatttttta atcaacaaaa gaaaaaggtt cttcaaattt cgctactatg     48240
     attaatcaat ttgaattaca ttttgacata ttgttaaacg ttgatttagt ctttccaaat     48300
     ctgttgacaa tgtttactat taaacaaata ttgaagcttt tagcaaagag atataaggag     48360
     agactttact tcactagtcg tcagtcatta ctaactaaac cggcatcatt tggtggtatg     48420
     tatttccctt aaaaacctta ccaaaatgca accaaaataa attaaaaaaa ccataagcac     48480
     atattctgct tctaaaagat tccaaaaaag ctagcagatt gaaaaaactg aaacgagatg     48540
     cttcaatctt tggacattca aggtgataac atccgcttga tccctgattt ctgctcagtg     48600
     gttagcttcg aagggaactt gatgatgaat ctgattctca agtttccttt tcttgacgga     48660
     tctttaggga tcggcatgcc ttctcctttc accacctctt cgtacgacgg actgatcaca     48720
     ttgtttaccg gaactgttaa ggttcttccg tcaagagtag tgacctgtgc ggtgtaacct     48780
     gtgagagcat ccactagaga aatcttttgc attaccacaa gatcattccc gtctcgtttg     48840
     aaaacgggat gcggtttctc gtctacgatg aaaacgagat cggatggtat gactccacga     48900
     tgctcattac ctttttccag gaaggttatc tttgttcctt ttttccaacc gggtttaatt     48960
     tctatcgtca agatctcctc aaccggtgtt ggcctcctgc attaaaggat aaacagaggt     49020
     tttgtcagta gaagaacgta gaaaataaaa tttcagtaat gtctttatac tcatggtagt     49080
     ggaaatcaca aaaagtagga atgaatttcg atacttgaga ttgcgaaaag gaagatattc     49140
     aagagagctt taagcagaca ttctaacaag gattagagat gaatcaaatt gaagacaaga     49200
     gacaccatta caatttgtag agttgaagag atttccgttt tcatgaaaaa acagatgaag     49260
     ctaaaatcca taatgaaagt ggttaagtag gtcaaggaat gtcctggtta gctatagcta     49320
     tcggttccta cacttacatc tatcatttat gtgccgatag agagatcaaa tactgaataa     49380
     aggtcacaga gtacacaact tagatgctaa caaaaacctg ttcaaaagaa gaactttcta     49440
     ataagctgac tctatagact attatagctt tcatagacta aacatttgga accaaactcc     49500
     acagaaagag agtttaaact gttctagaaa gaaattggcc aaaagcagca gatatatccc     49560
     tctactaaaa gccaaatgtg tgatcatcaa tggaaaaaca aacccggaag agtcaagaac     49620
     atcacgagag atcttcatct tcttggagac acctttatac aaatcctcca agctacaagg     49680
     caattgtctc tcaataggag cagatttcct agaaggaatg gaggcttctc ctccggtagt     49740
     agcagccctg aaggaagcga agatatcatc gccataccta aagccagaag gtcctgcgcg     49800
     tgagtcgctt cccgtaccaa aagaaggcct cgtgaaacca aagaactcgg agaagatatc     49860
     atcagcgctt ctgggattga accggaaaga agctccggcg tctgatcctc caggatagcc     49920
     accaccggcg ccgggaggtg gggcttggtt taaaccttct tctccgtatt gctcgtagat     49980
     tgctcgtttc tgaggatcac tcaaaacctg attcacaagg aaactgcatg aattttgaaa     50040
     aaggaaaaag tgaaattgaa agaggggaat ggtcaaggag ggaaggaatt acatcgtaag     50100
     cttcagagat ctgcttgaat ttagcttcgg cttctttttt gttgttaggg ttcttatcag     50160
     gatgccattt catggcgagt ttgcgataag ctttcttaag ctcgtcgtca ttagcacttc     50220
     gatcaacttc aagaacctta tagaaatcaa cccccatctt ctctctctct ctctctctca     50280
     ctcactcaat cttcttcttc actggatttt attaggggtc gatgactact ctcttcgact     50340
     tgtttatttc attttcttcc gggattctca ttttaatcca acttaaccga tccaaccgtt     50400
     cgtgatttta accggtaaac tccttttttt cttttcttta atagtattcc cgttttatta     50460
     tgatcagttt ttaacttaat gggctgcttt ctacccaaaa agaaacctta atgggctgat     50520
     tggttaaggc tttgggtatg caaacattct tttttttttt tttttttcgc aagggtatgc     50580
     aaacattcat gacatatatt ttttataaaa aaaactttta ttaaagtctt aactcaaaga     50640
     aaacaatgac aatacaaccg ctaatgactc attaaaagaa atctctaact aaattctaca     50700
     aaattcattt tgaaaaaaat tgctacaata catggaatga agatttcctg ctctaatcga     50760
     cgcttcattc actcttcttc tccgacataa gaggtagaag gcaacctgaa tttaatttca     50820
     aagtatctct tcttctctct caagttacat aatgttacac tcactcttct tcttcttctt     50880
     cttcttcttc ttcttcggaa gattcttttg atttctcgat ttctgtcacc tcgttttctg     50940
     aggttgctgt gtcgtctatc ttctcatcat catctcgtag tgtctggctt gacgcttgag     51000
     gatctgatgt ccgagtatgg cttgttggtt ctggagcact cgagtccgac acttgagggg     51060
     tttgactcat atcagactgg ccagtaccaa taggactgct ttgtgactga ccaataggac     51120
     tgctctgaga ttcactcatt tcagatcttc ccgtatctat gggactgttc tgagactgac     51180
     tcatttcaga ccggcccgta tctatgggac tgttctgaga ctgactcatt tcagaccggc     51240
     ccgtatctat gggactgttc tgagactgac tcatttcaga ccggcccgta tctatgggac     51300
     tgttctgaga ctgactcatt gctgactgga cggtccctat gggactgctt tgagactgac     51360
     tggcaactac ctgactgggt tcctggtgat ctacttggga gtggctcaat ggtacagaaa     51420
     cttgctgaga ctggctcgtt tgctgtggct cgcttgcttg ctgttgctgc tgttcctgac     51480
     tcgtttgtgt ctcattcgct tgcacttggc ttgtttgtgt tccttgagaa tcagggacaa     51540
     gtccaagaac agccaatgta gacctaccaa caaacatgtt tcatatctcc gtgatcagca     51600
     aatggatttc aaatagctga agttgtttgt ttagaactgg aattcatgga aatttgaaag     51660
     aggaaaggtt accttggaag tgaagattga atctctggct ggctggcatg tgcggttagc     51720
     ggagctctta aggccgggat tttagtcaat gcgtttccca gttgaagtgg aggaagctaa     51780
     atgaaaggaa tgtcagtgat aaaaccgctt tccgatagat gagaacaggt aatttaacaa     51840
     ttgtggaaga gattaaataa tcgcacctgt agtaagacct tatatgattg aggctgtgtt     51900
     gtctgtgtgc atttcaaaaa cccaacccac agtttcggat atttccatat ctgaggcata     51960
     cacatagaga gagccaccgt tttatttcca acacacagtc aattataaga atggacaata     52020
     gagagaatat aacgtttcaa gaccaatact gacctgtttg ctaacgagac gagaaagaat     52080
     ctccaggatg aagtccgact attagaatat caagttaaag agattattca gagaatatta     52140
     aattgggatt gaaaaaagag atgtgataag tttgttacca gagctggaaa agcaccaata     52200
     gcttgtaaaa ctgtacgcat gaataacatt ggcagtggaa tttgctggac ctgcagccaa     52260
     aaactcgcca atgagaaaaa atgtccagaa gaagaaaaga aatcaaaaca tgaatagaag     52320
     aaatactcag tacgatggag attgttatat accagttgat tcagaacacc ggctaaaacc     52380
     tgttgagtga atgtctgcct ctgcgcaaaa caggtattgc atgcatctgt gacctgataa     52440
     aagcattaaa acataagatt tagggaagca acctcagtgt tgattgtaaa acaggtggcg     52500
     gagatctcct aataattcat caaagctgta ttctttgttt gctgtatgtt aacaaggaaa     52560
     ttgtcgatat atacctgttt aagtggtatt ccatctcttg ctgggtcaat gctatggata     52620
     gcaattaaag cttcagatgg agaaagcact gggccagatt gagatgatcc ctaagaacaa     52680
     aattccacag tgagcagatc aaacttaact caaaagccag acataagaaa tgaatacgat     52740
     acctgcagca cacgagaaag tgcaacttgg aatttctcca taggaagatt caccatatgg     52800
     ggaaaaatgc ggagaacctg atcgagagac aagtttagga aaataagaaa actataaccc     52860
     aatgagtcaa taaaagggga aaaggtaggg aaagagattt acatcatctc ttggcaggaa     52920
     tggcaaaatt gggaaaagaa tctctacatc ctgtagtccc ataaaatgtt caaaacccaa     52980
     gaaaacatta gagaagaatt agcttatagt tttgctctta acgagttttc aataaacatt     53040
     ccatcgtctt cacctttatt cttgtatcaa acaacttccg tatagtaagt atcaattctg     53100
     aagaaggagt gggcccctcg gtgagggttt gaagaacctg tcatcaaaga ggaacaataa     53160
     agaaatagta aaagcacata ccactattta cagtatagaa gaaactgtga aggatgataa     53220
     aaacctgtat aagaaggttg tcactcccac ttggtgggtc tgctataatt ttaagaagct     53280
     cagaggatga gcccatagta cgaactagaa tagggatttg aagatgaata gcctacacaa     53340
     aataaaccgt gtgataaata gcagagaaga aaatatatta taaaacttct taactctggg     53400
     ctccagtacc tgcttaacgg gatctgatgc attcttgtat atgctgaata catgaacaaa     53460
     aagggagtgc ttctgcaaat aatagacaca tagaaactaa gagtattagc aaaattttgc     53520
     cacaaactta aagactagat tagtcattag tcgaagaatg gtaaaaattc gcaagacctt     53580
     ggtacagaga gcaaaataga gtgacaagca gcgttgagct tcagtaactg aagttgatga     53640
     tgatgttgct tcggagggcg tctccatact cataccacta atactgtgtt gcggtttgtt     53700
     tggtggactt ttcagatcaa gatccatcta aaagagaaat gaaaattctg gtcacatatt     53760
     ttttaagcag tgttcattag taatcataaa tcaaatataa atgcatacac aactacaaaa     53820
     ataaatttct ttgcaataag cgctcacctt atcacaatca tcacttacga cagaaaatag     53880
     cctatccttt gcaaattcct caatctgttc tgtaatgaat gataaagaat agagtttgtt     53940
     tgccacctgt aaaatgaccc acaattattg aagtgataac acatcagtag aaggatacat     54000
     taaatcgcag gttttacaga aacataccag gcggattgct ttcatgcgaa tctcttccaa     54060
     gtgatgaaca gcactctttc acaagaaaaa aaaaggaaat ttagtgagtg ccccataaac     54120
     aaaaaaaatg aatattacag ccttgacaat atgaaactgt caaatgctga taagagaaaa     54180
     tgaaaaaaaa ggccagaaaa ggaaggagaa agaaccacaa gcacaatgct gggaaaaaaa     54240
     aaaaatcctg aaatgttaat atgatgaaac taaagctgca ccaaagaaaa gggaatcagg     54300
     aaaggggtga gatagaagga acctgcaaag cgatattcag gcagtcattc cggattccag     54360
     gtctcattaa aatcaggctc caaacagcac tgagaccttg agtaacacgg tctccatgtt     54420
     gtaaatcctt ttcaacttca ccacttccag gacagcaaaa cgattccaac aacatcagaa     54480
     ctgatttcgg cagatgtgga gaatctccaa gcaatttact taaagatttg tcagacggtg     54540
     gaaaagaatc tcttagtgct tcagcctgaa agataataat gttttctgag attccctcgt     54600
     gaaaaattga ctcagatgca aacaaaattg aatgcttacc acagttagca agaaactttc     54660
     atatgcagac gcagcagtag ttgaagagaa gaaatcttgt tctgcttctg cctccccgta     54720
     tagcctgtaa agaacccgca cagtcaactc atgtccctga aaacataaga aaggataaat     54780
     ctttaaatga ccttttaatc aattagggat gtcatccaac attagagtaa gatattctag     54840
     agtcgagcca gttcgaaacc catcaaaatt agaaaatata ctaagatagg agaagattag     54900
     aacctaaatc actatctcta gcaaaaggat ttcattacca aaattgggcc ttttgatgct     54960
     atcaaaaaag taagcgtgta tcacaaatac ataggaatca ccaatctaat tgttcaacct     55020
     tcaagtcaag aatacaaatt ctcacctcat gattcaaata atccgagaga acgtgctcct     55080
     gtaatatttt ccaagggtct aactctgaag gaaactgcaa aaaagaagaa ggcaaaagta     55140
     taggtatata tattaggaaa gtatggcact ctgaaggcaa atgtgagaca gaatgccatc     55200
     gtacttcaaa caaacatctt gccatctagc atgcatttga tataaaacag gaaagtataa     55260
     acagccacaa acataataca atggtaacaa gggcacctga taccacaaac caggctctta     55320
     gagtagaggc aagtgaggta agaatcatgc agaggccgat atgttcatat ttatcgaatt     55380
     tcacaaaaac ttatgaagag taataaatca caagctgaaa tgtcagaaaa tataatttaa     55440
     aaattcacct caactcctaa atgagcaaga agagaaaagc ggagttgtga gccaccagac     55500
     attgatattt gcttatatgc ttcaacaatg cgcaaaaaaa ccagcttttg taaactgtct     55560
     ttctcttcat cagaaaggtc gacaacaggt gctgatatct taggtaagac aaactgactc     55620
     gccgaagcaa ctgtgccaac cgcctttgga ctaaattcct ccaacttatc cacagacatt     55680
     gagggaatta catcgacaag aagttttcca ctgaaactcg cattttgatt tttgcttgca     55740
     gcctccacat tcgtagaact caatacatta gtaacaaggg ctcctgaccc atcatgttga     55800
     gcagaagatt ccagtccagg tattccactt tctctattcc ctatgtaatg cacattttgt     55860
     ggagacacag tattgctttc ttcattttct ggaaaagaag tatcacaggt agctaataag     55920
     ccaggtggag ttcttgcatc ttcagctgga aacatttgct ggtccacatg aacagaatag     55980
     acttcctcat cttcctgtta ttggtgagat tttagtgtac aatacaactt taaagacgag     56040
     aaggtaaaac aaggagcata aaatataaca cagatagaaa tactaaatcg agcaaagagc     56100
     acccatacat tgtgaggatt tatcagggca gcaattggtg ggaatgcggt tgacaatgaa     56160
     aggacacccg ctacaaatga tggtggatat ttaatttgtg catcactgcc aactatacac     56220
     atgttcatca ccaactcatc ggtgccatca gcataagaag aacaatttgg tggaatatta     56280
     tgcatattag ccatcacaac atcagtaagt aaatccgccg aaatacttga aataagaatc     56340
     tccaaagatc caattgcttt ttcaccctga gaaaccaagg ttccaaacaa accaactagc     56400
     tgctgagcag gtccactatc actcactcct ctgctatcac ttggtccggt cgaggtagaa     56460
     gcaacccgag gtagagagac cccatcatta ccatttaatc cgtcagtgga ttcttctgac     56520
     acagaaggtg ttattcttgc acgttttcca tcggaagcat ctccatttag atcaatattg     56580
     tattctgatc cagatctttt cctacttaag ttactttctg ctacatcaga acttgcacag     56640
     agaggattct cttccactga tacctgtaat taatagttgg cttttaaatc tgtattcaat     56700
     atacataaac caagaaaacc ggagagacac atgcacacac atcgataaac aaacgaggaa     56760
     caaattacct tggtatcttc tacactgtct ttgtcctgaa tgcttccgtt agtcttgtaa     56820
     aagagatctt tcgctttggc tgcctgacct ccaccttcta tctctttaag agcactggtc     56880
     aaccggtcct tccactggag aaaattgaca gcatacagaa aattgcaagt taactacgaa     56940
     aatcaactcc atggagaata caccatcaga aaatttataa gaattagtta taccactatt     57000
     agttaattac cagctcagca taatgaaaaa aaatctataa tataaaataa cagtgaacct     57060
     aatcattgta ggtaactaaa acaaaataat accggtgcag cagcgggatg tgtacatttc     57120
     aagcaggaga gaaatacagt cttcaaggca agatttgttg ctgcagcata cactcctttg     57180
     agaaagctta ggggatccaa gctcagtaga acaggtagaa ttcgtccaca gtatgcagga     57240
     cgtttctttg caactgatga aagactgtat aagaaacaga atcaaaatga aaaggatatc     57300
     atgaaacata agacaagctt acatgacatt ctggatcccc atctacacaa ttcacgatga     57360
     aagagtaccg gcagattacc aaacacagtt ttcccttaaa tattagtaac tgtgtgtgag     57420
     gaccaaaaca tatttttata cttgccccgt tctaatcaca ggaacctcgt ccttactaga     57480
     ttggatgctc ttcagtcaaa agtcaaatct aagtatttca tctatgttca gattataaag     57540
     attttctaga ccacaacgaa agtaatagaa aaaaaacata tagagctaga tttttaggat     57600
     tcatagataa tttgccggta ttctttccaa gctccaaagt ccaaactgat tgaacgatac     57660
     caaattaaac tacgcatata gatgcactta aaaacaactc acctattgat aagaacaata     57720
     atcgtcgagc tatttagaga ttttgctgca gggtgcctaa gctgatcaag cagtaaaccc     57780
     aatttctggc tggcctcaat tgacaaatct ccaattttca aaacaggatg acccccacgg     57840
     agaatagata tattaaaatc tgcttcaatt ccttcaggac aggtaactag attgtataag     57900
     aacctagtat ctaataagat actaataaaa caacaacttc tagtttcacg gaattgagcg     57960
     gatagatcca taaagattta ccttcatgag gagtatacaa gagaataagc gcttccacaa     58020
     atttcatagc gcataatttt acaccactat ttccttgcta atatacaggt cacaagaaaa     58080
     aatacaatca gataagaaag acgacccatg gggggattag agaaagcatt aattcccacc     58140
     ttgaaagcca ctgagcatat ttcatccttg aacttaatca accatgtcca tgaagattca     58200
     agaagatcat tcaactcact agaatgcaaa ccctggaagc caaatagcaa taagcgcgtc     58260
     aaataagaag ggatttacat acgaaatgca ggaagaacag gtcacaaata cagaacctaa     58320
     aaacaaaaac aagaaaacaa cctgaactgc cactctttcg agggtggaac ggaataaatc     58380
     agctccacaa gcaatgacct gcctggccac agctggtgtc tcatcttcaa gagacttaat     58440
     taaaaggggc actatttcag gtattaattc cacatatttc aggccaattt caccaagtat     58500
     cctgcatttg aaatatcatc agaggttcag cgagttatgt agattcccta gtcgcaaata     58560
     attctttcag caagctgata agagtaagac agacactgaa ccatcactta tgatcactgc     58620
     ctgaagtgag atgagatgtt gtccatgatt aagagcaagt aaatatacaa aggcaagaaa     58680
     ctatgcatca ttagtgtggc catgtatata attatagaga gagacggtga ttacaaaaat     58740
     aaaggattca caaagaccaa gaatcaacaa tttcatcatt taatgtataa aaactccgga     58800
     aattcattta tatctgtgta gttacaaaca aatccgaaat atttcagaaa ctccagcatg     58860
     aaatcaccac aagaagaata aaactaatcg gggaaagagt tacagattat acaataacgg     58920
     agcttactcg gcgacaaact tgcggacagc accgaattga tcggagagaa gatcgaaaag     58980
     gtgaggaagc aactccgtgg gaaaaacgga atcgtctttt tgcaaatccc ggcgcatata     59040
     gcgcaagcgt tgcagcttgg gaggcaattc cgtcgctgat ttggcggaat tcgcgagatc     59100
     tttaagcctt gctcttgaat acgaagccat gattccaacc ataacaaata ggtttcaaac     59160
     aatcgataat aatatataca ctagtgccca gagctttgat ggatatgcat ctatcttctt     59220
     cttcttcttc gactatggca tatagggttt agagacaagg acgacgatgg agattcgttt     59280
     tatttctgat atgaacacta atgaactgat ttccattttt gaggtctttc ctaaaggaga     59340
     ctgatcaata gttacactac gtcgtttgga taaagaaaga aattgtgtta tggtccctca     59400
     tatttgatag tatattatat aagtctcata tagttagtga attgattaaa taggccaatg     59460
     tgcagtaata atgggccgat gtgggcctat ttcgattgat atttaaattg tatccgtgtt     59520
     tctggtctta ccggagtctt tttggacaaa atgcgagtga tgtgcaatca aatcacattt     59580
     acaatttggt taagttttgt ttgattttgg ttgatctcgg ttaacaaaat taacctgtta     59640
     gtagtgagaa ccttttgaac tttgaagtaa tgctctttgg agaaattgga tccggcagag     59700
     ccaagagctt agaggctgaa gtcaagggat atatactcgt atccctaagt catggtgtcg     59760
     tgtaagacct tcaagaactc gattttgaac aaaagagctc tatggattcc gatgatcgta     59820
     tgctactacc gcgcatgaga tctgaaatcc catagctaga agagccccat ggattttcaa     59880
     agctagaaga gtgagtccca tggattttca aagctagagg actcttatgg attttaaaag     59940
     ctagaagagt cccatgaact cttctccttt actaatcaca cattaacata gcatttcata     60000
     aaaaccaatt tacaatgcaa acatagctgc aaagaacccc ccataaacca taatccacac     60060
     atcatgaaat cgatgattag tactcgttaa caacaaagaa aactcaactc atattatctt     60120
     cctttgttag gttgacagct atgcctgaaa tcacaaattt aaaataagaa ctagaggcta     60180
     tgtgaatcta atccaggaca gttcttcaaa accaaatcca atactcaaag tctcaaacat     60240
     ctacagagct cagtaccagt gtacgaattc ccaaattaaa caagttcatc ctttgtttat     60300
     caacctgata ctactaagta ctaataggcc tgtctgaaat gtaattgaac aacaagctca     60360
     atggtcaata ccaatggatc gaagaatata tcagattcaa aaccaactga tcgatcaaga     60420
     gagtagtaca ttattataac tgacaaactt gttcttgcaa agggattacg agttacaata     60480
     acaaaagact atcaaagatt ataaggaaaa cacaaaggat acaaactacc aacaatatca     60540
     tcatcttctt cttttcaaag agattactgc aaaatggtct gagaaaattc tgaaaccatt     60600
     tcgtctgaga tattttacct tttatttctt tgatcactcg gagcgattag cgaacctctc     60660
     aaccttctca tcgttgagat tgatcccaac catggcttct ccaagcccac agctcacctc     60720
     cacaagcatc tcagggtcac tgtaatgagt cacagcctga acaatggcac gtgcacgacg     60780
     agctgggtca ccgctcttga agataccaga accaacaaag acaccatcac atccaagctg     60840
     catcatgaga gctgcatcag ccggagtagc cactccaccg gcggcgaatt ggactacagg     60900
     aagacgacca agctgcttag tctgcatcac gagatcgtac ggagcggcta atttcttagc     60960
     gaaagtgaaa acctcatcat catccatgtt tcgcaaaacc ctaatgtcac cattaacaga     61020
     cctcacatgc ctcacagctt caataatgtt accggttcca gcttcacctt tggtcctaat     61080
     catcgccgca ccttcacgga tcctcctcag agcctcgccg agattccggc aaccgcaaac     61140
     gaacgggatc cggaaattat gcttgttgat gtgatgatct tcatcagcaa gagtcaaaac     61200
     ctcgctctca tcgatgtaat cgattccaat tgcttcaagg atctgagctt caacgaaatg     61260
     accaatccta gccttagcca tcaccggaat cgtaacggct tgtttgattt ctttaatcat     61320
     ttgtggatcg ctcatacgag cgacgcctcc ttgagcgcgg atatcagcag gaacacgctc     61380
     caaagccatg acggcgcaag caccagcctc ctcggcgata cgagcttgct cggcgttgac     61440
     gacatccatg ataacaccac cacggagcat ctgagccaaa ccgaccttca cggagaaggg     61500
     agatttcttc gcctccgtta tcgcaccgtt accgtacacc gccacaacgc cggttccttc     61560
     cattatcgga gattgaagag aaatttgtgt ggagaaaatg gaagagagat ttgggaatgg     61620
     tgaagcgatt tctggccggt cctcgtttat ctatggatcg gctttatagt gagagtttgt     61680
     ggcggtgtga ataaaagcta aaataataaa atagatgttt ttctctattt ttattaatta     61740
     aatagaaact ccttaattat tgaattttta atttttattt gggaaagtgt gggattttgt     61800
     tgtgatcgga cggtcaagat taaaacacaa tttcgatttt tcgattaaca catgtttagt     61860
     ggactgcatt ttaagatttt agccaactaa actagaggtt ttgacaagaa aaaatgagtc     61920
     gtccggaatt ggattataaa agtgttaaat gcattgttaa tgatgtttta aaacgttttc     61980
     acaatttatt ttttcttatt ttaaatagat tttagggaaa aaattttgga aaaaaatctt     62040
     ctgacacaaa gaaatgtaac tggacctcat agaatccacg actgtcgctc tagtccgcat     62100
     taattgttgc ataaaagaca aggagaaaaa atgttagcag aaaatgaatt gcacgctttt     62160
     ggaaaaaatg ttatggaaag catcattttc ttcataacaa acatctttat atttctttat     62220
     caaacaattt acaaccaatc gttttggaat gggattttta agatactaca tttgggagta     62280
     ggagaaattc atttttatac aatagtacgt taagttttat aatcctagaa aaaaaaattt     62340
     gaaataaagg aaaaaatctc ttaaaaagaa aatctaaaaa tagcagtttg tgatgataaa     62400
     agtaaataga gaaataggcg gctgtggttg aaaaggaagg cccgcctctc ctttgcaatc     62460
     agtagatttg tccactcagc cgaccctggc ggcccaactt gctcttttga ctacttcact     62520
     gtaactatac cattcagata tttaagtatt tggcaattca tcgaattagt gaatacgttt     62580
     tgttaagtgg ttgatcgatg attaaatcaa ataataaggg taaattctca aataaatgta     62640
     gtttatggat gacaatctta gtggatgttg caaaaatttt gctactaaca ccggtatgtt     62700
     aatctttata cacatcatat ataattataa acattaacaa atgctataaa tttagtgcaa     62760
     ttcgtgtcaa taattcaaac tcttttttaa ggcaataata acttgagatt tgtgtagaaa     62820
     caaccatatg atataactga tgaccatatt tattttctgt ataaaaaaat cgttacaata     62880
     ctaagaaaaa taataaacga ataatgtaat ttgatatata tagaccaaac aaaaaaaatg     62940
     gtattaggag caaccaacgc acacaattaa cccattctca ttacatatca aacactgaat     63000
     tcttgatcca tcaccagaga taatccggcg actacctctg catccatcac acatcaaaaa     63060
     cctaaaacca tcgcaccgcc ggcaacgttc atctccggtg attggaatgc cctcaaagag     63120
     aatcttaaac ttcccttgct cgtgcagtcc caacactctc tgagctccac cgatacacct     63180
     tccttttacg aacagaaccg gaggcaacac ctctgtttcc gccgctgaga ttcgtcggag     63240
     ctcttctcta tactctctat gcatcgacac atctctctcg tagtacttaa ccttaaaact     63300
     atccagcaga aatcggatca tgttgcaatc gtcgaacgtt tttctgattc ctcgaagagt     63360
     cgttgtgtag aaaacaacgg attcctctcc tcccggagga caccgttcct cgaattccaa     63420
     caacggatcc ataagggtat ttccgtcttt tccaatgtct tcttctccga tgacttcttc     63480
     cctgatcgca tttacaatct gaagggcatt tccatcatct ttgtgaagaa cgacgacatt     63540
     ttcgtctttc cgtctatact ctacgacgct aatcaccgga ggaatgctat tcccgtcttt     63600
     tctgatttcc tcttcctcgg gaaagacgat gtcgtcttca tcattgactc tggcttctct     63660
     ggaaaaatcc ttaatcttcc taaagcataa cgcagctaat tcaaatgctt ctaacagttt     63720
     cggatcgaaa agtgtggtcg aattcaaatc aggtcttcta aatccagatc cgaaactctt     63780
     tcttccgatt cctgtatcag atccgcatga aactgccagt ttactctctt tccgatcaca     63840
     cggaactctc ggaatctgat tcaccggagg ccgtacgttc tcctcgtcgc cgacaaaatt     63900
     tccagaagct tcttcttctc cttgtctcac gttttccaaa agttccgtta catttgcaat     63960
     ttgattttca gacttttgag gggttctcca gatagaagcg gcggatgtaa tctgaggaat     64020
     gtggttagat atctttggaa gaaactcatc tgcagcagaa agaacctgga gaattcgatc     64080
     ctgattcaga tattctccgg ctctaattga tttcaacttc tttgcaaact tcattctcga     64140
     tgacttcatc tccctccagt gtattacttc accggagatc tataccaatc agatcaaaat     64200
     cgagaaaact tcgctgggga taagaagata aattagggta aaagagaaga agacgatgag     64260
     ggtgatgatg atggttcaat ttcagcccca acggctagaa aaagacggta gcttcttttt     64320
     tttcggggga aaacaaatga gagagtgatg atctgctacg tttaagtgta ctaaggattc     64380
     ggatagtaac cactcagcaa gtgccacgtc ttcagacgat ttcactacac acacgctaaa     64440
     cgcaacggtc ccttaaactc gcaaagttgc aacttccaag tggacctcaa aaatcagtcc     64500
     tcataaaccg aaccacattt gaattacaca ttaaaccgga accgctaatc aatttttata     64560
     tgtatgcaaa aagcaagcga cgacgtattg ccaaaacaag atttggctaa ccgatttgtc     64620
     agagttaaac aaccaaaacg tttacaaact ccatcaaaga gcattaagtc actgagtttt     64680
     tctctcaagt acatagacac acagcttcaa attgtacgtt cttttccttc ctattttctt     64740
     tctcctatgg ttttagtttt ctacaggagt caccaacttc ttcttccaaa aactttaatc     64800
     gcctgttcag ctgcatctag ctcagtgaat cgtctctcta ctcgggatgg aagactagac     64860
     cggcacacgc ttgccccggt acttgtcaaa gaactacaca tcacataaat aaaagtgtca     64920
     agtaatcgca ttagccaaca attggcagac tatgcaacag agttaatatt aaagttaagg     64980
     caaactgaga aaagacctag caactcaaga tcatcagaaa caaagagaga attatcaact     65040
     gtaatttgaa aaggcaaaac tgggagtcat tatgagtttt gtatgtgttg tattcgaggt     65100
     ctaagaattt catgcgaagt ttgctatagt tgtttgcaat tggacacata ccgatctaat     65160
     atatggttgc tgaataatcc aaccgagaac gggtatcttc tgagcaaaga ctgccaaggt     65220
     aggccagaag ccactgcaaa agcaaaacgt ttttagtatc agtttacatt tcctcaagca     65280
     ataccagtaa ggaagaagaa aatagccaaa agtacctgaa gagtacgaaa aagccatagg     65340
     tctccaacat cattcccaag ataggccacc cgatgataac aaagaagaaa ccgacgccaa     65400
     aagagatggt tccctaagtg gataacatat aaagccaaat gaacacacat agatgacatt     65460
     aaggagaaat atgtaaaaat ccagcagaga ctggcccaga gctattgata atgtaggcaa     65520
     agacagaaac aaaccttata attttgacgc ttcatgaaga actgcatggt agacttgaag     65580
     ccaatggtta gactaacccc cgagatgaaa agaatctgag aaaatatgaa aagaaacaag     65640
     ctctcatact agttctgtac gtgtatgcaa taatagtggt caaagtatga aacaaagata     65700
     catgagatac ttacatttcc catggcaagt aatcccttat caaagacaaa gactattccc     65760
     aaaaacgaga agaatacgcc aaatcctgtc aggcctaacc cgatttctgt ttcaaatcac     65820
     ataagaaacg tttaagtata tccaagtaca gcaggagtaa ctttgtaacc tggtaataag     65880
     atatactgaa actaaacggg gttcccacaa caacatgaca ttcaatgatc tactcactcg     65940
     agaacgtaat aagtaaaaga agaattaagt acaactaagt aacaggtatc tcttccaata     66000
     gcacaaaata tttatagaaa tcacaatgtg aacttacttt tccggtcatt catttcaaag     66060
     gacatcatgg ttcctgtaat gagctgcttc taccttttgc tgccatggta aaaacatgtt     66120
     gaagtcagca attaggccat tgaaagttga aattgtgccc atggcttagc catgactctg     66180
     atatatacat acatagccca tagagattta atactctcgt atcagtttcg gtaacaaatc     66240
     aatatttggc aacattatat cgatttgacg tcgactagac agatgctaca tacagaatca     66300
     aacgtataat cctaactata cttgtacaat aaaaaagagt gcataaccaa acaaatggac     66360
     tgcgtacaga gcgagaaaag agattcaacg acactagaat cgatctgagc agacgaatcg     66420
     ttgaaattga acagaggcaa gtgaaaacga ggatcataac aaatctagaa ttaaaccgaa     66480
     accgtaatga tgcagagtaa cttacagatc taaaataagg gaaggaagaa ggcggagaaa     66540
     ccctagcacg caggctcctc gaagacgatg atagacccag attgggttta acaaagaaga     66600
     acagaaaaga gatgagaagt agaagaagaa attgaggaag aagatgattg ttttgttaat     66660
     tgatctttcg aagaaacgtt tacagagaga aatgaagaaa taggctttta aacgaataac     66720
     gaggcccatt aggcccattc attaacttaa tactacttaa attttcaatt gactgtctca     66780
     aattcgaaat atatcaattt ctactctttt tatggtagtc atatgatttt ttttttttaa     66840
     gttattcaaa ctgtcaaatg atttatattc tataaaacgt gatttatata ttttcattgc     66900
     ttttcaaaac aagcaacact tttaagttta tgatacagta gcaatcacta tcagagtaca     66960
     agccacattc caatgttctt agattaaagg tttgttctaa acataactaa taaacaaata     67020
     ctagattttg tcaaaaaaac taaaaaaact gtttaagaat atgattcatt tacttttatt     67080
     tgactttatt agttttagct tacttcttac ttggtaaaat ttgaaatgta ttaaagtgaa     67140
     atgtatatgt tttttttatc ttctatctta attagataaa ccaattaatt tggaaaatta     67200
     aattatcaag tgactagttt gttaattttc ttgaaaaata acattcataa aacagaaaaa     67260
     ggacatgaga caatttaatc agtttcagag aagaagaaga aaagaaaaat gtaaatgata     67320
     ttaatacacg cttatttgat gtatattcac taagttacca acaactagct ttgattattt     67380
     tcgtttgaaa atcttaacaa gagatgcaga ttaattatca tatactgaag agacaaacaa     67440
     acttatttgt tatttatttc ttaaaaattg ctagttgttt tttaacaaaa aaataattag     67500
     tagtttagtt tagacaaatc tagtacaaac ctcgaccaaa tttgtaccac atcttcatct     67560
     atgggttata tctatcaata cctgcaatta atctggtgga ggtttggcac atgccaactt     67620
     caacatatat ctgaatgata aaaatgagtt tgtgaaaaat catttaatgg tcaaatgttt     67680
     ctaaatcttc tagaagatga gctaagcgat atcatattcc acgtgagtgc atcttaacct     67740
     tgtgagagac tttttgaatc tttcagattg atattcaaca atgtgatagt atctttgtat     67800
     gtagggaaat tctgctggcc ttagtactct aatattattt tgtgataccc atgactttca     67860
     gcgtctgcca atatctccga tgagcttgag agaaagggaa atatttcctt gtgccaaacg     67920
     taaaacagat gtaaaggtga aaaataagtt cgaatctaac tctctagcaa aggtacgaac     67980
     ataaacttgt ctactattgg cctgttaaag atacaaatga attatatgct tatgaaattc     68040
     attgttatgt aggtatactt tcgaatcaag tgtgaaaaag cccaagaagc aaggcaaact     68100
     gcattgttaa atctctttgt ctccattata agtgatagcg tctataataa gctaaggtaa     68160
     atgttgaaag caaatagttt attttgtttt agtctaattt gtacttatgc tagcttgcaa     68220
     ctgctgggca ctgaaactca cagagtttca aatctatttt gctactagga tcgaagaaaa     68280
     gcttggttac ttagttgaat gtgaaactcg cttgatacat ggagttggtt tctatgtatg     68340
     cgttgtttct tcagattaca atccttgtca tttggtaagg cgaatctaca agttcatgaa     68400
     tggaattcgc ttggtaagtt tgtctataat ttcatgaatg ttgttggtaa gtttctttag     68460
     cttggttcat atttcactta tttggtccta tatttatagg aaggtttgtt tgacaaaatg     68520
     tttaaagatt tcaaaaatgg tgtaagttcg aagttgccac atgatagtgg gaagacaaaa     68580
     tggagtgaga ttgttcgaga aaggtaatga attcatcgct cgagaatgat ttgaatattt     68640
     ttcataaatt tagagttaac ttccctggat tatattagtc aaactttgat actatagttt     68700
     ctatatgcga aatcatgcaa catgacaatg tttgaagtcg ctaacttatc tatgtttgat     68760
     ttattttcag ttgcatattt gatttctact ccgaagaaaa gaaggagcta agcttgatca     68820
     cgaaaaatga tttaatagaa tggtacaaac ggtatgttag actatcttcg cctaagtgct     68880
     gtagttttgt tgtttcaatt tggggatgca acaccaaaaa tggtctagag aaagtgaaga     68940
     ttcttcggtt aagaaggaag atgaaagtaa agaagaagca gttttggtta actcagaaga     69000
     ttccgctata ccttggcaag tgtttatcta gaaagaggta gatcaatgca ttacttgtaa     69060
     tcagaggttc agcgagtcag gtgaattcca taggtcaaga gatgaacaca tcattactta     69120
     tgctagttgc aaaaaaaatg gaatcctttt acaagctaat gagagtaaga cagacactga     69180
     actatgccga ggcaagaaac tatgtgtcat taaaaaggcc atggattgcc gagacggtgg     69240
     ttacacaggt acggcattta taaataaaag ctctggaaat ccgaaatctt ggattacagt     69300
     agcagagcaa cgaatcgatc gagagaagat cgaaaaggtg aagatcgaag cagcgagacc     69360
     ttcatggcca accatataag gttctcgtta atctgaatca gacaatcaaa atgcagcaac     69420
     tccaagacca ttttttaatt cttcatccaa gttcatcttg ttgcacaagt aaggatacga     69480
     caaatcaact actttgcttg caaaacgaga cttgttttga tgggcccaat aataacatca     69540
     cctatctttg atttatttta catgacaaaa aatccgacga aatcctcatg gatacttgaa     69600
     tgcatgtaat ggcatcatta gtgtttcgtg tgtacaaatg cttcttgctc ttaagcgtat     69660
     atgtacatga tgataagtga gtctaagtgt tgcaactaca aaacaaagag gtatagatga     69720
     aactggcagc tgcacaagta agcaaagctg aacggagatt tggcaaggca gaggattttg     69780
     tcttctttgt gattacaaac tagctatctc atggaagcat aacaaattat gcatgctatt     69840
     ttattcatgt ttctaagttg aatagcacaa gtagatagat caagttggag aatgctcttt     69900
     gagaaatgtc ttagcaataa tagagtgaga caaagataag aaataaaagg attgttaagt     69960
     catacttaag ctaagcatag caggtttaag ttacatatct tgaagaacaa ggggagacaa     70020
     agatttctca agggaaaatc tcattacata aaaaaataaa ataaaaggtt tcaagtctta     70080
     ataaagcatt gcaagttttt tttaggtgat ggtggcttca cgagcatctt cttcttcttc     70140
     ttcattttaa aagctttgtg cttgtggagg aatcgcatct ttgaacttga ttgaaactgc     70200
     ttagctacgc tgagtcaggt gaaaaacact aacacatatg agcaacaacc tcgtcgctaa     70260
     ttcaaagccg atcgagaggt aaaatgaatt gaataccttg tcgaagagtc actaacatca     70320
     ggtgacaaca acttttcctg tgactcagta acatcaggcg acaacttttc ctgttatgta     70380
     taaacaacaa tttgtaagaa tcaatcaata agcctagacg gaaatttcaa ttgcaaaggt     70440
     acaatggaaa ataacctcaa aatcatagcg gcgggcgaaa cgcggatttg tagtataact     70500
     tcgcacttga agtctggaaa cgcagatatg aatttgagag caaaaagagg ctctgtatgc     70560
     gtgatgggca taaattctac ccattattgc tctccgtgcc gcctcctttt cctaggtgtt     70620
     catatataca agtgcctgat gggttttcca gctcctgatc tggcccatac tattgggcct     70680
     atactagata gaacgaggtt ttttagataa ttgttttcaa atgttcttac tctttagacc     70740
     tcctgcttga tctcgggtcg ggaagaagca agcaaaccct ttcaagttgt tgactttact     70800
     attgccaatt tcttgagaga tttgccaatt atccttttta aaatcttaca ccacgatgga     70860
     aatatgccat gtccttagaa gatttggtaa ggcagaacat ttgtacattt tattcgtgtt     70920
     atcaaggaga gaaatgtcta ggctctagct atgttagaac gggacaaaga tatgttgcaa     70980
     atcaataaca taaaaatgtt ttaagtcata gtaaagcata gcatgacata tcttgtagaa     71040
     caaggggaga aagagaaagc gtcggacaga tctctcttga gaaatctcat tacatataaa     71100
     aaaaaaaaag gtaaaaaagg ttttaactca taattataaa gcatcgcaag ttttttttct     71160
     tctaaaaagg agtaaagaac ctaaggttat agtgggtggc ttcacgagca tcttcttctt     71220
     cttcttttta aaagctttgt gcttgtggag taatcacatc tttgaacttg attgaaactg     71280
     cttagctacg ctgagtcagg tgaaaaacac taacacatat gagcaacaac ctcgtcgcta     71340
     attcaaagtc gatcgagaga taaaatgaat tgaataccac catgattgaa tgaatattgg     71400
     aaaatttcag aaaatgatta aaaacgtgaa aattcgcaag ttctatacat ggtcagacat     71460
     atttgttgtt acacaaacaa gaaattacgc tgcaaaccag acgctaaaca gttatcgaat     71520
     cggaaaaata aaatttcaac cgggttcaat gaaatatggt tacaagtaca acgaagcgga     71580
     aactccggaa tccatatcat ttcatataca gacagcagta acacagacgc cagaaccttc     71640
     ttgcttttct ccgtcccaca cttgtctttt acatttatac aacggatatg gtaatgcgag     71700
     gaaacagaaa cagcaagcaa cgttgcattg tgtgttattc attctctctg ttagacattg     71760
     aagatcttct tgaccttcct gatcttctta cggcataccg gacaaaaacc cgaagtttca     71820
     gctatcctgt gtattgtaca tccaattttt gaagtcatca ttaatgttca ttcttgtgtc     71880
     atgaaaagat cccattcaaa aatgacacaa ctaaaataat gaaaagatcg aacatgttat     71940
     tttcttaccg tgtcccgcac tggaagcaag caacgcagtg tccacaagag aggaagaaac     72000
     agtctctagg cgcatcatag caaattgcac atagatatct tgtactactg tggccttcac     72060
     catgtgcacc ttccaattcc tctgtactcg tcaaaataga actgtaggac gagcaccagc     72120
     ttgagttatc atcgtctttt cccggaatta gaggagctac atcatcattt tcatcaacgg     72180
     tttcatcttc agtgactggt tgtcgtttat tgaagagact cgagacaatt aacaagagtg     72240
     ctgtcactac acctgtgata ataagcccag gggaagagca aaagtttatg ataaagtctt     72300
     aaacggaaaa aattcggttt atatgcctca tgttatataa taaaaagaac attacccatg     72360
     caaactatgt atgcaatcca ccttggttca tatgagagtt ttgcgcagaa ctcattctta     72420
     gaattgttct gaacaacaag aaaagagttg gatccaaact ggttcgtaag ttttattctc     72480
     gaatatacat aacaatgtga actattttgt attgctctat gaatagcttg ttaagaagaa     72540
     taaaatggaa agacaagaaa tagggtacat accagctttg gacctggtga ggttagtaca     72600
     gcagcattag ttccaaataa tggaacactt agagtgcact tgtcgttagg gaaagagcaa     72660
     ttgtaataag catttgtagt atcatacaat accccctcaa cttgaatgtc aatcgtcgcc     72720
     tgaacataga tattgtgtga gaatggtgta taatcagaca aaaagagcgc tacttgggat     72780
     tagaaagggg caatatactg cagtaaaact tttcaaaaag ttaccctaag agtttaagtt     72840
     ttaacatata tcatcataag ctgcttcagc atttaccttc acttcattca ggtatacgtt     72900
     gcctactgca acataataac tcgacgactt agttatgtcc tgctcaatat aaccactatc     72960
     tgtcacaaat aaaataagta gggcgtgagt gaacacataa atattcagaa taaaaatcca     73020
     tcatgttaaa aaccttggac acttgccaga gattatatgc cacgacagtg tagtgtctgg     73080
     acgcgtcgga tcttgtaccc actcagagag cccatccaca ccttcaatta taaacgcata     73140
     aaaaagctga attacaaaac aactattctt tcttaacagc ctgtgaatac cagaatatga     73200
     tgaaatctca acatcaaatc aggggaggga tcagactggc ataatgaaca ttcttttgca     73260
     aaacatcttc tcattcatat ggttattaaa gacagaaaac aacaatgaag gtgaccgttc     73320
     cagcaatttg tctcagtgga tactaaaaca tcaccaaact aaagatttgg cgaataaact     73380
     cttgtgatga agatgataat ttaagtggcc actatgaagc atctatctaa attactaaac     73440
     taattataat taaaaaagga ttcttctcta gcataccttg ggctatcaca aggtataagg     73500
     aagaacccac agattcaacg ttgtatgaaa cttttacgcg tgaccccttg ttcaaatact     73560
     gtatccaata ctgcaaaatg tagcaaaaca aaaagtatca gtccccgttt caatagccat     73620
     ttctagataa cacaagtaaa gagctaacct tgtaagaatc attaggcaca gctagatagt     73680
     gaacttcgga ccatttagtc agaacatcaa gctgtggggc ttggttcaat ccatacagta     73740
     tcaaaccaga tcccttgttc cctaattctt ccaccttgag aaaatcggca aagatagaaa     73800
     ctttgatatc agaaggttca acaatggtgg attctaaatg catgagagga gagaacatac     73860
     aatgacattt tggacgaaca ctgaagttgg cttaataaga aacgaagagt ttggtcccaa     73920
     ccagacattc gttgttccat aaagccccag aatcaaagtc atcgacactg atttaaaatt     73980
     caacgacgac aagacatata tcaacaacaa gaacaacaaa aataaagcat agattgaaaa     74040
     atacgaactt accaaagata cagaaggtag caacgacgac aacgcaagac caagggtctt     74100
     cagaagtgga attgttcctg acgttctcag atgcaacaac gcttccatgg cgataatcgt     74160
     actcagaacg attccacggt ggacgatcac gatgatcaaa accggaatcg ttgccgtgat     74220
     gttcaaagcg atgaaagccg gtttcttcac gggtcacagg cggagaagaa gaagaagatg     74280
     ggagagaatc cggtagagac atgttgtcgc gaatcgatga gaggaatgaa gaaattgaag     74340
     agataaaggt aaaaccctaa ccttaggttt ggggttaatg ttgttgagga acgaaggatg     74400
     atttgaacga cgggtcggct tcttctcttt cttcatcgtc acgttgaacg gtggattcac     74460
     aaaacttgga gagagacgac gactttggaa aaagtaaaac atttattttc ttatcttaat     74520
     agaaatttaa agataaaaaa cattttcgaa gaatctcttt ttggtttgga gttaggacag     74580
     gctggtctgg tctcgtttta cgcaattact gtaacaccct cattcccatc tgtcatcagc     74640
     tacggtatat tcgtaaatat gacatttaag tgagggctta tccgtaaata accgaagcga     74700
     gtcacatacc tggacgcagt cttcgtttct cattccagtc tggttttcga catacggaaa     74760
     aaaaaaacca gatctacaaa aataaataat ccccaaattg aatttcaaat ttcgaagctt     74820
     caagaaaccc taatttttct caatctaagc tgaggtttgg gatctcgtac attgcacgcg     74880
     atgggagatt tcaatctcgc tctcgtgatt gttgcgatcg tagtttgcgt cattgttttc     74940
     atctccagta tctacctcct cgtcaactat cagcatccag atgatgcaaa ccaggcttat     75000
     ttccccaaat tcgttgttgt ttttggttta tccattgcta tgatctctat tctcatgtta     75060
     ccggcggatg tggctaaccg gcatgcttgt cgacattcga tttacaacgg cgcttgtaat     75120
     ctcaccttac ctatgaagga tctttggctt gccgtttaca ttgttgacgc tgtgcttgtc     75180
     ttcttcatca tccccttcgc tatgtttttc tatgaaggcg accaggacaa gtttgtttct     75240
     ccacgatttt tttttttttt tttttgagtt attattagtt ggtaatgtaa agttgttgat     75300
     gttgtgggct tgtgtttttt actgcagggc tcttgggaag aggataaaga gtgctttgat     75360
     ttgggtggtt actacagctg ttgtttgtgc tctggttctt ggaattttat acggttagtt     75420
     gttactgttt ggtttctttt gtagattttg agcttcattt tcttcctggt ttgaggaaaa     75480
     ttactgagat tatgttggag tggtgattga accaatagtg ggattgtgaa aagggtggtc     75540
     ttctgatgtt cttcttattt gcattagtga tttataatgt aattctacaa atgtattagg     75600
     agtcattggg aaggtggact tctctgtaag gcacttgtct tctgccacga ctactttccc     75660
     tacttcatgg cagttttcaa ataatcaacc ttgcattggt aacactgctc gtcaggtaat     75720
     actttaaatt ttcttgcatt cttgttatga gtttttcttt cgttagtctc tatgcaaaat     75780
     atatttcagt atgtaaaata tcttctcttc tccttggtat attgatcggc agtgctcagc     75840
     atatacagct aatgctgcgt ctgaaaagac atggtccatg cgtactacgt ttccagaata     75900
     tgttgttgct cttgctacaa tcgttgggtc agtgctcttc acggtatgta catctctcta     75960
     ttaggtgttt tgtgttaaaa gtttcacctc attgtcttgg aaggcatata atctttctca     76020
     tattaaggct tggttgtgtt ctcttgcagt taaaagactt ttggtagctg tgattttttg     76080
     ctttcctcta aagattctga gaaactcttt tatctcaaat gttgtagata tttggtggtg     76140
     ttggtattgc ttgcctaccc ttgggcctta tcactgcatt catcaggcga ccaaaggctg     76200
     ttatcactcg gtcacagtat ataaaggttc atttgtgctg gttattgttg tctacttgtc     76260
     ttcatgcaaa gcttttctaa agaatacatg tacacttcgg gtagttggca gtgttagtgg     76320
     cctgacaagt catctaattg tttttcagga agcaactgaa ctaggtaaaa aggcaagaga     76380
     tctaaagaaa gcagctgatg cacttcacca ggaagaacga agtggtgcta agggaaggaa     76440
     gtggaggaaa aatgtgaaag cagttgaaaa ggtacaccat catatctaag ggtttggggt     76500
     cttatttcaa atctgttcca tgtctacaaa ggtggctgat acctctgttg atattggttg     76560
     ctgatgtgta gtggcgcttt tggccgtagg ggcagttact taggtgatca ttcatagtaa     76620
     aaagctcgcc aaaaagtaga aaccagttct gctataggcc cactaatatt ggcagcttga     76680
     tgcatatctg attgtagatt tgaagtctta actactctta attggatttc attgctttca     76740
     tgtatcctgt aggagttgct ccaattggaa gaagatgtga acctcttaga agagatgtat     76800
     ccgcaaggag agcaggtaaa gatgactata cctcagtatt ttatctatct aaagaattct     76860
     gtaatccaat atttgccttg cctcgtccat tttccaggca gagactgctt gggccttcac     76920
     tgtcctggga tacttggcca agtttgttct tggaatctta gggtttgtat tttacttaat     76980
     cttcttagta ctttgatgtt ttcactctat tagtcctcgg ttaagctctt attaaataat     77040
     ttcttttttt gcttgttgaa gattaattgt ttctgtggct tggattgctc acatcatcat     77100
     atatctactt gttgaccctc ccctctctcc ttttctgaat gaagttttca tcaaactgga     77160
     tgacgtctgg ggtaacttca ttttctgatc ttgttatgct actctatacc ttgttccttt     77220
     tgtgtctgac ctggctctgt gttcatacat gtgacatttt cttgttcact aggtcttctt     77280
     ggcacagctg cctttgcttt cttctgtttc tatctcctac ttgctgttat tgctggggca     77340
     atgatgcttg gtttgaagct ggtcttcatt accattcatc caatgaagta attcatcttg     77400
     tagttttgaa atgttttttg ctatttcaga gatctttctg ttttcttctg gtttctcata     77460
     agcctaatta acttgtttca gatggggagc cactcttatg aactcttttc tctttaatgt     77520
     cggtctcatt ctcctctgtt ctatcaggta ggcttcttag ttctcatatt tcccgtcagc     77580
     tgatagcatc aaaagtatgt attaactttt attcttacaa tcgactattg tggctcactg     77640
     aaattccagt gtgattcaat tctgcgccac tgcatttgga tattatgctc aagccaccgc     77700
     cgctcaggag atatttggcc acactttgca gtcccttcgc ggtattaagt acctctacaa     77760
     gtaagtaata tcgggttttt gcaaataaag gtctcacttg tgtacataag actgatgata     77820
     atcttccctt tcttatcggt atctttcagg tacaatgtgt tccagatcgg gtttgttgtc     77880
     ctcgctggat tgaccttttt atattacatt gcctttgtaa gtcccttaaa tcctctcggt     77940
     tttctgttcc attatatagt tctgtgtcat tagtcagaga tctttaaact catgcttttg     78000
     gtgggtattt tttggcaggg atggagaaga aaaaagccga gcggcagatt ccagctctct     78060
     acctaatgta aatctcttct tttgatttta tcgtttatgt ttcctcgtct ctgggatcga     78120
     tcgcgtgcca ctgaggattg ctgtgtccac aattataccg agattggtct catgatctgt     78180
     gcaagtggtc ttatatcata agaacaagca cctgcccaaa aagcttctct ttcttctgct     78240
     tctctttgct gctgaggttt gttttcattt cacttgaatg taaaattatt cttctttttc     78300
     tcttatcttt tctcctgtat ctattgcttt atttttgttt gattaattac aagaaagatc     78360
     tctttgtcgc cgtcttctca tggcctattg aatgatttcg aatactttct tgtaaccatt     78420
     acttggttga gagtttagac tgtcagaaca aattcaggtt ttggagttat ttgtgtgtat     78480
     agtgtgatga caagagactt cataccattg ttgcatttct attatgtggg aaaccaaaat     78540
     ttctccttgt tatggaccaa tctcaaattc tcaatggtac tttgactaga gttttgattt     78600
     tagccgttcg gttttttttt tggttcggca aaatcgttcg tttggttcga gaagtctctt     78660
     caaacttgaa aacctacagt acttttgttt gtgcggttag attggcaatt gtttgattcg     78720
     gttcacgctt aatgcggccg gtttagataa aaatacaaaa caaaatatag tttaattaac     78780
     aatatgagag cgaaaagaaa ggaaaactta cgaattttgt tttaaaaaac agttaaatag     78840
     gaatcgattt ggcacgattt ggtatgtctt tggttttggt aatttggtat ggttagtaaa     78900
     atctccggac actctgggag ggtcagaggg tctcagagat gggaacacat tatataaacc     78960
     gttggaggaa cacagcctct cgcttagcta acaacaactc aacgagtgac atggacatcg     79020
     ccctcttctc accggcgtcg ctctttgctg cagacggtga ctcctctggt cagtgaaatc     79080
     tctcttcttt caatttctaa tttgatcgaa gggagagagc cataattagc gaagtaactg     79140
     taatttttat tctcagatgg agagacgacg gagacgagcc agaacttcgt tgagagaaat     79200
     catcagtttc ctggaattgt aatttcttcg ctcccgaatt tctcttctat cgtctgcttt     79260
     tagtaatatc aattccatat ttagtttacg ttctccgttg agagtgaaac ctaagcttct     79320
     gatttcagtg attttgagtt catatagtgg attaggtctt agattgctct gctttggtgt     79380
     ttaactaaat tatgttgcct tgaagaaacg aattcatgaa ttcgctgtga tgtcttttgt     79440
     gaaatagttt tcttactgag attgagttta aggttagtgt tagtatttca aacaagttta     79500
     tgattacttg ttgtttgaat aggaactgca aattcgggaa tttggtttcc accagctgaa     79560
     tgcaaacttg ctgtggccag gtacatttgc ctttgctgat tggttactgc agcatcgata     79620
     tttgatcgaa aggcggcgct gtctcgagat aggaaggtac ttccttgtct tttgtctatt     79680
     ctttatgctt attttgttca aggaatcctg aaagatgatt gatttgtgtc ttggttacaa     79740
     gttgcttata tgccagtgtc agtccactta tcagttttta tttattttgg ttgtcttaaa     79800
     atcaaatggg cagtggcaca ggggcactag ctatatttct taagaaagag tttaatctcg     79860
     acataactac ttcagattac aatgatcaag agattgaaga caatattgtt cataactgta     79920
     ttgcaaacaa gattatccct tctctgcctc atatcaagcg tgagtttcct tattactcac     79980
     aaatggcgtc gtatgaattt gattgttttt gcttttctta cattctctta tctattatga     80040
     cagatacatg gggtgatgaa tttccaattt cggaaccaga ttgggatttg atcatagcca     80100
     gtgatatcct tctatgtaaa tacccatttc ccattcgatt tatcggaaaa ctatacatat     80160
     acatttttac attcggtttt tcgcagatgt gaaacagtac ccaaacttga ttaagtctct     80220
     gacttttctt ctcaaaaaat acaaaccaac caatgtcgtt agtccagcag aaggtaagct     80280
     aaatggtcag tatccctttc atcaccactc acacacatca aaagaagtct taacattact     80340
     cttttacctg taggagcaga cacagaactg cctcgtcctg tgttcttaat gagctggaga     80400
     cgaagaattg ggaaagacga tgagtctcta ttctttacgg gctgcgaaga agctggcctg     80460
     gaggtgaagc atctcggaaa ccgagtttat tgtatcaagc ttagagaaag caacctctga     80520
     agaataggct gacaaactca tgaatcatcc acatgctcgc ctctgaaact aaaggttctg     80580
     tttgtttctc tcgctgctta tttggatttg ctttttctgt caaaattaat gtgaaatgag     80640
     atagtgtcga ttcttaacta atgtttccct taatcaattg aatttgatgg gtggacggaa     80700
     aaaaaaactg tatttcattt gtagtataat atgtggggaa attagtgaag aaaagaacat     80760
     agaatcaata ttggcatttt ctttcaaaaa tggggcaata agaaaagaac tattaattag     80820
     aactgagacg atcacacaca taaagaatcg cattcttgct ttgccgtgag aaagtttgaa     80880
     atgaaaataa attgtgatac tttgcctgtg tacatacata aagagtcttg ggcattgcat     80940
     atacttacta tagcttcagc caattgttgt gacagctaaa cattaaatct tttcacacaa     81000
     aaaaaaaaaa aaaagggaaa gacttgtaag ccttgaatct gtaacccatg catcatcttg     81060
     accacactcc ttccgatcgt ctcttatgcc cagtagaacg aattcaaaaa gataaagatg     81120
     gcaaagtgac aacaattagt gggggaatcc attacataat caaaagttcc tatttcattt     81180
     ctaacgctga agacgaaaag cctgttcatc tcctctcctt gattcttcgc aaccgaaaag     81240
     aagacaaggt actatctttt actttttgct atgtttgtca gatagcacta ttaggtgaag     81300
     cctattacgt ttacttctgc agctattgcc ccaattacta ccacaaagaa tgtgttgagt     81360
     ctccttccgt gtttcattcc tctgatcatc caaaacatcc tcttcaactt ctctggattc     81420
     ccgacatgtc tttagaagaa gaacgtgata aacgatgttg ttcttgtaaa cgtggcgtag     81480
     acgcactatt ttactattgc tctatttgcg attttgcagt ccatatggca tgtgcgggaa     81540
     atccaacatc cccaaccatt gacaatccaa aaaggcataa gcataccctt cattactttc     81600
     ccaggaaatc cggtctgttt tgcgatgttt gtgcgttggt ggacgattct gattacttat     81660
     atgtatgtct cctatgtgat ttcattgtcc ataaacgatg tgtctactta ccatatgtca     81720
     taaaggtgtc tcgtcacaat catcgtctca cttttactcc caatcttcct tacgaagaac     81780
     caacggtgac ggattgtgga gtttgtcatg caaagataaa cgaaaattac ggagaatact     81840
     cttgcactaa gaagggatgc gtttatgcag tgcattccag atgtgctatg caaagtgatg     81900
     tgtgtgacgg gaaaaaactt gaaggagagc ctgaagaagt atatgaagac actaaaatgt     81960
     ttgaggagaa aggcgatggg attatacagc atcagagtca tccacgtcac caattgagac     82020
     ttgaaaaaat attccacgat gaaagccatc attgtcaagc gtgcagacgt ccttcttatg     82080
     atcatggtgg taatgtgtat cgatgtatgc aatgtgatga tttcattttt catgaatcgt     82140
     gtgcatatct tcctcgtact aaacaattta tgctacatgt tcatccattg actctagatc     82200
     ccagttacaa tttcatagat tggttccaat gtgggaaatg ttatcgttac tcttgcggtt     82260
     tccggtgcat gtgttcgtgt gccgtgtgac ttttttccgg tgttggacac actttgtgct     82320
     tctatatgtg agccgtttga tcatcactct catccacatt ccttgttcat tactagtggt     82380
     gaacacgaaa gcaaaatctg ttccatctgt caatcatcgg agccacaacc tttaaattgt     82440
     ttgaaatgcg attttgtttt gtgcttttat tgtgccactc ttcctcataa agcaaggtac     82500
     aaacatgatg agcatttcct cactttttct tatgaagaag atgcaaatga tgagctttat     82560
     ggttgtgaaa tatgcgagga agatataaat ccaaagaatg ggttatatgc atgcaacgag     82620
     tgcggagtca cactccacat cgaatgttta ctagggagag atccgaatac gacgcctgga     82680
     tcattttcaa attcggtagg aacgttgtat attcttccca acacttattc aactcgacct     82740
     atatgcacaa catgcagaag acgttgtccg taccaaataa agataaattc atcgggcggt     82800
     ccctatatat tctgctcttt tgattgctat caaagattgt gtcgtagcga agactggtcc     82860
     taatgcttgg gaggcctaaa gcaaatcact aaatatgtgg tcttctcgta aaagaatttg     82920
     tatatgtatt tgtttttttt acttatatat tttgagctgt atcaaggatg gtgtcagaat     82980
     cattcatgtg attattttaa ggttttcttg atttagacat caaatatttc tagaaatttc     83040
     gagcgtgttt cgcaagttca agacataaac tcatgttttt agttgtttat agaacgatga     83100
     ttatatatat tcgtaaattt cttgggggat aagacacgta aagaccaaca caacttaatt     83160
     agatgagtca acaatcatcg tgcataactc caaatttcta ctttttcact tatttgaccg     83220
     tcatcgatat tttatttcat tagtaaaaac acaggaagat tactcaaaag tcttgaagtc     83280
     tttgatcgtt aaaaatgaac atgtgcaagg agacacacaa aaattccaaa tcaattatat     83340
     aattgcaact tgcaaagatc gaagcgattt cttcttatat acgagttatt atatgtataa     83400
     aaatgataag acatagtaaa tgacagacgc aaaaacattg accaaaagtt gtaaaaatga     83460
     tatagaaaga cgtcaacacc aacaaaaaaa tgatataga                            83499
//

If you have problems or comments...

PBIL Back to PBIL home page