(data stored in ACNUC13479 zone)

EMBL: AL161946

ID   AL161946; SV 1; linear; genomic DNA; STD; PLN; 86690 BP.
XX
AC   AL161946;
XX
DT   23-MAR-2000 (Rel. 63, Created)
DT   14-NOV-2006 (Rel. 89, Last updated, Version 3)
XX
DE   Arabidopsis thaliana DNA chromosome 5, BAC clone F7A7 (ESSA project)
XX
KW   .
XX
OS   Arabidopsis thaliana (thale cress)
OC   Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
OC   Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae; Pentapetalae;
OC   rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis.
XX
RN   [1]
RP   1-83690
RA   Bevan M., Pohl T., Weizenegger T., Bancroft I., Mewes H.W., Rudd S.,
RA   Lemcke K., Mayer K.F.X.;
RT   ;
RL   Unpublished.
XX
RN   [2]
RP   83034-86690
RA   Bevan M., Terryn N., Ardiles W., Buysshaert C., Dasseville R.,
RA   De Clerck R., De Keyser A., Neyt P., Rouze P., Van Den Daele H.,
RA   Villaroel R., Gielen J., Van Montagu M., Bancroft I., Mewes H.W., Rudd S.,
RA   Lemcke K., Mayer K.F.X.;
RT   ;
RL   Unpublished.
XX
RN   [3]
RP   1-86690
RA   EU Arabidopsis sequencing project;
RT   ;
RL   Submitted (23-MAR-2000) to the INSDC.
RL   MIPS, at the Max-Planck-Institut fuer Biochemie, Am Klopferspitz 18a,
RL   D-82152 Martinsried, FRG, E-mail:
RL   lemcke@mips.biochem.mpg.de,mayer@mips.biochem.mpg.de Project Coordinator:
RL   Mike Bevan, Molecular Genetics Department, Cambridge Laboratory, John Innes
RL   Centre, Colney Lane, NR4 7UJ Norwich, UK, E-mail: michael.bevan@bbsrc.ac.uk
XX
DR   MD5; c949d4f1011bfeca8b684973ecd3b35b.
DR   ENA-CON; BA000015.
XX
CC   Information on performance of analysis and a more detailed annotation
CC   of this entry and other sequences of chromosomes 3, 4 and 5 can be
CC   viewed at: http://www.mips.biochem.mpg.de/proj/thal/
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..86690
FT                   /organism="Arabidopsis thaliana"
FT                   /chromosome="5"
FT                   /variety="Columbia"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:3702"
FT   misc_feature    1..100
FT                   /note="overlap to BAC T10O8"
FT   misc_feature    1..3000
FT                   /note="region from position 1 to 3000 is annotated with
FT                   preceeding BAC T10O8"
FT   gene            3248..5790
FT                   /gene="F7A7_10"
FT   CDS_pept        join(3248..3535,3643..3710,3819..3847,4118..4308,
FT                   4447..4662,4758..4898,4987..5103,5202..5255,5482..5598,
FT                   5683..5790)
FT                   /gene="F7A7_10"
FT                   /product="Ca2+/H+ exchanger-like protein"
FT                   /note="strong similarity to Ca2+/H+ exchanger - Vigna
FT                   radiata, EMBL:AB012932"
FT                   /note="Contains Prokaryotic membrane lipoprotein lipid
FT                   attachment site AA419-429"
FT                   /db_xref="GOA:Q945S5"
FT                   /db_xref="InterPro:IPR004713"
FT                   /db_xref="InterPro:IPR004798"
FT                   /db_xref="InterPro:IPR004837"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q945S5"
FT                   /protein_id="CAB82265.1"
FT                   /translation="MSSISTESSSNLSLLENGGGGSDKPTAETSRRVRRTVSASSLIRK
FT                   RSDLKLISRVRWEFMRRILTNLQEVLLGTKLFILFPAVPLAVVAHRYDCPRAWVFALSL
FT                   LGLTPLAERISFLTEQIAFHTGPTGLMNATCGNATEMIIAILAVGQRKMRIVKLSLLGS
FT                   ILSNLLFVLGTSLFLGGISNLRKHQSFDPGDMNSMLLYLALLCQTLPMIMRFTMEAEEY
FT                   DGSDVVVLSRASSFVMLIAYLAFLIFHLFSSHLSPPPPPLPQREDVHDDDVSDKEEEGA
FT                   VIGMWSAIFWLIIMTLLVALLSDYLVSTIQDAADSWGLSVGFIGIILLPIVGNAAEHAG
FT                   AVIFAFRNKLDITLGIALGSATQIALFVVPVTVLVAWTMGIEMDLNFNLLETACFALSI
FT                   LVTSLVLQDGTSNYMKGLVLLLCYVVIAACFFVSNSPSSKLLF"
FT   exon            3248..3535
FT                   /number=1
FT   intron          3536..3642
FT                   /number=1
FT   exon            3643..3710
FT                   /number=2
FT   intron          3711..3818
FT                   /number=2
FT   exon            3819..3847
FT                   /number=3
FT   intron          3848..4117
FT                   /number=3
FT   exon            4118..4308
FT                   /number=4
FT   intron          4309..4446
FT                   /number=4
FT   exon            4447..4662
FT                   /number=5
FT   intron          4663..4757
FT                   /number=5
FT   exon            4758..4898
FT                   /number=6
FT   intron          4899..4986
FT                   /number=6
FT   exon            4987..5103
FT                   /number=7
FT   intron          5104..5201
FT                   /number=7
FT   exon            5202..5255
FT                   /number=8
FT   intron          5256..5481
FT                   /number=8
FT   exon            5482..5598
FT                   /number=9
FT   intron          5599..5682
FT                   /number=9
FT   exon            5683..5790
FT                   /number=10
FT   gene            6676..8988
FT                   /gene="F7A7_20"
FT   CDS_pept        join(6676..7107,7463..7519,7617..7679,7772..7828,
FT                   7939..8022,8100..8168,8245..8357,8442..8611,8695..8773,
FT                   8865..8988)
FT                   /gene="F7A7_20"
FT                   /product="putative protein"
FT                   /note="similarity to peroxisomal Ca-dependent solute
FT                   carrier - Oryctolagus cuniculus, EMBL:AF004161"
FT                   /note="Contains Mitochondrial energy transfer proteins
FT                   signature AA135-144;Mitochondrial energy transfer proteins
FT                   signature AA235-244"
FT                   /db_xref="GOA:Q9M024"
FT                   /db_xref="InterPro:IPR002067"
FT                   /db_xref="InterPro:IPR018108"
FT                   /db_xref="InterPro:IPR023395"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9M024"
FT                   /protein_id="CAB82266.1"
FT                   /translation="MGEEKSLLQFRSFPSLKTSDFALTEEPSWRLENNVSSNRRRGNKR
FT                   SGGVFTNFASLSVAIRRDRRESTFNGRNGGGGGAFASVSVVIPKEEDEFAPTSAQLLKN
FT                   PIALLSIVPKDAALFFAGAFAGAAAKSVTAPLDRIKLLMQTHGVRAGQQSAKKAIGFIE
FT                   AITLIGKEEGIKGYWKGNLPQVIRIVPYSAVQLFAYETYKKLFRGKDGQLSVLGRLGAG
FT                   ACAGMTSTLITYPLDVLRLRLAVEPGYRTMSQVALNMLREEGVASFYNGLGPSLLSIAP
FT                   YIAINFCVFDLVKKSLPEKYQQKTQSSLLTAVVAAAIATGTCYPLDTIRRQMQLKGTPY
FT                   KSVLDAFSGIIAREGVVGLYRGFVPNALKSMPNSSIKLTTFDIVKKLIAASEKEIQRIA
FT                   DDNRKKASPNTIDEQT"
FT   exon            6676..7107
FT                   /number=1
FT   intron          7108..7462
FT                   /number=1
FT   exon            7463..7519
FT                   /number=2
FT   intron          7520..7616
FT                   /number=2
FT   exon            7617..7679
FT                   /number=3
FT   intron          7680..7771
FT                   /number=3
FT   exon            7772..7828
FT                   /number=4
FT   intron          7829..7938
FT                   /number=4
FT   exon            7939..8022
FT                   /number=5
FT   intron          8023..8099
FT                   /number=5
FT   exon            8100..8168
FT                   /number=6
FT   intron          8169..8244
FT                   /number=6
FT   exon            8245..8357
FT                   /number=7
FT   intron          8358..8441
FT                   /number=7
FT   exon            8442..8611
FT                   /number=8
FT   intron          8612..8694
FT                   /number=8
FT   exon            8695..8773
FT                   /number=9
FT   intron          8774..8864
FT                   /number=9
FT   exon            8865..8988
FT                   /number=10
FT   gene            9415..12810
FT                   /gene="F7A7_30"
FT   CDS_pept        join(9415..9515,9636..9674,9747..9870,9965..9991,
FT                   10268..10338,10432..10478,10559..10637,10741..10813,
FT                   10928..11017,11117..11176,11300..11413,11498..11558,
FT                   11628..11746,11842..11934,12565..12810)
FT                   /gene="F7A7_30"
FT                   /product="putative protein"
FT                   /note="similarity to hypothetical protein At2g31190 -
FT                   Arabidopsis thaliana, EMBL:AC006593"
FT                   /db_xref="InterPro:IPR006968"
FT                   /db_xref="UniProtKB/Swiss-Prot:B6IDH3"
FT                   /protein_id="CAB82267.1"
FT                   /translation="MTSCQPKRRRVEHLRCSAQPSSIREDDEDADDRRDTEMALQKGGQ
FT                   LRYFLDDDDSPLQGILEERETKPDNNSQSSNSSETNILWLPDVDSQNVKLAEAVGVGSF
FT                   SGTSAAATAAASAAAIRWVSKDGIGALGRLLIGGRFGSLFDDDPKQWRMYADFIGSAGS
FT                   FFDLATQLYPSQFLLLASTGNLAKAVARGLRDPSFRVIQNHFAISGNLGEVAAKEEVWE
FT                   VAAQLIGLGFGILIIDTPGLVKSFPFVLLTWTSIRLVHLWLRYQSLAVLQFNTVNLKRA
FT                   RIIVESHVVHSVVPGYVDCNKRENILLWQRFMKPRIIFGVSLEELSGLEKSVSKVKALL
FT                   KMYTKEKYILTLNKLNKDTEFSVSFKVNATSRDVLRCLWQAYWLEENMEESFKDKDSVF
FT                   HWLKQSLSEMDNKFDDFLFKLDTAGWNLRESNLKVPNQVLIDQESIPF"
FT   exon            9415..9515
FT                   /number=1
FT   intron          9516..9635
FT                   /number=1
FT   exon            9636..9674
FT                   /number=2
FT   intron          9675..9746
FT                   /number=2
FT   exon            9747..9870
FT                   /number=3
FT   intron          9871..9964
FT                   /number=3
FT   exon            9965..9991
FT                   /number=4
FT   intron          9992..10267
FT                   /number=4
FT   exon            10268..10338
FT                   /number=5
FT   intron          10339..10431
FT                   /number=5
FT   exon            10432..10478
FT                   /number=6
FT   intron          10479..10558
FT                   /number=6
FT   exon            10559..10637
FT                   /number=7
FT   intron          10638..10740
FT                   /number=7
FT   exon            10741..10813
FT                   /number=8
FT   intron          10814..10927
FT                   /number=8
FT   exon            10928..11017
FT                   /number=9
FT   intron          11018..11116
FT                   /number=9
FT   exon            11117..11176
FT                   /number=10
FT   intron          11177..11299
FT                   /number=10
FT   exon            11300..11413
FT                   /number=11
FT   intron          11414..11497
FT                   /number=11
FT   exon            11498..11558
FT                   /number=12
FT   intron          11559..11627
FT                   /number=12
FT   exon            11628..11746
FT                   /number=13
FT   intron          11747..11841
FT                   /number=13
FT   exon            11842..11934
FT                   /number=14
FT   intron          11935..12564
FT                   /number=14
FT   exon            12565..12810
FT                   /number=15
FT   gene            14456..16058
FT                   /gene="F7A7_40"
FT   CDS_pept        join(14456..14520,15112..15262,15362..15428,15526..15760,
FT                   15848..16058)
FT                   /gene="F7A7_40"
FT                   /product="putative protein"
FT                   /note="similarity to putative proteins - Arabidopsis
FT                   thaliana"
FT                   /note="Contains Zinc finger, C3HC4 type (RING finger),
FT                   signature AA161-170"
FT                   /db_xref="GOA:Q9M022"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR017907"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9M022"
FT                   /protein_id="CAB82268.1"
FT                   /translation="MRKSFKDSLKALEADIQFANTLASEYPEEYDGGYVQMRLSYSPAA
FT                   HLFLFLLQWTDCHFAGALGLLRILIYKAYVDGKTTMSLHERKTSIREFYDVLFPSLLQL
FT                   HGGITDVEERKQKEICDKRYRKKDRTDKGKMSEIDLEREEECGICLEIRNKVVLPTCNH
FT                   SMCINCYRNWRARSQSCPFCRGSLKRVNSGDLWIYTCSAEIADLPAIYKENLKRLLIYI
FT                   DKLPLVTSDPNLVPYAPLPR"
FT   exon            14456..14520
FT                   /number=1
FT   intron          14521..15111
FT                   /number=1
FT   exon            15112..15262
FT                   /number=2
FT   intron          15263..15361
FT                   /number=2
FT   exon            15362..15428
FT                   /number=3
FT   intron          15429..15525
FT                   /number=3
FT   exon            15526..15760
FT                   /number=4
FT   intron          15761..15847
FT                   /number=4
FT   exon            15848..16058
FT                   /number=5
FT   gene            16743..17902
FT                   /gene="F7A7_50"
FT   CDS_pept        join(16743..17252,17540..17902)
FT                   /gene="F7A7_50"
FT                   /product="chlorophyll a/b-binding protein CP29"
FT                   /db_xref="GOA:Q07473"
FT                   /db_xref="InterPro:IPR001344"
FT                   /db_xref="InterPro:IPR022796"
FT                   /db_xref="InterPro:IPR023329"
FT                   /db_xref="PDB:5MDX"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q07473"
FT                   /protein_id="CAB82269.1"
FT                   /translation="MAATSAAAAAASSIMGTRVAPGIHPGSGRFTAVFGFGKKKAAPKK
FT                   SAKKTVTTDRPLWYPGAISPDWLDGSLVGDYGFDPFGLGKPAEYLQFDIDSLDQNLAKN
FT                   LAGDVIGTRTEAADAKSTPFQPYSEVFGIQRFRECELIHGRWAMLATLGALSVEWLTGV
FT                   TWQDAGKVELVDGSSYLGQPLPFSISTLIWIEVLVIGYIEFQRNAELDSEKRLYPGGKF
FT                   FDPLGLAADPEKTAQLQLAEIKHARLAMVAFLGFAVQAAATGKGPLNNWATHLSDPLHT
FT                   TIIDTFSSS"
FT   exon            16743..17252
FT                   /number=1
FT   intron          17253..17539
FT                   /number=1
FT   exon            17540..17902
FT                   /number=2
FT   gene            18944..20992
FT                   /gene="F7A7_60"
FT   CDS_pept        complement(18944..20992)
FT                   /gene="F7A7_60"
FT                   /product="receptor like protein kinase"
FT                   /note="strong similarity to receptor like protein kinase -
FT                   Arabidopsis thaliana, EMBL:ATLECGENE"
FT                   /note="Contains Protein kinases signatures and profile
FT                   AA373-395;Protein kinases signatures and profile AA490-502"
FT                   /db_xref="GOA:Q9M021"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR001220"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9M021"
FT                   /protein_id="CAB82270.1"
FT                   /translation="MGTQRSMFIVSFLFKLFLFLSVHVRAQRTTTNFAFRGFNGNQSKI
FT                   RIEGAAMIKPDGLLRLTDRKSNVTGTAFYHKPVRLLNRNSTNVTIRSFSTSFVFVIIPS
FT                   SSSNKGFGFTFTLSPTPYRLNAGSAQYLGVFNKENNGDPRNHVFAVEFDTVQGSRDDNT
FT                   DRIGNDIGLNYNSRTSDLQEPVVYYNNDDHNKKEDFQLESGNPIQALLEYDGATQMLNV
FT                   TVYPARLGFKPTKPLISQHVPKLLEIVQEEMYVGFTASTGKGQSSAHYVMGWSFSSGGE
FT                   RPIADVLILSELPPPPPNKAKKEGLNSQVIVMIVALSAVMLVMLVLLFFFVMYKKRLGQ
FT                   EETLEDWEIDHPRRLRYRDLYVATDGFKKTGIIGTGGFGTVFKGKLPNSDPIAVKKIIP
FT                   SSRQGVREFVAEIESLGKLRHKNLVNLQGWCKHKNDLLLIYDYIPNGSLDSLLYTVPRR
FT                   SGAVLSWNARFQIAKGIASGLLYLHEEWEKIVIHRDVKPSNVLIDSKMNPRLGDFGLAR
FT                   LYERGTLSETTALVGTIGYMAPELSRNGNPSSASDVFAFGVLLLEIVCGRKPTDSGTFF
FT                   LVDWVMELHANGEILSAIDPRLGSGYDGGEARLALAVGLLCCHQKPASRPSMRIVLRYL
FT                   NGEENVPEIDDEWGYSKSSRSEFGSKLVGYVSSTSITRVSSTSRISQ"
FT   exon            complement(18944..20992)
FT                   /number=1
FT   gene            22176..24242
FT                   /gene="F7A7_70"
FT   CDS_pept        complement(22176..24242)
FT                   /gene="F7A7_70"
FT                   /product="receptor like protein kinase"
FT                   /note="strong similarity to receptor like protein kinase -
FT                   Arabidopsis thaliana, EMBL:ATLECGENE"
FT                   /note="Contains Protein kinases signatures and profile
FT                   AA367-391;Protein kinases signatures and profile AA486-498"
FT                   /db_xref="GOA:Q9M020"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR001220"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9M020"
FT                   /protein_id="CAB82271.1"
FT                   /translation="MLVLFLLLTIPTRAQRTTTETPKTEFIFRGFSGNQSNIVTTGAAT
FT                   IKLDGLLRLTDRNSNVTGTSFYHKPVRLLETNTSSTNSTIRSFSTSFVFVIIPTSSSNG
FT                   GFGFTFTLSPTPDRTGAESAQYLGLLNKANDGNSTNHVFAVEFDTVQGFKDGADRTGNH
FT                   IGLNFNSLTSDVQEPVVYYDNEDPNRKEDFPLQSGDPIRAILDYDGPTQTLNLTVYPAN
FT                   LKSRPVRPLISRPVPKLSQIVQEEMYVGFTAATGRDQSSAHYVMGWSFSSGGDLLTEDT
FT                   LDLLELPRPPPNTAKKRGYNSQVLALIVALSGVTVILLALLFFFVMYKKRLQQGEVLED
FT                   WEINHPHRLRYKDLYAATDGFKENRIVGTGGFGTVFRGNLSSPSSDQIAVKKITPNSMQ
FT                   GVREFIAEIESLGRLRHKNLVNLQGWCKQKNDLLLIYDYIPNGSLDSLLYSRPRQSGVV
FT                   LSWNARFKIAKGIASGLLYLHEEWEKVVIHRDIKPSNVLIEDDMNPRLGDFGLARLYER
FT                   GSQSNTTVVVGTIGYMAPELARNGKSSSASDVFAFGVLLLEIVSGRRPTDSGTFFLADW
FT                   VMELHARGEILHAVDPRLGFGYDGVEARLALVVGLLCCHQRPTSRPSMRTVLRYLNGDD
FT                   DVPEIDNDWGYSDSSRSDLGSNFEGYVSSDRASSSVPSFSVTRVSSSSVISGR"
FT   exon            complement(22176..24242)
FT                   /number=1
FT   gene            25829..27886
FT                   /gene="F7A7_80"
FT   CDS_pept        complement(25829..27886)
FT                   /gene="F7A7_80"
FT                   /product="receptor like protein kinase"
FT                   /note="strong similarity to receptor like protein kinase -
FT                   Arabidopsis thaliana, EMBL:ATLECGENE"
FT                   /note="Contains Protein kinases signatures and profile
FT                   AA363-386;Protein kinases signatures and profile AA481-493"
FT                   /db_xref="GOA:Q66GN2"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR001220"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q66GN2"
FT                   /protein_id="CAB82272.1"
FT                   /translation="MVSLLLVLFLVRAHVATTETTTEFIFHGFKGNQSEIHMQGDSTIT
FT                   SNGLLRLTDRNSDVVGTAFYHKPVRLLDSNSTNTTVRSFSTSFIFIIPSSSTSNGGFGF
FT                   TFTLSPTPNRTDADPEQYMGLLNERNDGNSSNHVFAVEFDTVQGFKDGTNRIGNHIGLN
FT                   FNSLSSDVQEPVAYFNNNDSQKEEFQLVSGEPIQVFLDYHGPTKTLNLTVYPTRLGYKP
FT                   RIPLISREVPKLSDIVVDEMFVGFTAATGRHGQSSAHYVMGWSFASGGEHPLAAMLDIS
FT                   QLPPPPPNKAKKRGYNGKVIALIVALSTVISIMLVLLFLFMMYKKRMQQEEILEDWEID
FT                   HPHRFRYRDLYKATEGFKENRVVGTGGFGIVYRGNIRSSSDQIAVKKITPNSMQGVREF
FT                   VAEIESLGRLRHKNLVNLQGWCKHRNDLLLIYDYIPNGSLDSLLYSKPRRSGAVLSWNA
FT                   RFQIAKGIASGLLYLHEEWEQIVIHRDVKPSNVLIDSDMNPRLGDFGLARLYERGSQSC
FT                   TTVVVGTIGYMAPELARNGNSSSASDVFAFGVLLLEIVSGRKPTDSGTFFIADWVMELQ
FT                   ASGEILSAIDPRLGSGYDEGEARLALAVGLLCCHHKPESRPLMRMVLRYLNRDEDVPEI
FT                   HDNWGYSDSSRTDLGSKLVGYISSDRASSSHSHTSSSLTRISSTSLISGR"
FT   exon            complement(25829..27886)
FT                   /number=1
FT   gene            29026..29817
FT                   /gene="F7A7_90"
FT   CDS_pept        join(29026..29197,29266..29411,29524..29588,29727..29817)
FT                   /gene="F7A7_90"
FT                   /product="putative protein"
FT                   /note="similarity to hypothetical protein T16O11.19 -
FT                   Arabidopsis thaliana, EMBL:AC010871"
FT                   /db_xref="UniProtKB/TrEMBL:Q9M018"
FT                   /protein_id="CAB82273.1"
FT                   /translation="MRDQSRNFEMVISWGDELIHVLDDRKGFDVLVQTLEQLRAIPFSC
FT                   DEDFKEIHESLQDLQKKLDVCKEKTDEANSEIADEEEIERLQKELDEELELECKLKEEL
FT                   RYEALFEEHRLAIKRNKRDQLRTETKLPMYASVTRVIPNIDDSLKTSGCILLL"
FT   exon            29026..29197
FT                   /number=1
FT   intron          29198..29265
FT                   /number=1
FT   exon            29266..29411
FT                   /number=2
FT   intron          29412..29523
FT                   /number=2
FT   exon            29524..29588
FT                   /number=3
FT   intron          29589..29726
FT                   /number=3
FT   exon            29727..29817
FT                   /number=4
FT   gene            30419..31511
FT                   /gene="F7A7_100"
FT   CDS_pept        complement(join(30419..30580,30662..30754,30862..30999,
FT                   31119..31184,31269..31511))
FT                   /gene="F7A7_100"
FT                   /product="putative protein"
FT                   /note="similarity to gamma-interferon inducible lysosomal
FT                   thiol reductase - Homo sapiens, EMBL:AF097362"
FT                   /db_xref="InterPro:IPR004911"
FT                   /db_xref="UniProtKB/TrEMBL:Q9M017"
FT                   /protein_id="CAB82274.1"
FT                   /translation="MASYQRLCITSCTIFFCLLSLSSSQKVTLSLYYEALCPFCAEFIV
FT                   NRLPKIFETGLISSIDLQLVPWGNAAIRPDGTILCQHGEAECALNAIHACAINAYPDVM
FT                   KHFGYIYCTEQLVLENKLEKWADCLEMVGLSRAAVDCYINGYGNQLEQRYAEETSELYP
FT                   AHRFVPWVVVNNLPLQENYQNFVMYVCNAYGSNQVPEACRILNSSVETLSRSNSSVEKL
FT                   SNSPQVCYSNH"
FT   exon            complement(30419..30580)
FT                   /number=1
FT   intron          complement(30581..30661)
FT                   /number=1
FT   exon            complement(30662..30754)
FT                   /number=2
FT   intron          complement(30755..30861)
FT                   /number=2
FT   exon            complement(30862..30999)
FT                   /number=3
FT   intron          complement(31000..31118)
FT                   /number=3
FT   exon            complement(31119..31184)
FT                   /number=4
FT   intron          complement(31185..31268)
FT                   /number=4
FT   exon            complement(31269..31511)
FT                   /number=5
FT   gene            31908..34277
FT                   /gene="F7A7_110"
FT   CDS_pept        join(31908..32601,32691..32732,32803..32869,32945..32991,
FT                   33098..33262,33382..33642,33758..33915,34032..34277)
FT                   /gene="F7A7_110"
FT                   /product="hypothetical protein"
FT                   /note="protein contains 13aa long region consisting of acid
FT                   amino acid residues (E, D) at C-terminus"
FT                   /db_xref="GOA:Q7Y1W1"
FT                   /db_xref="InterPro:IPR025640"
FT                   /db_xref="InterPro:IPR037471"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7Y1W1"
FT                   /protein_id="CAB82275.1"
FT                   /translation="MSSMNFNPFQNWFEKPPNPVPSINFVSLADSFFPKSQSPNFASIG
FT                   LPKFSKKSPKPETAGTDEPGPYKQIAEQFLWECENIPDYRHTPEVDKLLNEDPVFEKKE
FT                   NPSTEEIEAEQKWWESFRASPVVQFMTRAEEIADDMNKMELEDNDTPYRKEDKDYWRAI
FT                   PHVPGFDGRPMPRKAIKSKEESDDKFWDFMKQFLFGLWGFRQRPYPPGRPIDVAQAIGY
FT                   KRLEKRYYDWSIFKCFWIVKTLPGGYHDSVRGSGFQALVVLNVVKLSKLVPVVELQEYD
FT                   ESDRLGRSRGPCEIITLKTAYGAGIIDRDTFIWGEDMDEWAPIHMVYGLEPAIATWEVR
FT                   LGAAATAFLHKLQKGIPPWVPLKGREPKTYKQLQKEAIESKKRDMAVLEANGGVWPGVR
FT                   TPSHALFLWASGSELTTVLESDHMPTKLAKVIPGLRPWEVISIEQAMDQISYGGEWYRE
FT                   PLGTYTTGPPYIREWNRSVMRLFRIFYNLSVRVGQKLERTVPGFDTIMDKVQKDYDKRI
FT                   ARRMKRREEELREEDLKHYSGRTDEDEEEEEEEDDDSNSKKD"
FT   exon            31908..32601
FT                   /number=1
FT   intron          32602..32690
FT                   /number=1
FT   exon            32691..32732
FT                   /number=2
FT   intron          32733..32802
FT                   /number=2
FT   exon            32803..32869
FT                   /number=3
FT   intron          32870..32944
FT                   /number=3
FT   exon            32945..32991
FT                   /number=4
FT   intron          32992..33097
FT                   /number=4
FT   exon            33098..33262
FT                   /number=5
FT   intron          33263..33381
FT                   /number=5
FT   exon            33382..33642
FT                   /number=6
FT   intron          33643..33757
FT                   /number=6
FT   exon            33758..33915
FT                   /number=7
FT   intron          33916..34031
FT                   /number=7
FT   exon            34032..34277
FT                   /number=8
FT   gene            35806..37251
FT                   /gene="F7A7_120"
FT   CDS_pept        complement(join(35806..35840,35929..35992,36086..36151,
FT                   36247..36308,36410..36497,36598..36658,36771..36854,
FT                   36944..37251))
FT                   /gene="F7A7_120"
FT                   /product="ferritin 1 precursor"
FT                   /db_xref="GOA:Q39101"
FT                   /db_xref="InterPro:IPR001519"
FT                   /db_xref="InterPro:IPR008331"
FT                   /db_xref="InterPro:IPR009040"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="InterPro:IPR014034"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q39101"
FT                   /protein_id="CAB82276.1"
FT                   /translation="MASNALSSFTAANPALSPKPLLPHGSASPSVSLGFSRKVGGGRAV
FT                   VVAAATVDTNNMPMTGVVFQPFEEVKKADLAIPITSHASLARQRFADASEAVINEQINV
FT                   EYNVSYVYHSMYAYFDRDNVAMKGLAKFFKESSEEERGHAEKFMEYQNQRGGRVKLHPI
FT                   VSPISEFEHAEKGDALYAMELALSLEKLTNEKLLNVHKVASENNDPQLADFVESEFLGE
FT                   QIEAIKKISDYITQLRMIGKGHGVWHFDQMLLN"
FT   exon            complement(35806..35840)
FT                   /number=1
FT   intron          complement(35841..35928)
FT                   /number=1
FT   exon            complement(35929..35992)
FT                   /number=2
FT   intron          complement(35993..36085)
FT                   /number=2
FT   exon            complement(36086..36151)
FT                   /number=3
FT   intron          complement(36152..36246)
FT                   /number=3
FT   exon            complement(36247..36308)
FT                   /number=4
FT   intron          complement(36309..36409)
FT                   /number=4
FT   exon            complement(36410..36497)
FT                   /number=5
FT   intron          complement(36498..36597)
FT                   /number=5
FT   exon            complement(36598..36658)
FT                   /number=6
FT   intron          complement(36659..36770)
FT                   /number=6
FT   exon            complement(36771..36854)
FT                   /number=7
FT   intron          complement(36855..36943)
FT                   /number=7
FT   exon            complement(36944..37251)
FT                   /number=8
FT   gene            38732..39651
FT                   /gene="F7A7_130"
FT   CDS_pept        join(38732..38818,39142..39196,39281..39651)
FT                   /gene="F7A7_130"
FT                   /product="putative protein"
FT                   /note="similarity to several hypothetical proteins -
FT                   Arabidopsis thaliana"
FT                   /db_xref="GOA:Q9M015"
FT                   /db_xref="InterPro:IPR007493"
FT                   /db_xref="InterPro:IPR036758"
FT                   /db_xref="PDB:1YDU"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9M015"
FT                   /protein_id="CAB82277.1"
FT                   /translation="MDQIFNKVGSYWLGQKANKQFDSVGNDLNSVSTSIEGGTKWLVNK
FT                   IKGKMQKPLPELLKEYDLPIGIFPGDATNYEFDEETKKLTVLIPSICEVGYKDSSVLKF
FT                   TTTVTGHLEKGKLTDVEGIKTKVMIWVKVTSISTDASKVYFTAGMKKSRSRDAYEVQRN
FT                   GLRVDKF"
FT   exon            38732..38818
FT                   /number=1
FT   intron          38819..39141
FT                   /number=1
FT   exon            39142..39196
FT                   /number=2
FT   intron          39197..39280
FT                   /number=2
FT   exon            39281..39651
FT                   /number=3
FT   gene            40539..42478
FT                   /gene="F7A7_140"
FT   CDS_pept        join(40539..40749,40864..41149,41348..41519,41621..41817,
FT                   41908..42051,42148..42478)
FT                   /gene="F7A7_140"
FT                   /product="putative protein"
FT                   /note="similarity to several hypothetical proteins -
FT                   Arabidopsis thaliana"
FT                   /db_xref="GOA:Q8RXQ1"
FT                   /db_xref="InterPro:IPR025846"
FT                   /db_xref="InterPro:IPR026057"
FT                   /db_xref="InterPro:IPR029962"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8RXQ1"
FT                   /protein_id="CAB82278.1"
FT                   /translation="MSQRWSRKKSRLPLAGLLFILVVTFMILFNERSIQQIHHHAASHT
FT                   QNLREPSTFDFVKPNVPRINYLGAHEVLDRFSKCNSTKEYSGKKIGWVDPFEDHPGQVT
FT                   KEEQKCDVFSGKWVFDNSSSYPLHKESQCPYMSDQLACQKHGRKDLEYQHWRWQPHACN
FT                   LKRWNAIEMWEKLRGKRLMFVGDSLNRGQWISMVCLLQSVIPRDKQSMSPNAHLTIFRA
FT                   EDYNATVEFLWAPLLVESNSDDPVNHRLSERIIRPDSVLKHASKWQHADILIFNTYLWW
FT                   RQDSVKLREEKGSCEEVKSAEGMEMAMDSWGDWVANNVDPNKKRVFFVTMSPTHQWSRE
FT                   WNPGSEGNCYGEKKPIEEESYWGSGSDIPTMRMVKRVLERLGPKVSVINITQLSEYRKD
FT                   GHPSVYRKFWEPLNEDRLKNPASYSDCTHWCVPGVPDVWNQLLFHFL"
FT   exon            40539..40749
FT                   /number=1
FT   intron          40750..40863
FT                   /number=1
FT   exon            40864..41149
FT                   /number=2
FT   intron          41150..41347
FT                   /number=2
FT   exon            41348..41519
FT                   /number=3
FT   intron          41520..41620
FT                   /number=3
FT   exon            41621..41817
FT                   /number=4
FT   intron          41818..41907
FT                   /number=4
FT   exon            41908..42051
FT                   /number=5
FT   intron          42052..42147
FT                   /number=5
FT   exon            42148..42478
FT                   /number=6
FT   gene            42774..48568
FT                   /gene="F7A7_150"
FT   CDS_pept        complement(join(42774..42839,42932..43105,43209..43413,
FT                   43503..43565,43639..43781,44068..44250,44319..44517,
FT                   44971..45082,45182..45263,45350..45430,45500..45581,
FT                   45656..45841,45914..46015,46111..46144,46226..46352,
FT                   46440..46564,46657..47643,47888..48049,48185..48328,
FT                   48415..48568))
FT                   /gene="F7A7_150"
FT                   /product="putative protein"
FT                   /note="similarity to breast cancer tumor suppressor BRCA2 -
FT                   Homo sapiens, PIR:G02334"
FT                   /note="Contains Prokaryotic membrane lipoprotein lipid
FT                   attachment site AA479-489"
FT                   /db_xref="GOA:Q7Y1C4"
FT                   /db_xref="InterPro:IPR002093"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR015187"
FT                   /db_xref="InterPro:IPR015252"
FT                   /db_xref="InterPro:IPR015525"
FT                   /db_xref="InterPro:IPR036315"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7Y1C4"
FT                   /protein_id="CAB82279.1"
FT                   /translation="MSTWHLFSDSSGDGFRWEVAGRILQSVSDSTPTKALESTAPLPSM
FT                   ADLLLQGCSKLIEREESMPGEIPMFRTGLGKSVVLKESSIAKAKSILAENVAYSDLQNT
FT                   NCSIPQTRQVDTAETMPMFRTALGKTVPLKESSIAKPLSILGSDMIIDSDNVLPRESGF
FT                   GVPNSLFQTASNKKVNVSSAGLARAKALLGLEEDDLNGFNHVNQSSSSLQQHGWSGLKT
FT                   HEEFDATVVKHHSGTPGQYENYVSGKRSEILNPSLKVPPTKFQTAGGKSLSVSAEALKR
FT                   ARNLLGDPELGSFFDDVAGGDQFFTPQKDERLSDIAINNGSVNTGYIAHEEKTSNKHTS
FT                   NSFVSPLHSSSKQFRSVNLENLASGGNLIKKFDTAVDETNCALNISKPATHGLSNNRPL
FT                   ASDMAVNNSKGNGFIPRARQLGRPADQPLVDITNRRDTAYANNKQDSTQKKRLGKTVSV
FT                   SPFKRPRISSFKTPLKKNAQQASSGLSVVSCDTLTSKKVLSTRYPEKSPRVYIKEFFGM
FT                   HPTATTRMDYVPDHVRRIKSSNADKYVFCDESSSNKVGAETFLQMLAESEKVCDCSFEA
FT                   CMWIVWKLACYDIYYPAKCRGNFLTITNVLEELKYRYEREVNHGHCSAIKRILSGDAPA
FT                   SSMMVLCISAINPRTDNGSQEAHCSDNCSNVKVELTDGWYSMNAALDVVLTKQLNAGKL
FT                   FVGQKLRHAYVLISYLKILGAGLSGWATPTSPLEAVISSTICLLLNINGTYRAHWADRL
FT                   GFCKEIGVPLAFNCIKCNGGPVPKTLAGITRIYPILYKERRSALVEGIMCEYQRGINGV
FT                   HSQNDTDSEEGAKVFKLLETAAEPELLMAEMSLEQLTSFTTYKAKFEAAKQMQMEKSVA
FT                   KALEDAGLGERNVTPFMRIRLVGLTSLSNEGEHNPKEGIVTIWDPTERQRTELTEGKIY
FT                   IMKGLVPMNSDSETLYLHARGSSSRWQPLSPKDSENFQPFFNPRKPISLSNLGEIPLSS
FT                   EFDIAAYVVYVGDAYTDVLQKKQWVFVTDGSTQHSGEISNSLLAISFSTPFMDDSSVSH
FT                   ISHNLVGSVVGFCNLIKRAKDATNEMWVAETTENSVYFINAEAAYSSHLKTRSAHIQTW
FT                   AKLYSSKSVIHELRQRVLFIIGACKSPSC"
FT   exon            complement(42774..42839)
FT                   /number=1
FT   intron          complement(42840..42931)
FT                   /number=1
FT   exon            complement(42932..43105)
FT                   /number=2
FT   intron          complement(43106..43208)
FT                   /number=2
FT   exon            complement(43209..43413)
FT                   /number=3
FT   intron          complement(43414..43502)
FT                   /number=3
FT   exon            complement(43503..43565)
FT                   /number=4
FT   intron          complement(43566..43638)
FT                   /number=4
FT   exon            complement(43639..43781)
FT                   /number=5
FT   intron          complement(43782..44067)
FT                   /number=5
FT   exon            complement(44068..44250)
FT                   /number=6
FT   intron          complement(44251..44318)
FT                   /number=6
FT   exon            complement(44319..44517)
FT                   /number=7
FT   intron          complement(44518..44970)
FT                   /number=7
FT   exon            complement(44971..45082)
FT                   /number=8
FT   intron          complement(45083..45181)
FT                   /number=8
FT   exon            complement(45182..45263)
FT                   /number=9
FT   intron          complement(45264..45349)
FT                   /number=9
FT   exon            complement(45350..45430)
FT                   /number=10
FT   intron          complement(45431..45499)
FT                   /number=10
FT   exon            complement(45500..45581)
FT                   /number=11
FT   intron          complement(45582..45655)
FT                   /number=11
FT   exon            complement(45656..45841)
FT                   /number=12
FT   intron          complement(45842..45913)
FT                   /number=12
FT   exon            complement(45914..46015)
FT                   /number=13
FT   intron          complement(46016..46110)
FT                   /number=13
FT   exon            complement(46111..46144)
FT                   /number=14
FT   intron          complement(46145..46225)
FT                   /number=14
FT   exon            complement(46226..46352)
FT                   /number=15
FT   intron          complement(46353..46439)
FT                   /number=15
FT   exon            complement(46440..46564)
FT                   /number=16
FT   intron          complement(46565..46656)
FT                   /number=16
FT   exon            complement(46657..47643)
FT                   /number=17
FT   intron          complement(47644..47887)
FT                   /number=17
FT   exon            complement(47888..48049)
FT                   /number=18
FT   intron          complement(48050..48184)
FT                   /number=18
FT   exon            complement(48185..48328)
FT                   /number=19
FT   intron          complement(48329..48414)
FT                   /number=19
FT   exon            complement(48415..48568)
FT                   /number=20
FT   gene            49099..49770
FT                   /gene="F7A7_160"
FT   CDS_pept        complement(49099..49770)
FT                   /gene="F7A7_160"
FT                   /product="putative protein"
FT                   /note="similarity to prenylated Rab acceptor 1 - Homo
FT                   sapiens, EMBL:AJ133534"
FT                   /db_xref="GOA:Q9M012"
FT                   /db_xref="InterPro:IPR004895"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9M012"
FT                   /protein_id="CAB82280.1"
FT                   /translation="MVSTNPPVLPISTTATDTTNQPPIVTAVVESQPPVVRAFVNGVTE
FT                   TVCGGLSRSRPWSELLDRSAFTKPDSLSEAGTRFRKNSSYFRVNYVCIVALILGFSLLA
FT                   HPFSLILLLCLAASWLFLYLFRPSDRPLILFGRSFSEYETLGGLILSTIAVIFFTSVGS
FT                   VLISALMIGIATICVHGAFRAPDDLFLDEQDHAASGFLSFIGVPAIPSVAPSASSAASP
FT                   V"
FT   exon            complement(49099..49770)
FT                   /number=1
FT   gene            50391..51690
FT                   /gene="F7A7_170"
FT   CDS_pept        complement(join(50391..50426,50905..51105,51580..51690))
FT                   /gene="F7A7_170"
FT                   /product="light-inducible protein ATLS1"
FT                   /db_xref="InterPro:IPR001398"
FT                   /db_xref="InterPro:IPR014347"
FT                   /db_xref="UniProtKB/TrEMBL:Q9M011"
FT                   /protein_id="CAB82281.1"
FT                   /translation="MPCLNLSTNVNLDGVDTSSILSEASSTVAKIIGKPENYVMIVLKG
FT                   SVPMSFGGTEDPAAYGELVSIGGLNADVNKKLSAAVSAILETKLSVPKSRFFLKFYDTK
FT                   GSFFGWNGATL"
FT   exon            complement(50391..50426)
FT                   /number=1
FT   intron          complement(50427..50904)
FT                   /number=1
FT   exon            complement(50905..51105)
FT                   /number=2
FT   intron          complement(51106..51579)
FT                   /number=2
FT   exon            complement(51580..51690)
FT                   /number=3
FT   gene            52161..55802
FT                   /gene="F7A7_180"
FT   CDS_pept        complement(join(52161..52250,52338..52527,52626..52727,
FT                   52823..52899,53205..53404,53768..54107,54344..54421,
FT                   54860..55453,55608..55802))
FT                   /gene="F7A7_180"
FT                   /product="putative protein"
FT                   /note="similarity to KIAA0132 - Homo sapiens, EMBL:D50922"
FT                   /db_xref="InterPro:IPR006652"
FT                   /db_xref="InterPro:IPR013989"
FT                   /db_xref="InterPro:IPR015915"
FT                   /db_xref="UniProtKB/TrEMBL:Q9M010"
FT                   /protein_id="CAB82282.1"
FT                   /translation="MVLTGLPSNHYPYVQKIDIGLPLFLFNYSDRTLHGIFEAAGCGQL
FT                   NFDPYGWTSDGSERTSYPAQVPISVRLQCEPLSEEKFKPAIADNYYSSHHFWFELDHFQ
FT                   TRKLTCLLTSFAVKPKPPMNTPNTRQIFRLISSSEKKENSDEVKPSENEPVGSLEVSLS
FT                   SGGESDSSAAASHPGFSENHPDVQNPKQIDKDHVLEKLKDLVFSHDEHGDNSLTETVEQ
FT                   ANIPTCKNLEDRDTLEEETCSEGKIDGSCLVSSPLPHTISQLMHEVKELRACGLENSTK
FT                   ICYLEEKLDKAHKEIYQLTERCNMLESISGPLITKAGGSDLEIHSPDDTSLDPTEAILL
FT                   LGGFDKDSETWLSSVQSYFPSRNVVKAHSSMSCIRSNASVAKLDGKIYVFGGDDGGRGW
FT                   TNSAESFNQTDGQWSLCPPLNERKGSLGGATLDGKIFAIGGGNGMVSFSDVEMLDPDIG
FT                   RWIRTRSMGQERFAVASVEHKSSIYAVGGYDGKEYLNTAERFDPREHSWMNIASMKSRR
FT                   GCHSLVVLNEKLYAIGGFDGETMVSSVEIYEPRTGTWMTGEPMKDLRGYSAVAVVKDSI
FT                   YVIGGYKGEEDDILDTVECFKEGEGWKNVPSSSIGRRCFLSAVAL"
FT   exon            complement(52161..52250)
FT                   /number=1
FT   intron          complement(52251..52337)
FT                   /number=1
FT   exon            complement(52338..52527)
FT                   /number=2
FT   intron          complement(52528..52625)
FT                   /number=2
FT   exon            complement(52626..52727)
FT                   /number=3
FT   intron          complement(52728..52822)
FT                   /number=3
FT   exon            complement(52823..52899)
FT                   /number=4
FT   intron          complement(52900..53204)
FT                   /number=4
FT   exon            complement(53205..53404)
FT                   /number=5
FT   intron          complement(53405..53767)
FT                   /number=5
FT   exon            complement(53768..54107)
FT                   /number=6
FT   intron          complement(54108..54343)
FT                   /number=6
FT   exon            complement(54344..54421)
FT                   /number=7
FT   intron          complement(54422..54859)
FT                   /number=7
FT   exon            complement(54860..55453)
FT                   /number=8
FT   intron          complement(55454..55607)
FT                   /number=8
FT   exon            complement(55608..55802)
FT                   /number=9
FT   gene            59657..61513
FT                   /gene="F7A7_190"
FT   CDS_pept        join(59657..59800,59955..60005,60105..60178,60260..60347,
FT                   60419..60625,60700..60765,60843..61085,61424..61513)
FT                   /gene="F7A7_190"
FT                   /product="aldose reductase-like protein"
FT                   /note="strong similarity to aldose reductase - Hordeum
FT                   vulgare, EMBL:Z48360"
FT                   /note="Contains Aldo/keto reductase family signatures
FT                   AA151-168;Aldo/keto reductase family signatures AA257-272"
FT                   /db_xref="GOA:Q9M009"
FT                   /db_xref="InterPro:IPR018170"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:Q9M009"
FT                   /protein_id="CAB82283.1"
FT                   /translation="MAHATFTSEGQNMESFRLLSGHKIPAVGLGTWRSGSQAAHAVVTA
FT                   IVEGGYRHIDTAWEYGDQREVGQGIKRAMHAGLERRDLFVTSKLWCTELSPERVRPALQ
FT                   NTLKELQLEYLDLYLIHWPIRLREGASKPPKAGDVLDFDMEGVWREMENLSKDSLVRNI
FT                   GVCNFTVTKLNKLLGFAELIPAVCQMEMHPGWRNDRILEFCKKNEIHAYSPLGSQEGGR
FT                   DLIHDQTVDRIAKKLNKTPGQILVKWGLQRGTSVIPKSLNPERIKENIKVFDWVIPEQD
FT                   FQALNSITDQKRVIDGEDLFVNKTEGPFRSVADLWDHED"
FT   exon            59657..59800
FT                   /number=1
FT   intron          59801..59954
FT                   /number=1
FT   exon            59955..60005
FT                   /number=2
FT   intron          60006..60104
FT                   /number=2
FT   exon            60105..60178
FT                   /number=3
FT   intron          60179..60259
FT                   /number=3
FT   exon            60260..60347
FT                   /number=4
FT   intron          60348..60418
FT                   /number=4
FT   exon            60419..60625
FT                   /number=5
FT   intron          60626..60699
FT                   /number=5
FT   exon            60700..60765
FT                   /number=6
FT   intron          60766..60842
FT                   /number=6
FT   exon            60843..61085
FT                   /number=7
FT   intron          61086..61423
FT                   /number=7
FT   exon            61424..61513
FT                   /number=8
FT   gene            61653..64297
FT                   /gene="F7A7_200"
FT   CDS_pept        complement(join(61653..61883,61972..62859,62944..63954,
FT                   64085..64297))
FT                   /gene="F7A7_200"
FT                   /product="putative transporter protein"
FT                   /note="similarity to Na+/H+ antiporter proteins"
FT                   /note="Contains Prokaryotic membrane lipoprotein lipid
FT                   attachment site AA140-150"
FT                   /db_xref="GOA:Q9M008"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9M008"
FT                   /protein_id="CAB82284.1"
FT                   /translation="MNNSVTSNGTHEFVCEAWLGSSSGGLLRGDDPLKYSTPLLLLLIS
FT                   LVSSLSSVFQALLRPLANVDFVTQILAGIFLGPSALGQNIDLVKKLFNTRSYFIIESFE
FT                   AISFMFISYISTAQVDMGVIKRGGKLAIINGLSLFLFPYVVGAIACTVITSNIRGTVAK
FT                   NNPEQLHNLLTNQSVVYFQVAYSVLSNLKMLNSEPGRLALSSIMVANCFGWGFFLLLIT
FT                   FDSFLHQNYSKTTYLPTFTKVLLLVGIVVVCRPIFNWIVKRTPEGKKLKASHLCTICVM
FT                   LCTATFLSETVGFPYVVGSVALGLVTPKTPPFGTGLTDKIGSFCYAVLMPCYVIGIGNK
FT                   VDFFSFNLRDIISLEFLIFTISAAKFASIVLPSLYFQVPISHAVIVGFIVCIQGIYDVQ
FT                   IFKQLLNYKNISHEAFGIMVISAMVHSTIFTAIVKNLYGWVQRKHITYRRQTVQHYEPN
FT                   KPLKILTCFYHRETVPPILTVLELSTCPSSASSHSIVSVNLEELEQNNVPLLIQHHPGH
FT                   NDESSTSSSRRDQISKAFEKFRSGHDLQENVSVECFTAVAPSKTMHEDVCALAFEKETD
FT                   LIIFGMADGTAAERRLCRNVRNASPSSVAVLMDQGRLPDFKNMGTAMKNGSMRINICSI
FT                   FLGGADDRETLAFAVRMTNQPYVNLTVLKLVDGENVSHLNDVVEKRLDFRTIEKFRQDT
FT                   MNKHNVALREEASDLVNLLREEGNNYDLIMVGIRHEKSFEVLQGLSVWSEIEELGEIGD
FT                   LLVSRDLKLSASVLAVQQQLSSVVEEV"
FT   exon            complement(61653..61883)
FT                   /number=1
FT   intron          complement(61884..61971)
FT                   /number=1
FT   exon            complement(61972..62859)
FT                   /number=2
FT   intron          complement(62860..62943)
FT                   /number=2
FT   exon            complement(62944..63954)
FT                   /number=3
FT   intron          complement(63955..64084)
FT                   /number=3
FT   exon            complement(64085..64297)
FT                   /number=4
FT   gene            65067..68002
FT                   /gene="F7A7_210"
FT   CDS_pept        join(65067..65285,65426..65938,66157..66410,66532..66670,
FT                   66753..67610,67787..68002)
FT                   /gene="F7A7_210"
FT                   /product="putative transporter protein"
FT                   /note="similarity to Na+/H+ antiporter proteins"
FT                   /db_xref="GOA:Q9M007"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9M007"
FT                   /protein_id="CAB82285.1"
FT                   /translation="MENITKTFQYGGVDWLCEPWVGAGSLGIGRGENPLKFALPLLLLQ
FT                   ISVFSIFSVSFQFLLRPFGKFAFLTQMLAGICLGPSVIGRNKQYMATFFYARSVYIIES
FT                   FEAICFLFICYITTCQVDTRMIKRVGKLAFINGILLFLIPFVWGQFAAILISKRLKSGP
FT                   AGIPPVEFHHVAIVQSTMFFQVVYGVLSSLKMLNTEPGRLALASMMVHDCLSWCFFMLN
FT                   IAIKLNVDLPNKNRAAFLSVLQTEMNADDNDIGDSICVPTTNAVDEESNTRRTLSQGLL
FT                   SLCYMRLALHLLPLGRICGFTLLLWCGRLRSSHPKTSASRHGTVRQNRFAKMIAIALPS
FT                   LYYKVPLWHAILVGFIVNIQGLYDVQIYKQNFNYTKISSKSFGAMVMSATVNSTIFIVI
FT                   VKKLYQTMSKRNPYKRRTVQHCRVEAPLRILTCFRNREAVRPVLDLVELSRPAIGSPLS
FT                   VFAVNLEELNNHSLPLLIHHTQEISPFLVPSRRDQIVKAFHNFEKTNQETVLIECFTAV
FT                   APRKTMHEDVCAIAFDQETDIVILTLDAGIELWERLLCRNLLHNCPCSVALFIDRGRLP
FT                   DFRFVPLKKLTINIGAIFLGGPDDREMLAYATRLASHPSVELQVFRLVDQNGVSPLRDM
FT                   VERNHDMRVINVFRKENSEKNIIFREVRIEEAVNLLDLLRKEGDDFDLMMVGIRHEENL
FT                   LMLEGLSEWSDMKELGEVGDVLISKDLELSVSVLAVQQ"
FT   exon            65067..65285
FT                   /number=1
FT   intron          65286..65425
FT                   /number=1
FT   exon            65426..65938
FT                   /number=2
FT   intron          65939..66156
FT                   /number=2
FT   exon            66157..66410
FT                   /number=3
FT   intron          66411..66531
FT                   /number=3
FT   exon            66532..66670
FT                   /number=4
FT   intron          66671..66752
FT                   /number=4
FT   exon            66753..67610
FT                   /number=5
FT   intron          67611..67786
FT                   /number=5
FT   exon            67787..68002
FT                   /number=6
FT   gene            68497..70149
FT                   /gene="F7A7_220"
FT   CDS_pept        complement(join(68497..68514,68613..68804,68886..69109,
FT                   69240..69354,69442..69570,69667..69747,69946..70149))
FT                   /gene="F7A7_220"
FT                   /product="putative protein"
FT                   /note="similarity to protein phosphatase type 2C -
FT                   Saccharomyces cerevisiae, EMBL:U72346"
FT                   /db_xref="GOA:Q6NKS1"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR015655"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6NKS1"
FT                   /protein_id="CAB82286.1"
FT                   /translation="MGVCCSKGTGIIVEHGADDGNECGDGEAEVRDTNDGAVVRTRGSS
FT                   KHVSMSIKQGKKGINQDAMTVWENFGGEEDTIFCGVFDGHGPMGHKISRHEELFREFED
FT                   ILVTFFKQIDSELGLDSPYDSFCSGTTAVTVFKQADCLVIANLGHSRAVLGTRSKNSFK
FT                   AVQLTVDLKPCVQREAERIVSCKGRVFAMEEEPDVYRVWMPDDDCPGLAMSRAFGDFCL
FT                   KDYGLVCIPDVFCRKVSREDEFVVLATDGIWDVLSNEEVVKVVGSCKDRSVAAEMLVQR
FT                   AARTWRTKFPASKADDCAVVVLYLNHRPYPREGNGFIVG"
FT   exon            complement(68497..68514)
FT                   /number=1
FT   intron          complement(68515..68612)
FT                   /number=1
FT   exon            complement(68613..68804)
FT                   /number=2
FT   intron          complement(68805..68885)
FT                   /number=2
FT   exon            complement(68886..69109)
FT                   /number=3
FT   intron          complement(69110..69239)
FT                   /number=3
FT   exon            complement(69240..69354)
FT                   /number=4
FT   intron          complement(69355..69441)
FT                   /number=4
FT   exon            complement(69442..69570)
FT                   /number=5
FT   intron          complement(69571..69666)
FT                   /number=5
FT   exon            complement(69667..69747)
FT                   /number=6
FT   intron          complement(69748..69945)
FT                   /number=6
FT   exon            complement(69946..70149)
FT                   /number=7
FT   gene            71366..72907
FT                   /gene="F7A7_230"
FT   CDS_pept        complement(71366..72907)
FT                   /gene="F7A7_230"
FT                   /product="putative protein"
FT                   /note="similarity to putative protein F4P12.100 -
FT                   Arabidopsis thaliana, EMBL:AL132966"
FT                   /note="Contains ATP/GTP-binding site motif A (P-loop)
FT                   AA168-175"
FT                   /db_xref="GOA:Q9M005"
FT                   /db_xref="InterPro:IPR006342"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q9M005"
FT                   /protein_id="CAB82287.1"
FT                   /translation="METSMGKPSFLRNIMVRVLLFGVLIIVVRFAYVVTITGESCNRGD
FT                   FCFFSLPENLNFVISGAASGSSAIDAIRSTSPGDDLYTTRDWIKSVQFYSSIFQDLIAD
FT                   GYLSPESKTLCVETAIGQEVHSLREIGVKNSVGISKKASRPLVVRGEGHAIPFEDNAFD
FT                   FVFSGGDRLGKSLKQLEFADEITRTLKPEGFAVVHVGATDTYSFNSFLDLFNSCRLVKM
FT                   RDIDGFDPSMPHIREFVIQKYSEIDGGGHHHRGGGDSGGKCWIPGYKRDLIRDAEPLIQ
FT                   EEPLKPWITLKRNIKNIKYVPSMVDIRFKSRYVYVDVGARSYGSSIGSWFKKEYPKQNK
FT                   TFDVFAIEADKAFHEEYKIKKKVNLLPYAAWVRNETLSFEINHDPGKEVEAKAKGRGMG
FT                   RIQPVKKSDSSDLAGEVNLIQGFDFADWLKKSVRERDFVVMKMDVEGTEFDLIPRLIKT
FT                   GAICLIDELFLECHYNRWQRCCPGQRSQKYNKTYNQCLELFNSLRQRGVLVHQWW"
FT   exon            complement(71366..72907)
FT                   /number=1
FT   gene            74775..78048
FT                   /gene="F7A7_240"
FT   CDS_pept        complement(join(74775..74828,74972..75223,75314..75608,
FT                   75689..75818,75904..75981,76135..76300,76552..76656,
FT                   76794..76805,77008..77133,77410..78048))
FT                   /gene="F7A7_240"
FT                   /product="putative protein"
FT                   /note="similarity to F-box protein Fbl2 - Homo sapiens,
FT                   EMBL:AF174589"
FT                   /note="Contains Prokaryotic membrane lipoprotein lipid
FT                   attachment site AA552-562;Eukaryotic putative RNA-binding
FT                   region RNP-1 signature AA400-407"
FT                   /db_xref="GOA:Q8RWU5"
FT                   /db_xref="InterPro:IPR001611"
FT                   /db_xref="InterPro:IPR006553"
FT                   /db_xref="InterPro:IPR032675"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8RWU5"
FT                   /protein_id="CAB82288.1"
FT                   /translation="MKKVKQIRVLKPFDLLSEELVFIILDLISPNPSDLKSFSLTCKSF
FT                   YQLESKHRGSLKPLRSDYLPRILTRYRNTTDLDLTFCPRVTDYALSVVGCLSGPTLRSL
FT                   DLSRSGSFSAAGLLRLALKCVNLVEIDLSNATEMRDADAAVVAEARSLERLKLGRCKML
FT                   TDMGIGCIAVGCKKLNTVSLKWCVGVGDLGVGLLAVKCKDIRTLDLSYLPITGKCLHDI
FT                   LKLQHLEELLLEGCFGVDDDSLKSLRHDCKSLKMYKQKLDASSCQNLTHRGLTSLLSGA
FT                   GYLQRLDLSHCSSVISLDFASSLKKVSALQSIRLDGCSVTPDGLKAIGTLCNSLKEVSL
FT                   SKCVSVTDEEAFWLIGQKCRLLEELDLTDNEIDDEGLKSISSCLSLSSLKLGICLNITD
FT                   KGLSYIGMGCSNLRELDLYRSVGITDVGISTIAQGCIHLETINISYCQDITDKSLVSLS
FT                   KCSLLQTFESRGCPNITSQGLAAIAVRCKRLAKVDLKKCPSINDAGLLALAHFSQNLKQ
FT                   INVSDTAVTEVGLLSLANIGCLQNIAVVNSSGLRPSGVAAALLGCGGLRKAKLHASLRS
FT                   LLPLSLIHHLEARGCAFLWKDNTLQAELDPKYWKQQLEEMAP"
FT   exon            complement(74775..74828)
FT                   /number=1
FT   intron          complement(74829..74971)
FT                   /number=1
FT   exon            complement(74972..75223)
FT                   /number=2
FT   intron          complement(75224..75313)
FT                   /number=2
FT   exon            complement(75314..75608)
FT                   /number=3
FT   intron          complement(75609..75688)
FT                   /number=3
FT   exon            complement(75689..75818)
FT                   /number=4
FT   intron          complement(75819..75903)
FT                   /number=4
FT   exon            complement(75904..75981)
FT                   /number=5
FT   intron          complement(75982..76134)
FT                   /number=5
FT   exon            complement(76135..76300)
FT                   /number=6
FT   intron          complement(76301..76551)
FT                   /number=6
FT   exon            complement(76552..76656)
FT                   /number=7
FT   intron          complement(76657..76793)
FT                   /number=7
FT   exon            complement(76794..76805)
FT                   /number=8
FT   intron          complement(76806..77007)
FT                   /number=8
FT   exon            complement(77008..77133)
FT                   /number=9
FT   intron          complement(77134..77409)
FT                   /number=9
FT   exon            complement(77410..78048)
FT                   /number=10
FT   gene            80676..85218
FT                   /gene="F7A7_250"
FT   CDS_pept        complement(join(80676..80726,80849..80962,81046..81132,
FT                   81211..83836,83949..84010,84147..84276,84360..84491,
FT                   84571..84738,84911..84988,85064..85218))
FT                   /gene="F7A7_250"
FT                   /product="putative protein"
FT                   /note="similarity to unknown protein At2g38440 -
FT                   Arabidopsis thaliana, EMBL:AC004683"
FT                   /note="Contains Prokaryotic membrane lipoprotein lipid
FT                   attachment site AA706-716"
FT                   /db_xref="GOA:Q5XPJ6"
FT                   /db_xref="InterPro:IPR028288"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5XPJ6"
FT                   /protein_id="CAB82289.1"
FT                   /translation="MALTRYQIRNEYGLADKELYQSADKEDPEALLEAASMAGLVGVLR
FT                   QLGDLSEEWDTEGSVELNFDAIYSESRENLNLGFAAEVFHCLHEQLMTTAARGHGLAMR
FT                   LQHLEADFPSVEIPILSQTDHSTFFYEPGQSSGLEWHSDLQTKEDLISPRNLPRCIMDS
FT                   YEECHGPPQLFLLDKFDVAGSGSCLKRYSDPSLLKTHTTSAVVATSKLGKDKRLRQSKK
FT                   KGSHTTIKETPEDSRTSHAKLHQLFFLEHVENGHRNPEFHVKLKRRQLNGPPINSSSGA
FT                   SYMEKFLKNSSPYCERVHGTMDQSSPAMETEVTVCSEQEDLPIPSLVYSNSGGTRKYNE
FT                   MEIESIAGHEILEIPFVPHEITVNEKSPVVCLESSSSVNLCCKTNNDADSPASTESEVK
FT                   EAGSDDKAGCDHGFPGFGQPQICTNAEVNQTEVLTQFSNVLRHSPEEGESSLLCTDIQR
FT                   ASPESKPHKAEEAAVDLDESFSQMTPDIDSAGMGTLEILQTPFSLSCYESPANLPEDSG
FT                   SHLELQSNKANAEACEVFEVRRDPMLNISPETHLLKVTQVPQDAYEGGTNDVHSQHVFS
FT                   VETASEISVSALVEDQFSSITNQEIEALESEDISSEAGHFIPDTKKSLNETSVALESDF
FT                   LLPNHYISTFDNFEDLSLSADAQDYAAPKEDETNSQDGSSMNPAQSKHISTSEISSENG
FT                   TLMSDTPRDLHTGYGSLSASSCLEDGLANPDLAEISSYSGQEDPQTMSIVSDDSSDPEV
FT                   PIPDGTCFAGDVDHDNQTGLNNKAIETVPQKELETISDPQESLLGTEECLSSEYCLQIQ
FT                   NQRQESPSETGSANSRTSSDESPPTQNGSVGVQSSPLDVFPSSITEIEALHAPYQEIFT
FT                   SLNDHISESVLSKGLTDEEDFLNVSPESILPLSTSLHETPQANPEITPPLPPLPPTQWW
FT                   MGKLVESTEMPSLAGSGNNSFNIQRDENTQNGSVQANEAQYPSEVSVTDGENHNFHIYT
FT                   EESKATEEQSPSGVNGTSDTYMESKHKCLNRTPEDSFSLAESAQGLEADWRTEAMALEW
FT                   FSQNLREHNNPHPAKLEEEEPQVDHPLEKPGQTKFRQTLRDNNSYNQNQKAGKLKRDED
FT                   TLVIGIDRSMLRKVSEGNRTHVGARVDENDSLLEIIRSKSFNLRPADASGRPNFQVAVP
FT                   KTNLKVAAILEKANTLRQAMAGSDDEHDSDSWSE"
FT   exon            complement(80676..80726)
FT                   /number=1
FT   intron          complement(80727..80848)
FT                   /number=1
FT   exon            complement(80849..80962)
FT                   /number=2
FT   intron          complement(80963..81045)
FT                   /number=2
FT   exon            complement(81046..81132)
FT                   /number=3
FT   intron          complement(81133..81210)
FT                   /number=3
FT   exon            complement(81211..83836)
FT                   /number=4
FT   misc_feature    83034..86690
FT                   /note="overlap to BAC T20L15"
FT   misc_feature    83690..86690
FT                   /note="region from position 83690 to 86690 is not integral
FT                   part of BAC T7A7 but stem from BAC T20L15"
FT   intron          complement(83837..83948)
FT                   /number=4
FT   exon            complement(83949..84010)
FT                   /number=5
FT   intron          complement(84011..84146)
FT                   /number=5
FT   exon            complement(84147..84276)
FT                   /number=6
FT   intron          complement(84277..84359)
FT                   /number=6
FT   exon            complement(84360..84491)
FT                   /number=7
FT   intron          complement(84492..84570)
FT                   /number=7
FT   exon            complement(84571..84738)
FT                   /number=8
FT   intron          complement(84739..84910)
FT                   /number=8
FT   exon            complement(84911..84988)
FT                   /number=9
FT   intron          complement(84989..85063)
FT                   /number=9
FT   exon            complement(85064..85218)
FT                   /number=10
XX
SQ   Sequence 86690 BP; 26285 A; 16593 C; 17422 G; 26390 T; 0 other;
     acgaagaatt gggaaagacg atgagtctct attctttacg ggctgcgaag aagctggcct        60
     ggaggtgaag catctcggaa accgagttta ttgtatcaag cttagagaaa gcaacctctg       120
     aagaataggc tgacaaactc atgaatcatc cacatgctcg cctctgaaac taaaggttct       180
     gtttgtttct ctcgctgctt atttggattt gctttttctg tcaaaattaa tgtgaaatga       240
     gatagtgtcg attcttaact aatgtttccc ttaatcaatt gaatttgatg ggtggacgga       300
     aaaaaaaact gtatttcatt tgtagtataa tatgtgggga aattagtgaa gaaaagaaca       360
     tagaatcaat attggcattt tctttcaaaa atggggcaat aagaaaagaa ctattaatta       420
     gaactgagac gatcacacac ataaagaatc gcattcttgc tttgccgtga gaaagtttga       480
     aatgaaaata aattgtgata ctttgcctgt gtacatacat aaagagtctt gggcattgca       540
     tatacttact atagcttcag ccaattgttg tgacagctaa acattaaatc ttttcacaca       600
     aaaaaaaaaa aaaaagggaa agacttgtaa gccttgaatc tgtaacccat gcatcatctt       660
     gaccacactc cttccgatcg tctcttatgc ccagtagaac gaattcaaaa agataaagat       720
     ggcaaagtga caacaattag tgggggaatc cattacataa tcaaaagttc ctatttcatt       780
     tctaacgctg aagacgaaaa gcctgttcat ctcctctcct tgattcttcg caaccgaaaa       840
     gaagacaagg tactatcttt tactttttgc tatgtttgtc agatagcact attaggtgaa       900
     gcctattacg tttacttctg cagctattgc cccaattact accacaaaga atgtgttgag       960
     tctccttccg tgtttcattc ctctgatcat ccaaaacatc ctcttcaact tctctggatt      1020
     cccgacatgt ctttagaaga agaacgtgat aaacgatgtt gttcttgtaa acgtggcgta      1080
     gacgcactat tttactattg ctctatttgc gattttgcag tccatatggc atgtgcggga      1140
     aatccaacat ccccaaccat tgacaatcca aaaaggcata agcataccct tcattacttt      1200
     cccaggaaat ccggtctgtt ttgcgatgtt tgtgcgttgg tggacgattc tgattactta      1260
     tatgtatgtc tcctatgtga tttcattgtc cataaacgat gtgtctactt accatatgtc      1320
     ataaaggtgt ctcgtcacaa tcatcgtctc acttttactc ccaatcttcc ttacgaagaa      1380
     ccaacggtga cggattgtgg agtttgtcat gcaaagataa acgaaaatta cggagaatac      1440
     tcttgcacta agaagggatg cgtttatgca gtgcattcca gatgtgctat gcaaagtgat      1500
     gtgtgtgacg ggaaaaaact tgaaggagag cctgaagaag tatatgaaga cactaaaatg      1560
     tttgaggaga aaggcgatgg gattatacag catcagagtc atccacgtca ccaattgaga      1620
     cttgaaaaaa tattccacga tgaaagccat cattgtcaag cgtgcagacg tccttcttat      1680
     gatcatggtg gtaatgtgta tcgatgtatg caatgtgatg atttcatttt tcatgaatcg      1740
     tgtgcatatc ttcctcgtac taaacaattt atgctacatg ttcatccatt gactctagat      1800
     cccagttaca atttcataga ttggttccaa tgtgggaaat gttatcgtta ctcttgcggt      1860
     ttccggtgca tgtgttcgtg tgccgtgtga cttttttccg gtgttggaca cactttgtgc      1920
     ttctatatgt gagccgtttg atcatcactc tcatccacat tccttgttca ttactagtgg      1980
     tgaacacgaa agcaaaatct gttccatctg tcaatcatcg gagccacaac ctttaaattg      2040
     tttgaaatgc gattttgttt tgtgctttta ttgtgccact cttcctcata aagcaaggta      2100
     caaacatgat gagcatttcc tcactttttc ttatgaagaa gatgcaaatg atgagcttta      2160
     tggttgtgaa atatgcgagg aagatataaa tccaaagaat gggttatatg catgcaacga      2220
     gtgcggagtc acactccaca tcgaatgttt actagggaga gatccgaata cgacgcctgg      2280
     atcattttca aattcggtag gaacgttgta tattcttccc aacacttatt caactcgacc      2340
     tatatgcaca acatgcagaa gacgttgtcc gtaccaaata aagataaatt catcgggcgg      2400
     tccctatata ttctgctctt ttgattgcta tcaaagattg tgtcgtagcg aagactggtc      2460
     ctaatgcttg ggaggcctaa agcaaatcac taaatatgtg gtcttctcgt aaaagaattt      2520
     gtatatgtat ttgttttttt tacttatata ttttgagctg tatcaaggat ggtgtcagaa      2580
     tcattcatgt gattatttta aggttttctt gatttagaca tcaaatattt ctagaaattt      2640
     cgagcgtgtt tcgcaagttc aagacataaa ctcatgtttt tagttgttta tagaacgatg      2700
     attatatata ttcgtaaatt tcttggggga taagacacgt aaagaccaac acaacttaat      2760
     tagatgagtc aacaatcatc gtgcataact ccaaatttct actttttcac ttatttgacc      2820
     gtcatcgata ttttatttca ttagtaaaaa cacaggaaga ttactcaaaa gtcttgaagt      2880
     ctttgatcgt taaaaatgaa catgtgcaag gagacacaca aaaattccaa atcaattata      2940
     taattgcaac ttgcaaagat cgaagcgatt tcttcttata tacgagttat tatatgtata      3000
     aaaatgataa gacatagtaa atgacagacg caaaaacatt gaccaaaagt tgtaaaaatg      3060
     atatagaaag acgtcaacac caacaaaaaa atgatataga gagaaacgtt cgtttacacg      3120
     cgtttttgtc tatataaagt atacatttat acatccctgg aaatttttca gattttcaaa      3180
     aatcagattc aaaggaaaca gaacacaaag ttttgtgggg tttgaccaaa gagagtcaac      3240
     gaagaagatg tcttcaatca gtacggaatc gtcttctaat ctgtctctgt tagagaatgg      3300
     cggaggagga agtgataagc cgacggcgga gacgtcgagg cgtgtgcgga gaacggtatc      3360
     ggcgtcgtcg ttgataagga agagatcgga tctgaaactg atctccagag ttcgttggga      3420
     gtttatgaga cgaatcttga cgaatcttca agaagttctt ctcggcacca aattgttcat      3480
     cctcttcccg gccgttcctc tcgccgtcgt cgctcaccgc tatgactgtc cacgtgtaag      3540
     ttccaacaaa tatatcttta ttttatcgga ataataaacc aaacattcgt cttaaaccat      3600
     atgttatgtt aattgttatt gcgtggtgta acaaaaaaac aggcgtgggt ctttgcgttg      3660
     agcttgctgg gattgacacc tttggccgaa cgtatcagtt ttctcaccga gtaatttatt      3720
     cttctttgtt ttcttctttt accatttatt tgctttctat ctaaaataac gttattagtt      3780
     catttacaaa catatatttt gattttcttc ttaaacaggc aaattgcttt ccataccggt      3840
     ccaacaggtg atcatttaga tttcgttgac tttatatttg ttgccatgtg aatcgaaccg      3900
     ggttattcgc agcacaaaac cgaattctta aattaaatca acgcattatt tttgtggttt      3960
     aatctaggtg tcttttatag tgcattgatc tttgataact tgacatgcaa gctatataca      4020
     tgaaggaaat tggatttttg attctgtgaa agtgtttgca ttttctctca cttatgaaaa      4080
     ttaatgaaaa taattgaatg aatgaatgaa gttggaggat taatgaacgc cacatgtgga      4140
     aacgcaacgg agatgataat agcgattcta gcggttgggc aaaggaagat gagaatagtg      4200
     aaactctcac ttcttggctc tattctctcc aatcttctct tcgtcttagg cacttctcta      4260
     ttccttggtg gcatctctaa tctccgcaaa caccaatctt tcgacccagt acgttattgt      4320
     ctcctctcaa tcaacattca agatatatgt atcatatctt atagattgac aacaacgtac      4380
     aacaaaaaaa tcaaaatgtg tatcgatcat ctaatcatgt gtgtaattct gcaagaacag      4440
     agacagggag atatgaacag catgttgttg tatctggcgc tgttatgtca gacactacca      4500
     atgataatga gattcacaat ggaggctgaa gaatacgatg ggtcagatgt agttgtgttg      4560
     tcaagagcaa gcagcttcgt gatgctcatt gcttacttgg cttttctcat ctttcacctc      4620
     ttctcttctc atctctctcc tcctcctcct cctcttcctc aggttctctc tcactctctc      4680
     ttataccata ctcttcacga tatgaatcat cttgtgctgc ttcttatcta tgtgtgcttc      4740
     ggttaaatgt ataaaagagg gaggacgtgc atgacgatga cgtgagtgac aaggaagaag      4800
     aaggagccgt gattggaatg tggagtgcga ttttttggct tattataatg acacttctcg      4860
     ttgctttgct ctcagactac cttgtctcca ctatccaggt gtgtgttgac tagagctttt      4920
     tggaaaaata tgttatcaaa aatataatat tttcttcaaa acgtataaaa aatatgaaat      4980
     ggacaggacg cagcagactc gtggggatta tcagtgggat tcataggaat aatattatta      5040
     ccaattgttg gtaatgcagc tgagcatgct ggtgctgtca tcttcgcctt ccgtaacaaa      5100
     ctcgtatgtt ttacttcttc tttttttccc tagttaatta caacaaataa ataacatcac      5160
     catattaatc ctggttttga acaaaatatg aaaatgtaca ggatataact cttggaattg      5220
     ctcttggatc tgcaacacaa attgctttgt tcgtggtaag cataatatta gtattgattt      5280
     ctgtaaaatt agggaaaaca aatatttctt ataatatatt cctcttagtt tataagcttg      5340
     gctcaattat caagtttagg tgtaaactta aatatatgga gaatatcttt cttacaacct      5400
     ggtgctaact gagaaaatat ttcattatgg ttcagttttc ttacaacaat ataattttga      5460
     caaactcaaa tttgaatgta ggtaccagtg acagtgttag tggcatggac aatgggaata      5520
     gaaatggacc ttaacttcaa ccttcttgag accgcttgtt ttgccttgtc cattcttgtt      5580
     acttccttag tattacaggt gccatttcac tcattacatt atttattgaa tcttgaggtt      5640
     gtgttagttt tattaatata tatgttatta tatgattaat aggatgggac ttcgaactat      5700
     atgaaaggct tggttctcct cttgtgttat gttgtcatag cggcctgctt ctttgtctct      5760
     aactcaccct caagtaagct tctcttttga ttatgatgac tgttttctac gatgaataaa      5820
     tacactatga tattcatttg ctttgtattt ctccaattgc agccgaaacc aatacaacta      5880
     atcatacaat aacgaaaagg taagttatgt ttaagggtat caattagtgc accatagtaa      5940
     acaaaaatgt aacattttaa gaaatctatc aaatatattg atgaatgtta gttttaactg      6000
     tcaactggca atcatgataa tcatagaaac ctaacttcta gaaagttaaa tcatttttag      6060
     attctcggac tacattatat attatgatat atggttcttg tttatttttt ttaattgcag      6120
     gtaactcgaa tattgttttg tctttctttt agtgtattgt tgttttcttt gattacatat      6180
     ttagtttttg aattattgtg taagtatata tatttttaag aatttgtttt ttacatcatt      6240
     ttttataagg aatatgtaaa ttaaacgtaa tagataattc taacataatc aaaccttgtt      6300
     catacatgtc agaactgcat gtctatatag gaatacaatt aaattaaaac taaaaatata      6360
     aatgccttct catggaattt tttgattcgt atcagaagat atttggcagg aatttatttt      6420
     cttagtgatt aaaaaacaaa aaacaaatgt tcgaagtatc ggagaaggcc caactgagcc      6480
     cactagttta aattgtactt tgtgattccc ttgggccttg tggatcccat taagtactaa      6540
     ctgttattta caagaatgcc atcatcggag gccatttata aattttggac tcaattttgt      6600
     tgcaaataaa aatctgaaat tctcaggcga gattccggaa gcaaaacatt cctaaatttc      6660
     gccaagtgat ccgccatggg agaagagaag tctctgcttc agttccgtag ttttccttca      6720
     ctcaagacct ctgatttcgc tctcaccgaa gaaccttcat ggaggctgga gaacaacgtg      6780
     tcgtcgaatc gccggagagg aaacaagaga agcggtggcg tttttaccaa ttttgcgtcc      6840
     ctttccgtag cgattaggag agatcggaga gaatctacat ttaacggtcg taatggcggc      6900
     ggaggcggag cgttcgcatc ggtttcggtg gtgattccga aggaagagga tgaattcgcg      6960
     cctacctcgg cccagctgtt gaaaaacccc attgctttac tgtcgatagt accgaaagac      7020
     gccgcactat tcttcgccgg agcgttcgcc ggagccgccg caaagtcagt gacggcaccg      7080
     cttgaccgaa taaagctcct aatgcaggta agggctctct ctcctctcct tctcaacaac      7140
     ttttaaggtt ttctggcacg tgtgttttct ccattttaaa aagtaaaata aaaataaaac      7200
     tggtgactgg tgagcacaac gaatacgctg tcgtttcggc tagttgttgc ttgtgggaca      7260
     ttgttgattt tcctcttctt ttttcttttc ctaagagact cttccatgac atggtctatg      7320
     ataaaattga tcatgtattt atatctcatt atttcaagcc aagaaccttg aggggaatct      7380
     atggagtatt tgtgattgtg ttcttgttac aggcttgtag taatgtacat tgattcttaa      7440
     atgatgtctt attaattcat agacacatgg tgttcgagct gggcaacaaa gtgctaagaa      7500
     ggctattggt ttcattgagg tatatatact ctcaatcgtg taatttttaa gaggattagt      7560
     tagttgttct tattgtaaaa gtcttgttga tttggttttg tttgggatga ctacaggcca      7620
     ttactcttat cggaaaggaa gaaggtatta aaggttattg gaaaggaaat ctacctcagg      7680
     tacgtcacac aatttcttgc atccttttgg aaagaatggt gttgaatttt gtagagtttg      7740
     attgcacata atcttagtct gaatgttcca ggtgataagg attgtacctt atagcgcagt      7800
     ccagttgttt gcatatgaaa catacaaggt atataatctt tctatatctg attctggttt      7860
     cgtttcgaaa gtttttgaaa ccgtgtctaa tcagtaatca ctttgttctg tacattctgc      7920
     cttttttatg ttgtttagaa actcttcagg gggaaagacg gtcaattgtc agtcctcgga      7980
     aggctcggtg ctggtgcttg tgctggcatg acgtctactc tggtaagtaa cgttgtttat      8040
     aggcctgagt gagtttgtct aatcgtaaag taacttaaga ctcttactac ttaatgcaga      8100
     ttacataccc tttagatgtg ctgagattga ggttagctgt tgaaccaggt tatcgaacca      8160
     tgtcccaggt atattcatcg cattatacac caactttctc ttccataaat taatcaggtt      8220
     ttaaagcaga catgtcatat ctaggttgcc ttgaacatgc tgcgggagga aggagttgca      8280
     tcattctaca acggtctagg tccttcgctt ttaagtatag ctccttacat tgccatcaac      8340
     ttctgcgtct ttgatctgta agtctactaa cagttcaaac attacccctg aatattttta      8400
     actagattgt ttacatattc gataatacaa tatatgcaca gggtaaagaa atctctgcca      8460
     gagaagtatc aacaaaagac acaatcatct ttgttaacag cagtagtagc tgctgctatt      8520
     gctaccggta cttgctatcc attggatacc attagaaggc agatgcaatt gaagggtact      8580
     ccatataaat cggtattaga cgctttctca ggtaggaaca aaaacatcat tatctgcttt      8640
     tattcttcca gtttccggtg actgacctta ttaaaccctt aaaccgttgt gcaggtatca      8700
     ttgcgcgtga aggagttgtt ggcttgtacc gtggctttgt ccccaatgca ctcaaaagca      8760
     tgccaaacag caggtagtta tagttttgat aaaacaagtt catttttttc atttttcttg      8820
     tttcagtatt aacattttgg aatcctcttt ttgtattgtt tcagtattaa gcttacaaca      8880
     ttcgacatcg tcaagaaact catagcagcg agtgagaagg agatccaaag aatcgcggat      8940
     gataaccgca agaaagcaag tcctaacaca atcgatgaac aaacctgaag acgcaatttt      9000
     ggatttccac aaggtcattt ttgcccgtta tcttatgacc tttgtttgtg tgttttgtaa      9060
     tttggaatgt aataagttgt atgttctcct cataattcaa aatgtgcttg aattgaatcc      9120
     tgaagccaga gagggtaata aatggctgtt tgtgttacgt ttggtcgcgc tggttttgta      9180
     taaaccgaat ttaaccgggt tgctacactc gaaattatat cgttttctgg aattgggtca      9240
     tctatctatt tcgcggttgc agagagaagt tgtcgacgac ggtgtctttt gtatcctcct      9300
     cctccagacc aacaaactca gaaccctaag ccctaactcc gtaaaatcat tttcgtcgcc      9360
     atgtactgta ctttgcgatt tcctttgcct cttcacattc cccaaactcg aacaatgacg      9420
     tcctgtcagc cgaaacgacg ccgtgttgag cacttgcggt gctctgctca gcctagtagt      9480
     attcgtgaag atgacgaaga tgccgatgat aggaggtgac catcgattct ctttatttaa      9540
     cttgttcctg tttgattcta attgaattat tgtttttctg caaatgtgat gttgatagag      9600
     ttggagttga aagacgaatt tcgattgtgg tggagagata cggaaatggc acttcaaaaa      9660
     ggtggtcagc ttaggtttct gttcttatct tattacccga agaatcatct gtataaacac      9720
     actacctctt gttccttctt gtgcagatat tttctagatg atgatgattc ccctttacaa      9780
     ggcattctcg aggagcgtga aactaagcct gataacaatt ctcagagctc taattcctcc      9840
     gaaacgaaca ttctttggct tccagatgtt gtcagggatt ttgttttccc ctcaggcttt      9900
     cctggtactt gtacttgtca gcttcaaatt ccatatgtat ctttctgtca tcttcctttg      9960
     tcaggactct cagaatgtta agcttgcaga ggttttgtag atccaattat gattcagtga     10020
     gttaatctcg taaaatcaca ttgtgcaggg tctgtttcag atgattactt ggactatatg     10080
     ctgtggcagt tcccaaccaa tattactggc tggatttgta atgtattagt cacgtcaagt     10140
     cttctcaagg catgttcggg aatcccctaa attattgcta aggtcttctt atgactggac     10200
     ttcttctaga gacaaatgtt gagaatgctc tgcaattttt tttcaaaatt cttgtgctac     10260
     aatgcaggcg gttggggttg gctctttctc aggaacttct gctgccgcta ctgctgctgc     10320
     ttctgctgca gccatcaggt ttactttcat tctaatgcaa actttgtttg tttgctgctg     10380
     catatttttt ttgttcttat agtttttcca aaccatgtgt tgtctcttca gatgggtgtc     10440
     caaggatgga attggagctc ttggccgtct tcttattggt agggaaacca tcggaacgtt     10500
     aataaatgtt catggagtta tctaatatcc tctacaataa gaagggtatg ttttccaggt     10560
     ggacgttttg gtagtctttt tgatgatgat cctaagcaat ggcgcatgta tgcagatttt     10620
     attggcagtg ctggaaggtt tgtagtacag gatttaaatt cttggtgagc catatttggt     10680
     taaaactgtg tataagcatc acagtttttt tttttttttt tttttctctt tttttcgtag     10740
     cttctttgat ttggcaaccc agctatatcc atcccagttc ctactgttgg catccacggg     10800
     aaatcttgcc aaggtattcc tcatttcagt tttattattt tcctgccagc tgaaatcttt     10860
     atccagaatt cgcttccgct aagctttaaa tgacagagtg agatacttag atttcaattt     10920
     gaaataggct gtggctagag gattgagaga cccttcattc agggtgattc agaatcattt     10980
     cgctatctca ggaaatcttg gagaggtagc agccaaggta tgctagtcat gtatgtggaa     11040
     tcaaaaccca aatacgagca tgtagtagct tgtttactct attagtggag tctttaattt     11100
     atgttcaacg tttcaggaag aagtgtggga agttgctgcg cagctaattg gtcttggttt     11160
     cggcattctg atcattgtat tttacttgtt tgttgaatca ttttatcata tcttttcatt     11220
     agaagtcccc attggatttc atctaaatca ttttttttgt ttcatgttaa gcgtttgtat     11280
     gctctaaatt ttgatgcagg acacgccggg ccttgtaaag tcatttccgt ttgtgttact     11340
     tacatggacg agcattagac ttgttcacct ctggctacgc taccagtcgc ttgcagtcct     11400
     acaatttaac acggtatgag ttttgaaatg gatattctta caatcccaac ttgagaaaac     11460
     tcagataagt gataactttg atttgaaata ttgacaggta aatctcaagc gtgctcgtat     11520
     catagtagaa tctcatgttg tgcactcagt tgtaccaggt aagcatattt cttcccttta     11580
     tccagcttat tattcaacgt tcaagtaaga ctcataatac tatacaggat atgttgactg     11640
     caacaagcga gaaaacattt tgctgtggca gaggttcatg aaacctcgaa tcatctttgg     11700
     tgtatccctt gaagagttgt ctggtctgga gaaatctgtt tctaaggtaa tcttctcctt     11760
     tcatcttaac tgcatccata tgtactcttg agagaatctt ctgtttgtaa gtccaagttc     11820
     ttgaaacttt gattttttca ggtcaaggca ctccttaaga tgtacacaaa ggagaaatat     11880
     attcttacgt tgaataagtt gaacaaggat actgagtttt ctgtgtcctt taaggtaaaa     11940
     cctatattac acgacttatc tgcttctcat tctcctccaa aagggctaaa tttaaaaccg     12000
     agcaccatac tgcatttact gactccgtca tgattttcct tgttcttgca ctgtgaagaa     12060
     agaacctaga atacgttact cgtttatttg tctttcaagt aacctgatag agagttgggt     12120
     atgctttggt tagtgattag ttgagagtct tgaaacccat tcatgggtaa ttaattagag     12180
     catgtcaagt taggactgtg agagatcata gggatgacat actgtttgct tcttcttagt     12240
     tgaataagct tcttgagaag catatgaggt aggcagtcat ttttcagaaa tatcggctta     12300
     acctacggga caaagtttat tcaccttgct ggagagtact ctcagttacc gtggctagag     12360
     tcgacctttt gttgttttat cagtaaagtg ttgcatgatc ttaatatttc tttgctttta     12420
     tcattctcgt ttgaaactac gttactttac atactttctg gctttttttc tactccttct     12480
     ccatcaagta tatcgtgaat gtgaggccta atccattttg ttttgccttg cctttaattc     12540
     atgaatgtaa aacaaataat gcaggtgaat gccacaagca gagacgtgtt gagatgcctt     12600
     tggcaagcat attggttaga ggagaacatg gaagaaagct ttaaagacaa ggatagtgtg     12660
     ttccactggc tgaagcaaag cttgtcggag atggacaaca agtttgatga tttcttgttc     12720
     aaattggata ctgctggatg gaatctacgt gaatctaact tgaaggttcc caaccaagtt     12780
     ctcatagacc aggaatctat ccctttctaa cactcgattg attgattctt cagactcatc     12840
     acgcaatctc ttgaacagaa gaaaataaca ctgaggtaaa taataccaaa ccctgtcaat     12900
     ttgagaatat ggagtagtct ataggtgatt tgtagaaata tcatgttcgg tacagctaat     12960
     atagttagga tatatcaggc tttgtatggc aacttgttta aatttgtatt gtgtgacctg     13020
     atccatataa aattaagaag aaaaagtaaa atatctaata ataagttagt gtggatgatg     13080
     agacaaatgg taaggtttta ggccaatgat agtgattata cctcttttgt ttgtacttga     13140
     ttcgtcacca ttattctgct tgcgtttatt ttagaattta gaggtggctt tcggaattaa     13200
     aaacaacaag acaacaacat tttataattt tgatttgtat actaataata gaaccaaact     13260
     ctgcttctct cagctattat tatctaagta ctgatatatt tcaaattgta gcataagttc     13320
     tgtatatgta ttagatagag ttatcttttg atttattatc atatacggat taaatttgca     13380
     gtttagagca atgtatttgc aattttgtga aaagtgaatt tgctttattt ttgtcttcat     13440
     tactaaagtt gaattagcgg tttgatgagt cattatcgct attaatttgt ttccgtaata     13500
     ataatgataa gcaatcatgt cacgaacata ttactaatat tgtggtgatt cttttgccct     13560
     cctcatccat attcattgat tgtaaaagca cacgtaggtc acatacgtat catcctaaac     13620
     cccaaattaa aaaaaaaaac taagcaattt ttatacatgg cctttggcga tccaagcatg     13680
     caaaaatatt ccataaatgg ttaacacaaa atcatcgatt ctgaggggtt aactagggtc     13740
     cactttatta ccgtatggaa atagagacac gtcaaagcta gtatttggac ctacgtacgc     13800
     tcatgtattc cgccacgtgt cgtggtttca ctgacataaa acacatgtcg gtcagataat     13860
     tctagctctc acgacgatga agcaatgtag gctcacttcc actcaccgcc gcctatagca     13920
     gtgacacacg tcctgtcacc ggcgtgtcac tcaataatta tcagattttc attttaatta     13980
     aataatgtta tcctatattt gttaggtgga tcccaacggg agggctttat ggtaattacc     14040
     atttactcct gagaagcttt tatttttgtg tgtggagtag taggagaagt gttgccgttc     14100
     cttgtcgaac aaaaaagagc tttagacaga cgctcctccc cttttgtaat atttttgata     14160
     ttacgtgtgc tctacgcgaa tctatcaata tctaaatcct ctctttctct ctctctctcc     14220
     tccttcttct tcttcttcct gtcgctgcct tgtggttgag tgagcaaaaa aactcaaaac     14280
     cctccatgga aatgggagag agaatcaatt cgagttgttg ttagggggtt tgcgatattt     14340
     taggcttctg tcggtgatct cgaccaaaaa aaataaacaa aggagctagt agggttctgt     14400
     tttctctatc actcggaagg aagctggttt atgtcaaaac tttgttcttc ggaaaatgcg     14460
     aaaatcgttc aaggattcac tcaaggctct tgaagctgat atccagttcg ccaacactct     14520
     gtaaatctct ctctctctct atttcttctc tctgtttttc tctgttttga tgtttcgatg     14580
     tgttggtaga atctgatcgt gttcttagtc gagagtggtt gatttgcctc ataaatttgt     14640
     ttgatgctgt ggttaaatcc atatttagtt ggtacttcgg ttttcccttt gcttgagttg     14700
     ctgatttttg tctcttccga ttcgataggt cagattgttt ttttacttct actgaagttt     14760
     ccagaggata atcagttttt gatacttgtg aatctgtatc tctgttgtct gctgggtctt     14820
     atgtgtgctg atgtcatatt gaatttaaga ctttgcgttt acgcgagctc ataaattcca     14880
     atttattcct tagcaagtct cagacgccac caccaccttt tggtcagatc acacaaaatc     14940
     tatctatagt ggtcaattct ttttcctttc gtcgtatata gtctctgatg ctatcctaag     15000
     ttgacttggt atacttggat taagctgtga agcaacatgt tcatgttgcg tactaatctc     15060
     accaatcatt gaatcaaaat gattaaaaaa aaatgaacta tgtgtgtgta gggcgtcaga     15120
     gtacccagag gagtatgatg gtggctacgt tcagatgaga ttatcttaca gcccggcggc     15180
     tcatctcttt ctcttccttc ttcagtggac tgattgtcat ttcgctggcg ctttgggctt     15240
     gcttaggatc cttatttata aggtctctta ttaattttcc tgctgtttta ttgctactgg     15300
     atcttcaaga tcacaatgtt cttgtctgcc tgatatgtga ttctctgttt tttatttata     15360
     ggcatatgtt gatgggaaga ccacaatgtc gctacatgaa cgcaaaacta gtatcagaga     15420
     attctatggt aatctgttaa tcacttattc tctcttaatc taaaggtata agattagacc     15480
     agacgatatg tttttttctg actagcaatg gatgttgttg ggcagatgtg ttgtttcctt     15540
     cgctattgca acttcatgga gggatcaccg atgtagaaga aaggaaacag aaggagatat     15600
     gcgacaaaag ataccgtaaa aaggacagaa cagataaagg aaagatgtcg gagatcgatt     15660
     tggagaggga agaagagtgt ggaatctgct tggagattcg aaacaaagtt gttcttccta     15720
     cgtgcaatca ctccatgtgt ataaactgct acagaaactg gtatataaag cttttccttc     15780
     ttttcactca ctctcaccat tcatcagcct ttttcttaca agttatagaa tctcttgttt     15840
     ggaataggcg tgcacggtca cagtcgtgcc cgttctgtcg aggcagcttg aaaagagtga     15900
     attctggtga tctatggata tacacttgta gcgccgagat tgcagattta ccagcgattt     15960
     acaaggagaa tctgaagagg ttgttgatat acattgacaa gttgcctctc gttacttctg     16020
     atccaaatct tgtcccttat gctcctcttc ctcggtgaac attacattct ctctgtttct     16080
     tgttatgcac atagcaattt ctttcaaaca aatttcatct atttatgtcc actttgtata     16140
     taatatttat gtgtttttag ttggtttttc atctttctat agtctcagat ttgggtttgt     16200
     atataacaac cattggttat tgacatttag atcaaaaatt cgatatcata tttgctgatt     16260
     aagggtactt aatcacattt tggttcgttt aaattagtat ctgtctatct gactatgaat     16320
     tacagtaacc gattggtgtt tcagtcaaac cgacttgttt tgatcgtttt ggggagtaat     16380
     ttggtttcgg tatggatcga attggctgaa ccggaaacca gcaatttgag tgaagcacaa     16440
     gaccgcagta cacgtggctt cttctaactg gggtaagaaa ttatttgacc caatcagatt     16500
     gtacctcatc tagattttat tgccaatgga cttgaaacat caccagataa cgcagagttt     16560
     aatagataag attagtaatc ctactcaccg tcagatggat ttgtgaatcg atccaacggt     16620
     cataatcgtc tttccaagat aggccagctc cgaaactcac ctccacgcat ctataatcgt     16680
     gtatcaagaa acggatcttt cttctctatc ttctgaatat cacaaaaccc aattagccgg     16740
     agatggccgc aacatccgcc gctgctgcag ctgcttcttc catcatgggt actcgggtgg     16800
     ctcccggtat ccatcccggt tcaggtcggt tcacagccgt gttcggtttc ggaaagaaga     16860
     aggcagctcc caaaaagagt gccaaaaaga cggtgactac ggaccggcct ctttggtacc     16920
     caggcgccat ttctcctgac tggcttgatg gttccttggt tggagattac ggttttgatc     16980
     ccttcggttt aggcaaaccg gccgagtatc ttcaattcga tatcgattca ctagaccaga     17040
     atctggctaa gaacttggcc ggagacgtga tcggaacccg tacggaagct gccgacgcca     17100
     aatcgacgcc gtttcagccg tacagtgagg tgttcggaat ccagagattc agggaatgcg     17160
     aactcatcca cggacggtgg gcgatgctcg ctactctcgg cgctctctcc gtcgaatggc     17220
     ttaccggcgt tacatggcaa gacgctggca aggtaacgcc actcccttct ccacttggat     17280
     aatcggttat aagttagtta tttcgaagat gctaataaat tagtattcaa atagttgcgt     17340
     ttgcgtttgt ttgcgactca gatagaaatg tatgtacaat ttagttgatt tagcgtttgc     17400
     tttggcgtct gtctctctct ctttcttaca gtttgcgtta gcattggact gtttgagttt     17460
     ctgttcagtc aagaatattc aagtctagtg ttcaatgagt gatatttaaa tattagttga     17520
     aatgttgtta ttcaatcagg tggagcttgt agatggatcg tcctacttgg ggcagccatt     17580
     acctttctcg atctcgacat tgatatggat cgaggtgtta gtgatcggct acatcgagtt     17640
     ccagcgcaac gccgagcttg attcggagaa gcgtttatac cccggaggca agttctttga     17700
     cccgctaggt ttagcggctg acccggagaa gactgctcaa cttcagttag ctgagatcaa     17760
     gcatgcacgt cttgcgatgg tcgccttctt gggattcgcg gttcaagcgg ctgcaacagg     17820
     taaaggtcca ctcaacaatt gggctactca cctcagtgat ccactccaca ccaccatcat     17880
     cgataccttc tcctcatctt aaaatcatta tcatgtgaga ttctatttgt aacttatgta     17940
     aaaacagagc tatgatgata ctgaatcgac tttgggcttt tgcttgtttg gtttatttac     18000
     atgtttggcc catgacatta aattgggctt ctccttattt actataccta ctcgtcgtac     18060
     attttcaaaa tgtatttttg tcgcatatac agattggccc aatagcagga gtacaagacc     18120
     gacccattag ttatgttgtg attatttttt cttgatttgg acaatgaaaa aggagaaccg     18180
     tacagaaaaa caaataagtc cacagacaaa aaaaaaaaaa aaaggatagt cacacaccgc     18240
     gtgggatttg gatgaacatg ggagacttgt cttgtgaagt ctccttgaaa ttgattccgt     18300
     gtctcactgt cactgttccg taatttggga ggacattgaa ttattatttt tgtcgttgat     18360
     tatgacacat aacaagcagg ttcaattact agtttaggaa aaaaaaaaaa gcaggttcaa     18420
     ttacttgctc gtatgcactg aagaaacaac cacaaaaaat gttttcaaac tattgaacgt     18480
     ggagattcga tgaattgatt gtaattctaa tattcttttg aagaaaaata ttcattgagg     18540
     aatgaggttc gtcataatca attatgaata tagaattggc tggttcaacg atcaaaaatg     18600
     gataatccgg acaatataac aaaaatgatg acgttaagca aaacatacag taattttata     18660
     taaaaaaatc ataactgtat gagtaatctt tgtgacgtta caaaatacta attttaattt     18720
     ttttgatagt atgactaatc tgtgtgacgt cacgaaaaaa ttatatatta aggttttacc     18780
     tccccgccac attcatttca gaaactttta gctatagaca ttccaacaaa tttattttat     18840
     actattgttc attaatcata agtactagtt aaatcatgtt ttggtctttt gaagctaaac     18900
     gatttgacta attcgaagca aaaaagtgaa tgtgctttat ccactactga ctgatacgag     18960
     aagtcgaaga aactctggtg attgaggtcg acgaaacata tcctaccaac ttggatccga     19020
     attcgcttct tgaagacttt gaatatcccc actcatcgtc aatctcaggt acattctcct     19080
     ctccgtttag atacctaagc acgattctca tcgacggccg agacgccggt ttttggtggc     19140
     aacagagcaa tccgacggcg agagcaagcc ttgcttctcc tccgtcgtaa ccagatccta     19200
     gtctcggatc aatcgcactg agaatctcac cgttcgcgtg aagctccata acccaatcga     19260
     ccaagaagaa ggtaccggaa tccgttggtt ttctcccgca aacgatctct aacaacaaaa     19320
     cgccaaacgc gaaaacatca gacgcagatg aggggtttcc gttgcgggaa agctctggcg     19380
     ccatgtaccc gatggttcca acgagtgctg ttgtttccga tagcgttccg cgttcgtaaa     19440
     gcctcgcgag tccaaaatct cccaatctag ggttcatctt tgaatcgatc aagacattgc     19500
     taggtttcac gtctctatga atcacaatct tctcccattc ttcgtgaaga tacaataaac     19560
     cagacgcgat tcctttagcg atctgaaaac gagcgttcca cgacaaaacg gcgccgcttc     19620
     ttctcggtac agtgtagagc agagagtcta agcttccgtt ggggatgtaa tcgtaaatca     19680
     acaagagatc gtttttgtgt ttgcaccatc cttggaggtt caccagattc ttatgcctta     19740
     gtttccccaa actctcgatc tctgcgacaa attctcgaac accttgcctg ctacttggaa     19800
     ttatcttctt cactgcgatg ggatccgaat tcggcagttt tcctttgaaa acggttccaa     19860
     atcctccggt tccgatgatt ccagtctttt tgaatccatc cgtggctacg tagaggtctc     19920
     tgtatctcaa tctgcgagga tgatcgattt cccagtcttc aagagtctct tcttgtccca     19980
     gtctcttctt gtacatgacg aagaagaaga gtaacacaag catgaccagc attactgccg     20040
     ataacgccac gatcataaca atgacttgag aatttaaacc ttccttcttc gccttattcg     20100
     gcggcggcgg aggaagctcc gagaggatta gaacatccgc aattggacgt tctccgccgc     20160
     ttgagaaact ccaacccatc acgtaatgag cacttgactg acctttcccc gtcgatgccg     20220
     tgaatccgac gtacatttct tcttgcacaa tctccaacag ttttggaaca tgttgagaga     20280
     tcaaaggctt tgtgggttta aaccctaatc tcgcgggata aacggtgacg tttagcattt     20340
     gtgttgctcc atcatactcc aaaagggctt gaataggatt gccactctca agctggaaat     20400
     cttctttttt gttgtgatca tcattgttgt aatacacgac tggttcttgg agatccgaag     20460
     tacgactgtt gtaattcaga ccgatgtcgt ttcctattct gtcggtgttg tcgtctcttg     20520
     atccttgcac cgtgtcgaat tccactgcga atacgtggtt cctaggatcc ccattgttct     20580
     ctttgttgaa aactcccaag tactgtgcgg atccagcatt gagacgataa ggtgttggag     20640
     atagtgtgaa tgtgaatcca aagcctttat tgcttgagct tgaagggatt atgacaaaga     20700
     cgaaagacgt gctaaaggaa cgaattgtga cgtttgtgga atttctatta agcaacctca     20760
     ccggtttgtg gtagaaagct gtaccggtaa cattcgactt tcggtcagtg agtctcaata     20820
     gtccgtcggg tttgatcatc gcggctcctt caatccgaat cttcgattgg tttccgttaa     20880
     aacctcggaa agcaaaattt gttgttgttc tctgagctcg aacatggacg ctcaaaaaca     20940
     ggaaaagctt gaataagaat gagactatga acatggatct ttgtgtgccc atgggtgagc     21000
     gaagtaaaga aggagataaa gagatacttt gaagagttct ttgttagata atttctttta     21060
     tggacatgag atgagagttt gttttttttc tttcagattc taatgagtca aagaagatga     21120
     aaattatacc aaaaccaaaa aagaagaagg aacatggtac tttccgctca atgttcacat     21180
     taccgtacat tgaaaatata tggcacccaa tgtttttgtg aaaattaata aatagaaaaa     21240
     aaatattagc catttatttc aacaaataat ttccattaag acttggacca acatgtttta     21300
     gtgcttgaac tctgtggtta aaaagaggtc caaacgcaac catcaggctg actttgacaa     21360
     attctacgtt gactttaaca tcatgtattt tatatttttc cttaggaaca agaaagaaaa     21420
     aaaatagtca tatggacttg gacgtttgtg attaaacctt aaaagataaa aagataaaat     21480
     gtccaatgaa tatcgtttaa ccgttttaac ttttaagtgt tttctcaaac tctcaagttt     21540
     ttctctaaca agtaacaccc acgtataatt ttctaaatta ccatttcagc aatatctagt     21600
     gagttctaaa tttcttcatg gacttgattt gtcgattggt aacaaaattt aatacaaaaa     21660
     agacgcaaat atacatgtca atttcacaag gaaaatttgc actaatatta aaatatcgat     21720
     attaataatt gagtgatatg tgtgttatag cttttgggtc atgctaaggt tgctaacttg     21780
     taacaacaat ttagaaatag acaacccaac atatttattt ttgagtttta tgtttttgct     21840
     catttttaaa gcttttttaa aagctaaacg aatttaattg gtgactgata tttttcatcg     21900
     tagtttaaaa ctaaagagaa tcaatttcta agattaatcg gccaagcatc ttagcaattt     21960
     acaaatgtaa aataagattc cagttcgtag ccgtaaatgt tgcataccgt ctgttattta     22020
     aaattatttt accgctctta gctatacgct tttgttaaac tagccgtttg aatgctaaat     22080
     accaaaaata ccataagaag tgaaaaacaa aatttgtact actgttattg cttataagtt     22140
     acaacagaaa aaaactcgaa gtaattgact ttgtactatc taccactgat aacagaacta     22200
     gaagaaaccc ttgtaacgga gaaagatggg actgagctcg aagccctatc cgatgaaaca     22260
     tatccttcaa agttggatcc taaatcgctt cttgaagaat ccgagtatcc ccaatcgtta     22320
     tcaatttcag gtacatcatc atctccgttc aaatacctaa gcaccgttct catggacggc     22380
     cgagacgtcg gtctttgatg gcaacagagc aatcccacaa caagagcaag ccgtgcctca     22440
     acgccgtcgt aaccaaatcc aagtctcgga tccaccgcat ggagaatctc tcctctcgcg     22500
     tgcaattcca taacccaatc ggccaagaag aatgtccctg agtcagtcgg tcttctcccg     22560
     gagactatct ctaataacaa aacgccaaac gcaaaaacat cagacgcaga cgaagatttg     22620
     ccgttgcgtg ctagctctgg tgccatgtac ccaattgtgc ccacgactac ggtcgtgttc     22680
     gattgcgatc cgcgttcgta aagcctcgcg agtccaaaat ctcccaacct aggattcata     22740
     tcgtcctcaa tcaaaacgtt gctaggtttt atgtctctgt gaatcacaac cttttcccat     22800
     tcttcatgga gatacaacaa accagacgcg attcctttag caatcttaaa acgtgcgttc     22860
     cacgacaaaa caacaccgct ctgtcttggt ctactgtaga gcagcgagtc taagcttccg     22920
     ttagggatat aatcataaat taacaagaga tcgttttttt gcttgcacca tccttgaagg     22980
     ttgaccagat tcttatgcct taatctcccc aaactctcga tctctgcgat gaattctcga     23040
     acaccttgca tactattcgg agttatcttc ttcacggcga tttgatcaga cgaaggtgac     23100
     gataagtttc ctcggaaaac ggttccaaat cctccagttc cgacaatcct attctccttg     23160
     aatccatccg tagcagcgta gagatcttta tatctaagtc tatgaggatg attgatttcc     23220
     cagtcttcaa gaacctctcc ttgttgcaat cgtttcttgt acatcacgaa aaagaagagt     23280
     aacgcaagca agatcactgt tactcccgat agagctacga tcagagcgag tacttgagaa     23340
     ttgtaacctc tcttcttcgc cgtgttcgga ggcggacgag gaagttccaa gaggtcaagc     23400
     gtatcttcag ttagaagatc accgccgcta gaaaaactcc agcccatgac gtagtgagca     23460
     ctcgactgat ctctccctgt agctgctgtg aatccaacat acatttcttc ttgcacgatt     23520
     tgcgacaact ttggaacagg tcgcgagatc aaaggcctta cgggtctaga cttcaagtta     23580
     gccgggtaga cagttaagtt tagcgtttga gttggcccat cgtaatccaa aattgctcgg     23640
     attggatcgc cactctgtag tgggaaatcc tctttccggt taggatcttc gttgtcgtaa     23700
     tacacgaccg gttcttggac atcagatgtt aaactgttga aattcagacc gatgtgattg     23760
     cctgttctat cggcaccgtc tttaaaacct tgcactgtgt cgaattccac agcaaaaacg     23820
     tgattcgtcg aattcccgtc gtttgctttg ttgagaagtc ccaagtactg tgcggattcg     23880
     gctccggtac gatcaggggt tggagatagc gtgaaggtga agccaaaacc tccgttgcta     23940
     gagcttgtag ggatgatgac aaatacgaag gaagtgctaa aagaacggat tgtggagttt     24000
     gtggaacttg tattagtctc cagcaatctc acaggtttgt ggtagaaaga tgtaccggta     24060
     acgtttgagt ttcggtcagt gagcctcaat agtccgtcga gtttgatcgt cgcagctccc     24120
     gttgtcacaa tatttgattg gtttccgcta aaacctcgga aaataaactc tgtttttgga     24180
     gtctccgttg ttgttctttg agctcgagta gggatggtca aaagcaagaa gagcacgagc     24240
     ataaatgaga ttatggatct tgcagtaccc attaatgatc ggtacattag aaacatacaa     24300
     aagaaaaaca gagagaaggc gttttggaaa agataacaag aataatttaa ggattagaga     24360
     agttgttata aggagggaga ctgaagaaag aagaatttat aagttttaaa ctagaaattg     24420
     cgtatgttct tcccctttga aaactggttc acattagcgc gagtattgaa caaatatata     24480
     tatatgaaac tccaatgctt tgtggtcaat ttaatatttg gaagaaaaaa agttaaaata     24540
     attgacaaat atatattgat tgtcaaccaa gaaagaaatt tcaatatttt aaagttgtgg     24600
     ctaggaccaa aatactatca tttgtcatct gttagttata agatatcaat gatttggttg     24660
     tttaagatga tttttctaat cgattttttt tttttaaaag aataataata tctctgtttc     24720
     tgtttctttg taatcgattt ctaatctagt gttattcaat cgattattat tttgttgttt     24780
     tacttgaaac atgtatcatt gatgattttc aacaacaaat tacattttaa ttttatttag     24840
     ctagtgactt tgaaatacaa gtatgcaaac taaatatgta acaaatttac atatttatgg     24900
     ggttaaaatg caaagccata ttaagatatt tacaaatttc aaaatataaa aaatgatcta     24960
     aatttcatgt tatcttttat gctggaaact aacttttttt attttttttt tcttttctca     25020
     aaagtcctac gcatatatgt agtctgtctt tgacaaattc cacatcgttc tttgaatatg     25080
     cagatatttt atagtttgta gggacaaaaa caaaaataat ttgactttga acaaggacat     25140
     tgtgtgattt aaactctaaa atataatata taatattggt gattagattg agttccgaac     25200
     ttatacgact gcagtaactt tttttccttt atacaataat gattaatcta ccaatgatta     25260
     gtagtaatat catatgttta ctttaatcac tttttcacat ttgccagaag aaacaacctt     25320
     ttatggttac gccatgtggg tctcttgtta gttgttacta ccgcatataa ttattatatt     25380
     taaataagca tttattacga aatctgatct gataagtgct gcaaattcct tgattcgaat     25440
     tgtcacatga cacatactaa atccttatca gtatgacttt gtaaatgttg tcctagtttc     25500
     aatatttctc ttttgcgtat ttatttaccc atgatgatcc ttaatgatgt agtattggaa     25560
     ctatagaaga tcacgtcatg tggtcgcgtg agatttgaaa tacgtggctc aaccctatcc     25620
     gatttttaaa actaaaccat gtttttacat agttgttgat tgtcaatccg gtccgatttc     25680
     aaatggctgg gctttaaact aattgttgga cacgagacaa agaacccaat gggccgagcc     25740
     caatttttaa acacagttcc aaaacttgaa ttatagttta gtgagaaaaa aaagagttaa     25800
     tgcgagcttt gaatgtgtca atcgaatctt atctaccact gattaaagaa gttgaagaaa     25860
     ttctggtgag agacgaagat gtgtgtgagt gtgagctcga agccctatcc gacgaaatgt     25920
     atccgacgag tttcgatcct aaatctgttc ttgaagaatc tgaatatccc caattgtcgt     25980
     gaatctcagg aacatcttcg tctctgttca ggtacctgag caccattctc atcagcggcc     26040
     gagattccgg tttgtggtga caacagagca aaccgacggc gagagctagc cttgcctctc     26100
     cttcgtcgta accagatccg agtctcgggt cgatcgcact gaggatctca ccgctcgctt     26160
     gtagctccat aacccagtcg gctataaaga aggtcccaga gtccgtcggt ttcctcccgg     26220
     agacgatctc taacagcaaa acgccaaacg cgaaaacgtc ggaagctgat gaggagtttc     26280
     cgttgcgggc tagctccggc gccatatatc caatcgtgcc gacgactacg gtggtgcacg     26340
     attgagatcc gcgttcgtaa agcctcgcga gtccaaagtc tcccaatcta ggattcatat     26400
     cggagtcaat cagaacattg ctaggtttca cgtctctgtg aatcacgatc tgttcccatt     26460
     cttcgtggag atacaacaaa ccagacgcga ttcctttagc gatttgaaaa cgcgcgttcc     26520
     acgacaaaac ggctccgctt cttctcggtt tactgtaaag cagcgagtcc aagcttccgt     26580
     tgggaatata atcgtagatc aacaagagat cgtttctgtg tttacaccat ccttggaggt     26640
     tcaccagatt cttatgcctt aatctcccca aactctcaat ctccgcgaca aattctcgaa     26700
     caccttgcat gctatttggg gttatcttct tcactgcgat ttgatcagac gatgatctga     26760
     tgtttcctct gtaaacaatt ccgaatcctc cggttccgac aaccctattc tccttgaatc     26820
     cctcagtagc cttgtagagg tctctgtatc gaaatctgtg aggatgatcg atttcccaat     26880
     cttctagaat ctcttcttgc tgcattcgtt ttttgtacat catgaagagg aacagcaaca     26940
     ccaacatgat cgatataaca gtcgataaag ccacgataag agcgatgacc ttaccattgt     27000
     aacctctctt cttcgcctta ttcggaggcg gaggaggaag ttgggagatg tcgagcatag     27060
     ctgcaagtgg atgttctcca ccgcttgcga aactccaacc catgacgtaa tgagcactcg     27120
     attgtccgtg tctcccagtc gctgctgtga atccgacgaa catttcgtct acgacaatat     27180
     ctgacagttt tggaacctct cgtgagatca aggggattct tggtttatat cccaatctgg     27240
     ttgggtaaac agtgaggtta agcgttttgg ttggtccgtg ataatccaag aagacttgga     27300
     ttggctcgcc gctcaccagt tggaattcct ctttctgact atcgttgttg ttgaagtaag     27360
     ccactggttc ttggacatct gaagagagac tgttgaaatt tagaccgatg tggttgccta     27420
     ttcgatttgt tccgtctttg aatccttgta ccgtatcgaa ctccacagcg aaaacgtgat     27480
     tgctcgaatt cccgtcgttt ctttcgttga gaagccccat gtactgctcg ggatccgcat     27540
     ctgtacggtt tggggttgga gagagtgtga atgtgaagcc gaaacctccg ttgcttgttg     27600
     agcttgaagg gattatgaag atgaaagaag tgctaaagga acgaaccgtc gtattggtgg     27660
     agttactgtc gagcaatctc accggtttat ggtagaaagc ggtaccaaca acgtccgagt     27720
     ttcgatcggt gagcctcaaa agtccgttgg atgtgatggt tgaatctcct tgcatatgaa     27780
     tttctgattg gtttcctttg aaaccgtgga aaatgaactc tgttgtcgtc tctgttgttg     27840
     ctacatgagc tctaacaagg aagagcacca acaagagaga gaccatggat tttgctctgc     27900
     ccataagtga tcgataggga taagagggat aaccaaaaac aaaattgagg taggaaagtg     27960
     aaacaaaaac agaaataacg gctttgggag atgacaacag aagatgattc ttagaaggag     28020
     aagtgagttt ggtttctctt acagattgtc gatgatcgag atgaagaagc aaagaagaca     28080
     gagagagaaa aaaaatgtca acaacttcct aacttgcagg tttttgataa atagtaaaat     28140
     gatacattgt aggatgctct ataattaagg gaaagtatct tttattgtta taaagtccaa     28200
     atggaagtag catagatagg gctgactttg acaaagtcca aattaacttg gaatttcctg     28260
     atactttaca cattgggtgt gaaagaaagg agacgagata ttaaataagt catttggact     28320
     gaggacattg tgcgacttca actatcaaag atcaaataag atctttggag aggggattaa     28380
     gtgagtcaca atgcttatag taacatagta acatgagtgc agtaagtttt cgaatttcaa     28440
     cgcgctttat tttcatagtt tagtttgttt gactgtcttt tatataatcc cccacatgca     28500
     atatgtttgt ttgactgtca tttatataat ccctcacatg caatatgtta gttaatgatc     28560
     taagcattgc tcgtgagatc aaaacgagtt catcgactcg attagtaaga gaaaaagtcg     28620
     ttgtggattt gacttggtag aagtacatgt agcatactag catttgttcg ttgttgattt     28680
     attttattac agtacaacgc cttagcatta aagcatacaa gatcacgtca cgtgagatgg     28740
     cgtaactagg ggatgccaga taaatataat gtctgaatgt caggtcagct tcatttaatt     28800
     ggttatgggc ttttttctaa atcattcatt cacgaggtga aataagccca atgggctgat     28860
     cccacgtttg aaatagttta tactttctca aattaaatcg gtccgttaaa gttaaaccaa     28920
     atctagataa tttttccctc tgattttgaa tttttctgac ggtttgggga tattagcgca     28980
     gaattggagc taggttagtg gattgttcat tgtccggtgt cggagatgag agatcagtcg     29040
     aggaatttcg aaatggtaat ttcatgggga gatgaattga tccatgtttt ggatgatagg     29100
     aaaggatttg acgtgttggt acaaactctc gagcaactga gagctattcc attctcctgc     29160
     gacgaagatt ttaaagagat acatgaatct ctccaaggtt gaatgccttc ttaaattggg     29220
     ttgatgtgtg tttgattaag tggtgaattt aattttgttg cgcagatttg cagaagaaac     29280
     tcgatgtttg caaggagaag acagatgagg caaattcaga gattgcggat gaagaagaaa     29340
     ttgagcgtct tcagaaagag cttgatgaag agctagaact agagtgcaag ctgaaggagg     29400
     agcttagata cgtatttcac tgaactgagc ttaaacatct cgtccgttga ttcaatgtca     29460
     tgactaattt tggtttttgt cgacacattc atagctgatg aactcaaaga cctgaattct     29520
     caggaggcat tatttgaaga gcacagatta gctataaaga ggaacaagcg ggaccagttg     29580
     agaaccgagt aagattttga cgaatccgct ttttagtctt ttttgggctt catatttccg     29640
     tctttatgtt gtttgaatgt tcatatttac ttgttagatt taacaagtag tgattttgct     29700
     tatgctctat tttttgttct ttgcaggaca aagcttccta tgtatgcttc tgtcactcga     29760
     gttataccaa acattgatga ttcattgaag acctcaggct gtatcctttt gctttaaaca     29820
     aatttctatc tactttgtga actttctaaa tttaaatctc gttcaacctt gtcctaaggg     29880
     tttttaatcc ttaatacgac agatatggtt ggtcgagaca aaaggctaat ggacaagttc     29940
     gaattcgatt caaacaagag tacttctgtc tacgagacat gtaatggtat ttgggatatt     30000
     ataaacaggc aatagacagc cttaacaacc aaaccgcctt tgtttatgat tcgttagatg     30060
     taaaaagctt catggcctct gtactatgaa caatatctga tgttatgagt tccttttttg     30120
     ttcttgttga atacctctct gtaggtatca gtgcttaact tttttttttt ttttatctac     30180
     tgtaaccttt agcctccaaa atcttcagaa acatatctaa atattggatg ttgaaaaaga     30240
     atgcatctta tatttatcta tttgtgcaga ttgttgcaaa tccagtctta acgtgtagaa     30300
     cgaattggag aggagcaaat tctgactggt aagcagtttc tgatttccca tacatttcag     30360
     tgcattgaat tatcttagga attctaagga taattcctaa ggatttttga ttcaaatctt     30420
     agtgattgga atagcaaact tggggactgt tacttagctt ctccactgaa ctattggacc     30480
     tgcttagtgt ctccaccgaa ctgttgagga tcctgcacgc ttctggtact tggttacttc     30540
     cataagcatt gcatacatac atgacaaagt tctggtagtt ctgttcacca aagacatata     30600
     aatgaaaagt tttctttctc ctttgatctt gaaagttatt agcttaattt ataggactaa     30660
     cctcttgaag tggtaggtta ttcacaacca cccatggtac aaatctatgt gctggataaa     30720
     gttcagaagt ttcttcagca tacctctgtt caagctgcac attgtcacat agatgtcatt     30780
     ttttcttgct tattatatgt ttagctttcc tgttgtggct gtataagtta actaatgttc     30840
     tctcctctga gcaggattta cctggtttcc gtatccgtta atgtaacaat caaccgctgc     30900
     tctgctcaat ccaaccattt ctaaacaatc agcccatttt tcaagtttgt tctccaagac     30960
     tagctgttcc gtacagtaga tgtatccaaa atgcttcatc tgcaagtgac ataggcagag     31020
     cacatataat tcacattaac agtcaaagcc tctatatggt aatcttactg cataaatcca     31080
     agaagatttt ggtagctttt accgtttaag agacttacca catcagggta tgcgtttatt     31140
     gcacaggcat gaattgcgtt gagcgcacac tcagcttctc cgtgctgaaa acaaagcaac     31200
     agtcaaatgc tatgtcctaa ttctatgatg tacaatgcaa gtgagacata gcaagaagag     31260
     tccaagacct ggcagagaat ggttccatct ggtctgatag cggcgttgcc ccatggaacg     31320
     agctggagat caatggatga gattaagccg gtttcgaaga tcttaggcaa gcggttgacg     31380
     atgaattctg cacagaaggg gcatagagct tcgtagtata aacttagtgt aactttctgg     31440
     cttgaagaca gagataagag gcagaagaag attgtgcaac ttgtgatgca aagcctctga     31500
     tatgatgcca ttggtggaaa caagaagaag aggaagattg cagagaattg tttttgactc     31560
     ttgctttatt cttgtgtctc attaaacaag gaaagtaaga cataaaactg tttcttatta     31620
     ctttcagtga ttcgttgatg ctttattatt gtttaaaggc atcttgggcg ttttggcgtt     31680
     gaaacaattg ttgcggcgtt gtttgattta actgaaaacg gcacgtagtt agttttcgga     31740
     atatcaaaac gacatgatgt ttaatcgctg ggttgggtca gtcacacttc gtcttccaca     31800
     tctaatccac ctgagcttac tgagtcggaa caacatcagc caataaagcc ctgaacccta     31860
     attttctttt ggctttggct ggagaacgac tgtatgtgtg ttcaacaatg tcgtcgatga     31920
     acttcaatcc atttcaaaac tggttcgaga aaccaccgaa cccagtcccg tccatcaact     31980
     tcgtctcgct cgctgattcc ttctttccca agtcgcagtc tccgaatttc gcttcgattg     32040
     gacttccaaa attctcaaag aagtccccaa aacccgaaac agcaggaacc gacgaaccag     32100
     gaccgtacaa gcaaatagca gagcagttct tatgggagtg tgagaacata ccggattaca     32160
     ggcacactcc agaagtggat aagcttctca acgaagatcc agttttcgag aagaaggaga     32220
     atccgagcac agaagagatt gaagctgagc agaaatggtg ggagagtttt cgagcgagtc     32280
     ctgtggttca gtttatgact cgcgccgagg agattgccga cgatatgaac aagatggagc     32340
     tcgaggataa cgacacgcct tatcggaaag aagacaagga ttactggaga gccattcctc     32400
     atgtcccggg ctttgacggg aggcccatgc ctaggaaggc gatcaaatca aaggaagaga     32460
     gtgatgataa gttttgggat ttcatgaaac agtttctctt cggcctctgg ggtttccgtc     32520
     aacgtcctta cccgcctggt cgacccattg atgtggctca ggctattggt tacaaacggc     32580
     tcgagaagcg ctattatgac tgtaagtgcc ttcgtttgct taaccatagt gtgatatctt     32640
     ggtgaaatga ttttgactct cccatgtcat gatgtttctg aatcgttaag ggagcatatt     32700
     caagtgtttc tggatcgtta agacattacc gggttgcttc atattgatgt tgtttctgtg     32760
     tttgtgggat ttgatccata ttctgtgttt atgagttagt aggtggctat catgattcag     32820
     tgagaggctc tggattccaa gctcttgttg ttcttaatgt tgttaaattg tatagtcata     32880
     gtttcttgtc tatgcgcgag tttatatggt tccacatttt atcttgttta tgttctgcat     32940
     gaaggtccaa gcttgtgcct gttgttgaat tgcaggaata tgatgaaagt ggtatgcttt     33000
     tttgtgggtt cctttgtgtt ggatcataac cttttgtttg ttctcctatg atttaaaatt     33060
     gtagtcataa tgaagactgg tggttggtgg tataaagacc gacttggccg ttctagaggc     33120
     ccttgtgaga ttataaccct taagacggct tatggagctg gaataattga cagagatact     33180
     ttcatttggg gcgaggacat ggatgaatgg gcgcctattc acatggttta cggtttggaa     33240
     cctgcaattg caacttggga aggtctgtct atgggataat ttgaaatctc ggatgaatct     33300
     gatcattgaa gaattacaat tttgcctcct atatatatga cttcattgtt ggttttattg     33360
     gctcgtttct ttcttgttca gtgaggcttg gtgcagcggc aacggctttc ctacacaaac     33420
     tccagaaggg aattccaccg tgggttccat taaagggacg agagccaaaa acatacaagc     33480
     agcttcaaaa agaagctatt gagagtaaga aacgcgacat ggcagtgctt gaagcaaatg     33540
     gtggcgtttg gcctggagtc agaactccca gccacgctct gtttctctgg gccagtgggt     33600
     ctgagttaac aactgtactg gaatctgatc acatgccgac aagttcatcc caaacaacta     33660
     cggtattaaa ctaaaggccc tttatacacc attgactgtt tagccgcaat tggatttgat     33720
     tcttctctcg aaacatgtgc ttttgattgt agactagagt tggccaaagt aataccaggg     33780
     ttaaggccat gggaagtgat aagtatcgag caagctatgg atcagatcag ctatggtgga     33840
     gagtggtacc gtgagccgct tggtacctac accactggtc ctccttatat cagagagtgg     33900
     aataggagtg tcatggtaag tttcctctcc tttcttctga tttcacaaac aacaaacttt     33960
     taaacactca ctgtatcttt gtgataaatt gattcatctt ttctcttccg tttcttgctt     34020
     tctgtttgca gaggctattc cggattttct acaacctgag tgttcgagta ggccagaagc     34080
     tggagaggac agtcccgggt tttgacacta taatggacaa agttcagaaa gattatgaca     34140
     aaaggattgc tcggaggatg aagcggagag aggaggagct gagagaagag gacctgaagc     34200
     attattccgg ccgtaccgat gaagatgagg aggaggaaga ggaggaggac gacgatagca     34260
     actccaaaaa agattgaagc aaagtcttca ccaggtggat gacaacaagc aaaacatcct     34320
     gttgtttatg aattcttcgc cagcaatgtc ggtgtgtggt tgatctggtt atcgcattta     34380
     ggtacacacc acatggtttt gggcgtctcc tgtaacatgg tttgtttgtt ttctacctgt     34440
     tttaaaccaa cgttcgacat tgagagttta tcagaaaaag aggaactgtt tcattaaata     34500
     ttctatgggc ttacatgggc ttatgaattt atctcgacag acattaaata ttctataaat     34560
     gggcctcagt ttgtaaggcc taactatagc ttttgcgtaa caacataccc gacccggttt     34620
     gtagtgtacc gaaatgttaa gtggcgatac tcgattggtg cccttcgcta caaaattggg     34680
     atttgttttt gtccattttc ggtttcggtt ccctgagagt cccggaagct cagtggtcgg     34740
     agtgtcggcg ttcaatttct cgatgactaa taaccctcaa attgtggtta gtttttctct     34800
     ccgtctctct caatttcatc gtccttgtcc aattttaagc acttgtggtg tcgatttcca     34860
     tatctgttct ctgctagggt tttagctgga gtctgagcta ttttgaaact tgttgtttat     34920
     ggattccaaa ttggttgcgt tatcttagag gatactatct tattagaatg cgtatttctc     34980
     tagattagat gcatggtgct ataacattcg ggattatttg acatttcctt gcttttgatc     35040
     agagcattac tactgtgata agtgttcttg ttagggtcat acaagtatcc aatcttgatt     35100
     gttcccgtgc gagggacttc ttcgtcatta tacaaataag attctcaatc tttacttaat     35160
     gcttagtggt ttgaagaacc atgatgaaaa gataaatcac taagggagaa tctgtacatg     35220
     aaaagcttaa tggtgttttc atacgtcatg aacttcttat ggatactcat tttcgtacat     35280
     ttgtcagctc tttgtagaac agacaggtct ttgtttggtt agaaatgatt ttctactgtt     35340
     caacatggaa tcaaagtaag agcatctctt ttgctttgat gtgacagtga tcttgttctt     35400
     gtttgctgtt cagttatatc ccagtgacca gcttgtcctt ctcggtggaa agtgacatac     35460
     gcttcatgct tcttttacat gttcttcata aacaggttcg ttatgcttac tctttcaagt     35520
     tggatcataa atattctatg tttaattaga taggtctgag ttttcactat tttcttagtt     35580
     acgcattgtt tggccgtagg tttatagcta gttagaatat actaaaacaa aaacttcatt     35640
     gattaagctt acgaagttat tacaaaaacc atcttgaaca caaagcttac tactacaatc     35700
     ttattagtcc ataatgttca atctaaagct tttacagaat cttcgggttc ttctgtttta     35760
     accccaacat tggtcatctg aaagtgaact tatagaggtc caagtctagt tcagaagcat     35820
     ctggtcgaaa tgccaaactc ctgcaaagac agaacaaatg taaataagct tttagaaata     35880
     ccattcaagt ctgagaacac tatctcaata tagggttttg attcgtaccg tggcctttgc     35940
     cgatcatcct tagctgggtg atgtagtctg agatcttctt gattgcttca atctagaaat     36000
     agtccataat atattctgag tcagaacatg tacagattat acaagtcact agttgtaatc     36060
     cgaacaaagg caaaagaact tttacctgct ctcccagaaa ttcactctca acgaaatcag     36120
     ctaactgggg atcattgttc tctgaggcca cctgttttgt tggccaaaag tacgtgttag     36180
     ttagtattag gaaaatgact ataagtttaa tctttgatga tcaaatggat aagttaggga     36240
     acttactttg tgaacgttta gaagcttctc attagtgagt ttctctagag acagagccaa     36300
     ctccattgct gaaaacaaag attagtaaac taataaatat ctgtatcttt aaaaaaaaag     36360
     aaaagttgtt attttaggat taagatagtg tatttgctta aagttttacc atataaagca     36420
     tctccttttt cagcatgttc gaattctgag ataggtgaga cgatagggtg gagtttcact     36480
     cttcctcctc tttggttctg tatagagaca acaaaccaac aatatgaata ttaactaagt     36540
     gaatcacaag tctttatcaa cttttctaaa acagaaaaga aggtaaaaat agaaaacctg     36600
     gtactccata aacttctcag catgccctct ctcttcctca cttgattcct tgaaaaatct     36660
     ggtgattata aaaactcatg tttagtatgg acatatatat ctcattttga agtatacgat     36720
     caagattatt ataaataaga ttaagattag agttagaagg taataattac ttggctagtc     36780
     ccttcatagc aacgttgtct ctgtcaaagt atgcgtacat tgaatggtac acataggaga     36840
     cgttgtattc cacactgtaa atagaaagca acctcctccg ttagatctaa tctttaaaca     36900
     ttttcgtttc tttaattaga cagaaaagaa aagagaagct tacttgattt gctcattaat     36960
     gactgcctcg ctagcgtcgg caaacctctg gcgagcgaga gaggcatgag atgtgattgg     37020
     aatggccaga tcggctttct tcacctcttc gaaaggctgg aacacgactc cggtcatcgg     37080
     catgttgttt gtgtccaccg tagccgctgc aacgaccact gctctgccgc cgccaacttt     37140
     cctggagaag ccgagagaaa ccgacggaga agcagagccg tgagggagta gtggcttagg     37200
     agacagagcg ggattagcgg cggtgaaaga cgagagtgcg tttgaggcca tcgttggaaa     37260
     atgtagaaga ggatagtgtt gagccgcctg agatttgttg taagagatgg tgatgatgat     37320
     aagaaagagg aaggaggaag ggtttatata agagggaaaa ggcgtgtggt caccgttgga     37380
     ttgagatcca cgtggagggt ggatatgaaa gccagatgta ggggcgtgtg gcggcctcgt     37440
     gctacatcca atgggatagt gtgaacgtga ggatattcga tccacgttaa catctctcca     37500
     aataaagttt gtctgtttct ctgctttctc ttttatcctc agaatctttt taccatttcc     37560
     ggttcctact ctcgcgttgc cactttctta tttcctactc gctctctcct atttttcgaa     37620
     atgtattttt tagagttgta gatgataaca aatacaattg tttactataa aaaaaaaaaa     37680
     agaaaagatg atagcgtttc caacataagt tagacgtgta aaatcctgtg acacatattg     37740
     acataggaaa tcggatagag ataaaagtat ttccatattg tttttataaa aaatcatcaa     37800
     gctactagaa cataagattg agaatggtcc aaacccttta agactttccg tattatgtgg     37860
     cctaatattc ataatttaca acaaagaagg aaaaattcgt ggctctctag gatatttgat     37920
     ggagacggaa aactgatata caattataca taggatagag tcgcgagtag ctcaactcca     37980
     cgtaatttcc agctaaagcg cgtgagaggt tccaaatggt tccttgtctt tatcggagac     38040
     aattacacgt cggagtaagt acattgtggg cctcattagt aatgtcacgg cccaagttaa     38100
     aaaatcatat caaatggttt ttctaaaaag ttgtaatgtt ggcaaggaca aaaattaagc     38160
     attaaataaa gtgtagttag gcttggtttt attttattgg cttgatttga atcgattcgt     38220
     attactctgg aatgcacaaa gacaagggta ggctataaaa gtgttaaaga gcttaataat     38280
     attttcgact gtaattacaa atttagctga ggttcgtcta atagacaagt aaaatcatgg     38340
     gaggaatggc aaaaaaaaag gattgattgt agtctttaat tttactctgt tttgtgccat     38400
     gtggttcttc agttcccaag ttgtgttgca cctatttaat ctgattttca ttgaaggccc     38460
     aatagataga tagtcagtcc caaggaggag tgataggcaa gtactttttt ttgtaatttg     38520
     tacagtataa tgctgcctgc ttgcttcaat aaatatattg gtgtttatgt atttgccaca     38580
     tgtcataagt taattggctg caggaatagt gcacaaataa cgaatccaac ggtgcgagag     38640
     tggtgggttc ccaaaattct ttcccggaag aaaaagaaag aaagtcgtcc ttcgttttct     38700
     caaaatcttc tctatccttt ctcgagagaa tatggatcag atcttcaaca aggttggatc     38760
     ctactggtta ggccaaaagg ctaacaagca gtttgactcc gtcggcaacg atctcaacgt     38820
     acgtcttttt ttgacccatc ctatagaatc tgattcatct gttttcctaa tcgattttga     38880
     tctattgacg tggttccgat ataatcaacc acctttatcg taattttggt atcatgcagt     38940
     tgtacgaatg ttttgagttc attgttaggt aaatcacgtc acataaggaa gaacatctaa     39000
     ttaccaaaac catgatatct taagaaatga ttcaaatata tgatcctata atgtcttctc     39060
     ttcttgctca tgtggttaga ttattttgtt tgaaactgtg atcttttcta acatataaaa     39120
     caatgttttt gtttatgcca gtcggtgtca acgagcattg aaggaggaac aaaatggttg     39180
     gtcaacaaaa tcaaaggttt gctttttttt attcttcttc tgactgcatc tttcaatttt     39240
     ttgttttttt gaaattcccc atttgtcatc atgttgacag ggaaaatgca gaagccgttg     39300
     cctgagttac taaaagaata tgatttgccg attggaatct tcccgggaga tgctacaaac     39360
     tacgagttcg atgaagagac aaagaaacta accgttttga tcccatcgat atgcgaagtt     39420
     ggatacaagg attcatcagt gttgaagttc acaacaacag taacaggaca tcttgagaaa     39480
     ggaaagctaa cagatgtgga aggaatcaag acaaaagtaa tgatatgggt aaaagtgaca     39540
     agcatatcta cagatgcatc aaaggtctat ttcactgcag gaatgaagaa gagcagaagc     39600
     agagatgctt atgaggttca aagaaatggt ctccgagtcg ataaattcta acacctgtct     39660
     gtgttctgtc tggttccaaa gtttcaagct tttccattta cgttttggtt ttgatttaaa     39720
     gcctcctact gtgagtatac atcaacttat ttataaatct gatcataact tcaatatggc     39780
     cggagcaatt ctactttgtt cttttttttt tccaattgta aagaactact attcgtgtgc     39840
     tcaatgattt ggtcttacaa ttttttactt gggttaattt atgttctctc atatattcaa     39900
     aatgaatttg acactcacac caaaaaaagt agaagcatga gatgataatc attttgatgt     39960
     acatttaaag aggtaactaa aggtgtttaa aaaagttttt gtacataagt taaaagaatt     40020
     gattatgata agcctaaaat atggaacatt attactctac ttttggctta acagcattta     40080
     taatagtcag atttgagaat aaatcacact cgcaattgaa gcgtgtttga tctcacatgc     40140
     ccaaaagaat ccatccattt ttctttgcaa aaaactgaat taaaaagaag aaaaaaggag     40200
     aagtgtgaaa ttttttaaaa gaaagaaaca aaaggattta ttaaaaaaaa aaaaaaagag     40260
     atgaagacag ctcgagggat gcaatagagc caagaggagg agaaagatgg gatctggtaa     40320
     acaaaacacg tcaaagtcaa attacaaatt tatattttat aaaacagata acaacaacaa     40380
     attaaacttt tattaatctc tctctgcctc tactcactgg atcatcatag ctccaaactt     40440
     gtaccagtcg catcaaagca agttttggtg aagaagaaga gacgaggtct tcctcttact     40500
     gtggtggtga cattttctct aaaaagaaag tctccgatat gtcgcagaga tggagtagaa     40560
     agaagagtag acttccatta gcgggtctcc tctttattct cgttgtcacc tttatgattc     40620
     tcttcaacga gcgtagcatt cagcagatcc atcaccacgc cgcgagtcac actcaaaatc     40680
     tccgagaacc ttccacgttc gatttcgtca agcctaatgt tcctcggatt aactacttgg     40740
     gagctcatgg tactgttctg atttgatttt ttttttccga ttttgaagtg attcgtgcta     40800
     ctttctctgc tgaaagcatc acgaacttac taattggagg attctgtttt gaaaaaaatg     40860
     cagaggtttt ggatagattc agcaaatgca actcgacgaa agagtacagt gggaagaaaa     40920
     tcggatgggt tgacccgttt gaagaccacc cgggtcaagt aacaaaggag gagcagaaat     40980
     gtgatgtctt ttctgggaaa tgggtctttg ataattcatc atcataccct ttacacaagg     41040
     aatctcagtg tccttacatg tccgaccagt tggcttgtca gaagcatggt aggaaggatt     41100
     tggagtatca gcattggaga tggcaacctc atgcctgcaa cttgaagagg taaaaaaact     41160
     tatgctgctt gtttcatttt tccaagtttt tctgtaagag ttatgtgtgt tgtggataac     41220
     tgatttgatc aaatggagaa catatggatg aatagtttgt tatgactttg ggagctacta     41280
     ttgtttgcaa agaacggtag aaactgatga tttaggtgtt tactgtggtt atcattttat     41340
     ctggtagatg gaatgcgata gaaatgtggg agaagctgag aggaaagaga ttgatgtttg     41400
     ttggagactc gttaaacaga ggccaatgga tttcaatggt ttgtctctta cagtctgtca     41460
     ttccacgtga caagcagtct atgtctccta acgctcacct caccattttc agggctgagg     41520
     taataaatac actctgagtt taacaacttt tatgccttga gtttgactct ttgttgtggt     41580
     tttggtgcaa ttggttactt tggtgtgtat gtacccgcag gactacaatg ccacagtgga     41640
     gtttctctgg gcaccgttgc tcgtggagtc gaattctgat gaccctgtta atcacagatt     41700
     gagcgagcgg attatccgac ccgattctgt tcttaaacat gcatcaaagt ggcaacatgc     41760
     tgatattcta atcttcaaca cctacttatg gtggagacaa gactctgtca agctccggta     41820
     attatatata gacatcattt tattcatctt caaaaccaaa aattaacaat tggtactcat     41880
     tgcatattcg aactaaagat ggagcagtga agaaaaaggg tcatgcgagg aggtgaagag     41940
     cgccgaggga atggagatgg caatggatag ttggggtgat tgggttgcta acaatgtcga     42000
     tccaaacaaa aagcgagttt tcttcgttac aatgtctcct acacatcaat ggtaacaaaa     42060
     atacttatcc cctgttctcc atcaatatga ttgattctac tctctttatt attttcgcat     42120
     taaaaccgag ctgttgtaac tggtcaggag ccgagaatgg aacccgggaa gcgaaggaaa     42180
     ctgctacggg gagaagaaac caatagagga agagagttat tggggaagtg ggtcggacat     42240
     tccgacaatg aggatggtga agagagtttt ggagagattg ggaccaaagg tctcagttat     42300
     aaacatcact cagttgtctg agtatcgaaa agatggtcat ccatcggtgt accggaaatt     42360
     ctgggaacct ctaaatgaag accggttgaa aaacccggca tcgtattctg actgtactca     42420
     ttggtgtgta cctggagttc ctgatgtctg gaatcaattg cttttccatt ttttgtgaaa     42480
     atgaaatgaa tataacctta ccttgatggc cgaatatcac ccataaatta tataacgggg     42540
     tgattttagc tagctataag gatccaaatt tgttacatcc cttgcctata gtcaggcgtc     42600
     atgagcttaa cttagcaaaa tgtaaagatt ttttattttg tacgaaattg atgtagcaaa     42660
     atgggcttta atagatacaa tcagcagagg gctagattta taaacaaaaa cttaagagaa     42720
     atggtgttgt gaaaaaaaaa aaaaaaagag aagaggtggt gtatgattta tcttcagcat     42780
     gaaggtgatt tacaagcacc gattataaat aggactcttt gccgaagttc atggatgacc     42840
     tgaaaattga gcaaaccaag aaggcttaat acaatagaac aatctttttg aaccgaatac     42900
     ttatagaaag aggaagtcga cgagaacgaa cggatttgga agaatagagc ttagcccatg     42960
     tttggatatg ggcactgcgg gttttaaggt gagaagagta ggcagcttct gcgtttatga     43020
     agtagactga gttctctgtt gtctcagcaa cccacatttc gtttgtcgca tcctttgctc     43080
     ttttaattag attgcaaaat ccgacctgcc aaaaattaag cccacaaagc atatattttt     43140
     caaacaataa tttctcggtg catattctct cagtgtaaaa ctagacaaat attagaattt     43200
     gtacatacca cggatccaac caaattatgg ctgatgtggg aaacagagct atcatccatg     43260
     aatggggtgc tgaagcttat agcaagaaga ctgtttgaga tttcccctga atgttgtgtg     43320
     gatccatctg tcacaaacac ccactgcttc ttttgtagaa catctgtgta tgcatctcca     43380
     acatatacaa cgtacgcagc gatatcaaat tcactgaagg acataattag agatgataga     43440
     gtatagatta gcaaagtgcg gtaaatagtg ttttataaaa agcttggact actgagatta     43500
     accttgacag aggaatttca ccaagatttg acaaagagat tggtttacga gggttgaaaa     43560
     aaggcctgaa aacatcatca gggaaattga acaaattaat gagatagatt ccagtgtcta     43620
     ctaaagaaaa ccacttactg aaaattttca gaatcttttg gagacaaagg ctgccatctt     43680
     gagcttgacc ctctggcatg taagtaaagt gtttctgaat ctgagttcat tggtactagc     43740
     cctttcatta tgtatatttt cccctccgtc agctcggttc tctgtcacag tagtagacaa     43800
     tgataactgt tttaagaatc tacaagaaaa aagttgaaca agctaatcga tgatgctctt     43860
     aatgcaacag tacagtgatg gtaacgattt tttgatatgc atttcagtcc attcgaggtc     43920
     cacagcaact ctgacgagct tatatttgga actccccgtt ccatataagc tcatatggat     43980
     aaggttcgtg taaacttata agccattaga aaaatgcctt cttttaaatt gtgcatgaaa     44040
     cattcagatt taggcatttg aatgtacctg tctctccgtg ggatcccaga ttgttacaat     44100
     gccttctttt ggattgtgct ctccttcatt acttaagctc gtcaggccaa caagcctaat     44160
     cctcatgaat ggggtgacgt tcctttcacc taaaccagcg tcttccagag cttttgccac     44220
     tgatttttcc atctgcattt gcttggctgc ctgaggttca gattgaagca gttaattact     44280
     gtaatcaata tatcaagaaa agggaattac tattctacct caaattttgc tttatatgta     44340
     gtgaaagatg tcaactgctc taggctcatt tcagccataa gaagttcagg ttcagcagcc     44400
     gtctctaaca gcttaaagac cttggctcct tcttcgctgt cagtatcgtt ttggctgtga     44460
     acaccattaa ttcctctctg gtactcacac ataataccct caacaagagc tgagcgccta     44520
     cggaaaatag aaaaagaaag aaagaaaagt acgaatgaga ataaaccatg aggaactgca     44580
     atctttggct cttctgttgg caaaaccatc catattcaga aggccagaag cttttctaat     44640
     aaatacaaag attctttgtc tgtcccaaaa actacttaga accctaatat tggtgtatgt     44700
     aacaaatgtc tctagctttg atgagttaat ctgacacttc ttagaaagtg atgtgctaaa     44760
     ttgatcacat aaatgttact aaaaattgct actctacagt tataaggaaa cttgcctctg     44820
     attatgcagc tgtataattc tactttctat tctctctgat cgaactattg acttcttttc     44880
     acctaacctg tatacatcaa gaaaatataa tgctttgcga gaagtataag gaagaccaaa     44940
     gtgcattaac aggcacacat ttatattgac ctttccttgt ataggatggg gtatattcgt     45000
     gtgatgccag ctagcgtttt aggcactgga cccccattgc acttgataca gttgaaagcc     45060
     agagggacac caatttcttt accttgagga agagattaag aacgatcaat agaaagataa     45120
     taatatgaaa gcaataagaa ctcagatgat gtagtgaggt ccacagcata aagctactta     45180
     cagaagccta gtcggtccgc ccagtgagct ctgtatgtcc cattaatatt caacaacaaa     45240
     cagattgtac ttgaaatcac tgcctgaaag tttggttgaa cgaaactcta agaacaaacc     45300
     aacctgagaa gatatcagaa aatcttataa aatgcaaagt ctaggaaacc tcaagtggtg     45360
     atgttggggt agcccagcca gaaagtcctg ccccgaggat cttcagataa gagataagaa     45420
     cgtaagcatg ctgcaagtca gtgatctaac caaaatctgt gttgcaaaac aaagtatatc     45480
     ttgcatgaat ataacttact cgaagcttct gccccacaaa caatttgcca gcattcagct     45540
     gcttggttag cacgacatcc agagcagcat tcatcgagta cctgtgattt aaaaaaaaat     45600
     cctatggaaa tgagacaaga aaacaggtaa cagaacagca gtagcaattt cataccaccc     45660
     atcagtgagt tcgactttca cattgctgca attatcagaa caatgtgctt cctgagaacc     45720
     attatcggtc cttggattaa tagctgatat gcagaggacc atcattgaag aagctggagc     45780
     atcaccactc agaatcctct tgattgcaga gcaatgacca tgattgacct ctctctcata     45840
     tctattaaga agattaacca tgttagactt tgcatgagtt taagtaacga gttgtgttgt     45900
     gagactggga aacctgtatt ttagttcctc aagaacattg gtgattgtta gaaagtttcc     45960
     tctgcatttg gctgggtagt atatgtcgta gcatgcaagt ttccagacta tccacctgta     46020
     gtgattagta acccacctag tgcatatgta gtgatagata agttaataga tatagacatc     46080
     aaactgtcta tctaatagag tgacaatcac atgcaagctt caaacgaaca gtcacacact     46140
     ttttctgata taataaacat ataacacggt taacatttca agggacagag aaagtacttt     46200
     ctggatgcat gttgtaagga agcacccgac tcagccaaca tttgaagaaa agtttcagct     46260
     ccaaccttgt ttgaagaaga ctcatcacag aatacatatt tatctgcatt acttgatttg     46320
     attcttctga catggtctgg cacataatcc atctaaaacc acctcgtaaa tgtgtttgag     46380
     tgaatgaaga aaaaatttat gtaacgcagg aacaggtgaa agggacaaaa agattttacc     46440
     ctggtcgtag ctgtcggatg cattccaaaa aactccttga tatatactct tggagacttt     46500
     tctggatatc ttgtagaaag tacctttttg gaagtaagtg tatcacacga tacaacagac     46560
     aaacctgata atagacagga caccaaaatt ataaatctga gaaccaacca attagattaa     46620
     caaaaaatta aaattaaaat taatcgtata tattaccact tgaagcttgc tgagcatttt     46680
     tctttaaagg agttttaaag gatgaaatcc ttggcctttt gaaaggagaa acggagactg     46740
     tctttcccag ccttttcttt tgggtactgt cttgtttatt gtttgcataa gctgtatctc     46800
     tgcgatttgt tatatcaaca agtggctgat cagcaggcct tccaagttgc ctagctcttg     46860
     gaatgaaacc gtttcccttg gaattattca ctgccatatc tgatgctaaa ggcctgttat     46920
     ttgatagtcc atgtgtagca ggtttactga tattcagagc acaattggtc tcatcaacag     46980
     ccgtatcaaa tttcttgatc aaattacccc ctgaagctag gttctccaag ttaactgatc     47040
     taaattgctt tgaagatgaa tgaagaggag atacaaaact atttgacgta tgtttgttgc     47100
     ttgtcttttc ttcatgagca atataacctg tgttgacact tccattgttt atagcaatat     47160
     cacttagcct ttcatctttc tgtggtgtaa aaaattgatc acctccagct acatcatcaa     47220
     agaaagaccc taactcaggg tcaccaagaa ggtttctggc acgtttcaac gcctcagctg     47280
     acactgacaa tgattttcca ccagcagtct gaaactttgt tggaggcacc tttaacgatg     47340
     gatttaagat ttcagatctc ttcccagata cataattctc atattgtcct ggagttcctg     47400
     aatgatgctt aaccactgta gcatcaaact cctcatgagt ttttaaaccg gaccacccat     47460
     gttgctggag ggaagaagac gactggttca catggttaaa tccattcaaa tcatcttctt     47520
     ctagtcctaa caatgccttg gctcttgcta aaccggcaga agatacatta acctttttgt     47580
     tggaagctgt ctgaaaaaga ctgttgggaa caccaaaccc actctccctg ggaagaacgt     47640
     tgtctacaca atcaaaaaga atcttattaa caaataaact atgaaaaaat gtcacttcta     47700
     atatttattc tctaaacgaa gtaagatgtg tgttgattag ttcttcacta ttcatcgttt     47760
     tatctgataa caaccaaact caagaaacct ggaagttgaa cggagtagca gcacaaacaa     47820
     caagttcata tgtaaatgcg cacacagctg gatataagac ttaaaaaaag aggagataag     47880
     aacacacctg agtcaattat catatcactt cctagaatag acaaaggttt ggcaattgaa     47940
     gactctttca aagggacagt tttccccaag gccgtcctga acattggcat agtttcagct     48000
     gtatccactt gtctcgtttg gggaattgag caatttgtgt tctgcaaatc taaaagtgta     48060
     gccaagaaca tggaacattc aaaagatttt caggaacaca tattcaccaa cattaagtaa     48120
     caattcaagc gaattcagaa acaaatgact agtcaaggga attcaatact gtcacataaa     48180
     atacctgaat aagcaacatt ctctgctaaa atggatttgg ctttagcaat cgaagactct     48240
     ttaagaacta cagacttccc cagcccagtc ctgaacattg ggatttcccc aggcatcgat     48300
     tcttcccgtt ctataagctt cgagcatcct tgaagcatca aataataatt caatctcctt     48360
     tgagtcacat gacaaacacg attcgacaaa gaaaaggaag atacgaagaa tcaccttgga     48420
     gcaagagatc ggccatggaa ggtagaggag ctgtcgattc gagcgccttg gttggcgtag     48480
     aatccgagac ggactgaaga atccggccag cgacttccca ccggaaacca tcgccgctgg     48540
     aatcggaaaa taaatgccac gtcgacattt attcagttct agggtttcca agttttccga     48600
     ttcgtcgtta tatgattcag ccggagaact aaacctcgcg attcagaatt gcctaccacg     48660
     ccaagaggga ggagtcggga gtgcggaatt tttattttta ttgttttatt ttctttcccc     48720
     aaaccaaaat catcaccaaa aatccaaaaa gttaaaagtt ctgacaaagg cgggaaagtt     48780
     gaaaaagatt tgggccgaaa ttatgagacg cgtggtttta ttttaacttt gggcttggtt     48840
     tttacggaca tagcgttcca agacaagtgt gatattgcca cggcctttta ttgcggtaac     48900
     taacggcacg aatgctaacc cgaaatcgtt ccaaacaata attgcttacg tggacatttt     48960
     aaaacatctg ttcaatgtga ttggtgactg acttcaatga aaattacatt gcaacaatgg     49020
     tcaagtatca cagaaaatta cattgcaaca atctccacct tcaaatctct aaacacgcca     49080
     gattctgaga actataattt acacggggga agccgctgag gaggcagagg gtgctacaga     49140
     ggggatcgcg ggaacaccga tgaatgagag gaatccggag gcggcatgat cttgttcgtc     49200
     gaggaagaga tcatcgggag ctctaaaggc gccatggaca cagattgttg ctattccgat     49260
     catgagagcg gatatcaata cagatccgac gcttgtgaag aagatcactg cgatcgtgga     49320
     gaggattagg ccaccgagag tttcgtattc ggagaaagat cggccgaaga ggataagagg     49380
     acgatctgat ggacggaaga ggtagaggaa gagccaggaa gcggcgagac ataggaggag     49440
     gatgagagag aatgggtggg cgagaagaga gaaaccaagg atcagagcga caatgcaaac     49500
     gtaattcacc ctgaaataag aggaattttt ccggaatcgc gtcccggcct cggagagaga     49560
     gtcaggcttt gtgaaagcgg atcgatcgag gagctctgac cacggacggc tacgagatag     49620
     accaccacag accgtctcgg tcacaccgtt gacaaatgca cggacgactg gaggttgcga     49680
     ttccaccaca gcggttacaa tcggaggctg attggtggtg tctgttgcgg tggtggaaat     49740
     tggaagaaca gggggatttg ttgacaccat tcgattttgt tcttttggga ttttgagatt     49800
     ggaaaatttt aggagacgaa tgatttagag gttgctgaag ttgcggtagt gttatgtata     49860
     tataggatca caattacgcg tctttcaact ttgattatac accttgcttc atctgatagc     49920
     taatctatat tcatttgcta aaataaaaat aaaaataacc tcctgatatt ataactcagg     49980
     ttattttttt gcttaacgta gtttatacaa taattcttga ttacttaggc aaagtgcatt     50040
     tgaccattaa tgttccagtc acaggaagtt tccctaatag aaaatatttt taacacaatg     50100
     ttgatctgtc atatggagta gtagacttga caatgtcaaa tccttttttc tttgataaca     50160
     ttcatcttcg aattctaaac ataattatat ctaacgagta gacaaagact aaataaccat     50220
     tgtttaccct gatagtaagt tgtagcatca tatatagcat aaatgttatt tcttaatgca     50280
     actccatcaa accttagata tgtttacaat acgaagtagt tcaaagttac ttgatcgatg     50340
     agagtagatc atacatttca agacaatcac actaatcacc taccacggaa ttaaagagtc     50400
     gccccgttcc aaccaaagaa ggatccctgc aagaagaacc acacgagaaa agaaatgtat     50460
     aattgatata tcaggtggtt ataggcataa acactccaga tgatggatga ccctctaagc     50520
     cagttagaca acggatttag agaagttgaa cgaatctcct aaataactca acagtgtggg     50580
     tgtaaagatt gaattcgagt agtggaacgg tttatgcatt tgatttaatt gtttataatg     50640
     cctagtttat gagtaaaagt tataggtccg tcttatgatg atgaacttac acacataaga     50700
     tgtatttgtt ccctattcat gacctagtag tgctggtgta aagcgtgtaa acattgtgca     50760
     tattcttgac tttgatggtc ctagagagac aacgaacaat gaaaatgaga catggacgca     50820
     tatcgggcat atgaaatcat taacacattt gcatatgtta tgtcactaca tcaaaaaagt     50880
     tatcagagag agggaattgc ttgccttggt gtcataaaac ttgaggaaga atcgagactt     50940
     gggcaccgat agcttagtct caagaatggc ggaaacagca gcgcttagct tcttgttcac     51000
     atccgcatta aggccaccga tagaaactaa ttcaccataa gctgcaggat cctcggtccc     51060
     gccaaatgac ataggcactg agcctttcaa gacaatcatc acatactgca aattaccaca     51120
     atgaacaatg caatcagata atgatctaag aaacaacatt acaggacaaa aatatttaaa     51180
     catcactaac ataaacaagc aatcgtcaaa gcagaccaat attgtttttg aaaacaaact     51240
     tcagcaatga gaaattcaag ggccaggaat ggcctagaaa tcgtggtaaa ataaaaaaga     51300
     agaaccccaa cgaagattgt acaaataagt caagagaaga ctccggaaat gtgaaccact     51360
     agaatagaac ggagcaacga gataaaattg cttagggttt ctatatcatg catgtgaaga     51420
     aaacaacact cgaatcgctg ttattcaata aggagaagaa aatgattaag agataaagac     51480
     gcacacaagg caaatctcag gagaaaacga agaatcgaaa caaaattcga acagaacgaa     51540
     acgaactaga ggttaaatcg agagagaaaa agggattacg ttctcaggct tgccgatgat     51600
     tttcgcgacg gtggaggaag cttccgagag aatggaagat gtatcgacgc cgtcaaggtt     51660
     aacgttggtg gagaggttga ggcacggcat tttcttcttc ttcttcgtct ctatcactcg     51720
     acgccaattt tttttagtca agcggataaa gagagtaaga ccacccagga attttcccct     51780
     tttatcctta aacctttttt attcgcttag gcccaagccc atcgttttta cgtttgcatt     51840
     ctcgtttcga agattctttc aaacgctctg atgaagtgat tttggattat tttgtttaga     51900
     aatgggcctt aatctagtta taaaagcccg ctcaaatttg agtgcccagg aacgtttata     51960
     aaatagatct ctcgacctag acccgaacgc acctaattgg ttagatgttt ttttgtactt     52020
     ttttatagca aatcgatatt tccattttgc ttctacttca tagagggaaa ctctttcccc     52080
     aaaatcaaaa ctcctaaagg cttatctctg tctctcatga cttggccacc aaaaaaacaa     52140
     cagcttcaaa gtttccccat ttacaaagcc accgcagata gaaagcaacg cctaccgatc     52200
     gaggaagaag gcacgttttt ccacccttca ccttccttaa aacactcaac ctgcaaacac     52260
     acacatgatc aaagattaaa ccgtgtctgc ttatgtaaat tgttttaatt tcatttcaag     52320
     ttcagaactg atcctacagt gtctaatatg tcatcctctt cccctttgta tcctccgatc     52380
     acatatattg agtctttaac cactgccact gctgaatatc ctcttaaatc cttcattggt     52440
     tctcccgtca tccatgtccc tgtccttggc tcatatatct caacactcga taccattgtc     52500
     tcaccatcaa acccaccaat cgcatatctg caatagtgca tatgaataca accttaaaac     52560
     tcttacccaa aatttgtctg ttagttactc tcaaagaaga agaaaaatgg ggagaagaaa     52620
     cttacagttt ttcattcaga acaacaagag aatggcagcc tcttctcgac ttcatcgatg     52680
     caatattcat ccaggagtgc tctctaggat caaacctttc agctgtgctg ttaaaagtaa     52740
     gtttccaata aattgttctt gttagcttca catgtgtcaa gattagggga aaaaatagaa     52800
     cacaaggctt aaatgttctt acttcaggta ctctttacca tcataaccac cgacagcata     52860
     aattgaactt ttatgctcca cggacgcaac tgcaaatctc tgagatcaaa gagcagtgac     52920
     aactcagaga ataaagccga ggagaaggtc atggtatcat cttgctaagg cttataacca     52980
     gtaggtgagt ggaagcataa actacatttc tattgttaac ctgacactcc ttacttgaaa     53040
     ttataactta gcgaaataga gtagttttaa caatggattc tctttgggaa tttatgtttt     53100
     tagctgtgag cttctgtcaa aaatttccca gtggggatct aattgacaac ttttcagatt     53160
     tttggctttc accatatgtc atgcgaatag agaagaacgt ttacctcctg ccccattgac     53220
     cttgttctga tccatctccc tatatctgga tcaagcatct caacatctga aaaagatacc     53280
     atcccattcc cacctccgat tgcaaatatt tttccatcca aagtggctcc acctaaactt     53340
     ccttttcgct cgtttaaggg ggggcacaag ctccactggc catcagtctg gttaaaggat     53400
     tcagcttcac agaaaaaaga agaggcaaaa cagaaatcaa agatcaggct taaataatta     53460
     tggttagaga gaaaaagaag tgtgaagtgg tagacattaa cttaaaatat gcacagccga     53520
     agtgaagtgc actaaattaa tacacctcac ttcacaattt gctaaaaata ctagagccat     53580
     ttggtttagt aatataatga aagtcacagt agtatgcttt tgccacccat attccgtttt     53640
     ctagttcttt tagttgtctg ttaagaatat ctggaaggtt tataggttta tatatgtatt     53700
     gtatacaggc tctaatgcac taaatagtta actcatttta agaacaagag aaaaagagag     53760
     gccgtacctg agttggtcca gccacggcca ccgtcatcac ctccaaagac gtaaatttta     53820
     ccatccaact ttgccactga tgcatttgaa cggatacagc tcattgaact atgagccttt     53880
     acaacattcc tggatggaaa atatgactgc actgatgaca accatgtttc agagtcttta     53940
     tcaaatcccc ctaaaagaag aattgcctca gttggatcta agctggtatc atctggtgaa     54000
     tggatctcca aatcactgcc accagctttg gtgattaaag gacctgatat ggactccagc     54060
     atgttgcaac gctctgtcaa ttgataaatt tccttgtgtg ctttgtcctg aaataccaaa     54120
     tatcgaaaag taaaagtgtt atggtttctc caccactata ttttgagctt attggttcca     54180
     aaaacaaggg aaaatgatac cgagatgaac ccctagctga aaatgataga ggatcattat     54240
     cactgatata atgaatatct gtgtgggtgt ggtcatatta cacatgcaaa cagaattcca     54300
     gcaggaagaa tgaaaatcaa aatagcaata aacaaaatct taccagcttc tcttccaagt     54360
     aacatatctt ggttgaattt tccagcccgc atgccctgag ttccttcacc tcatgcatca     54420
     actgcaaaat atttagccaa tatgatccca ttgattttga tacacccaag agacatgata     54480
     atcttccgag aaggaattac aagtctcaat taactataga tcatagtctt tggaagagaa     54540
     gcaagctgac atggaacagt ttcttcttaa ctattcctgc aatattatag ctaatacaca     54600
     gagttctaca cagttaataa ttgacagctc agatgggtat aagtagaagg ggggaacaga     54660
     cgtgaggttg cctaaaactt cgatattttg gctgagaaaa ttgggggttc tgtttgtcgt     54720
     tcgttctgag aagaaataaa ggggaaagtg ttgactctaa cagatttaca catagacttg     54780
     tataggaagt aacagttaaa gtattagaaa tggagaccta gtttgaataa ataccaacca     54840
     tgtgtagata ccaacgtacc tggcttattg tatgtggaag aggagaggat acaagacaac     54900
     tgccatctat tttcccctct gaacatgttt cctcttcaag tgtatctctg tcttccaagt     54960
     tcttgcaggt gggaatgttg gcttgttcaa cagtttcagt tagactgttg tctccatgct     55020
     catcatgact aaagacgaga tccttcagtt tctcaagaac atgatcctta tctatttgtt     55080
     tggggttctg tacgtctgga tggttctcag agaaaccagg atgagaagca gcagcagagg     55140
     agtcagattc tccgccagaa ctgagtgaca cttccaagct acccactggt tcattctcag     55200
     aaggcttaac ctcatcactg ttctctttct tttcacttga tgaaatcaag cgaaagatct     55260
     gtcttgtgtt tggtgtattc atgggtggtt taggtttcac agcaaaagat gttagcagac     55320
     atgtcaactt ccttgtttgg aaatgatcaa gctcaaacca aaaatggtga gaactgtagt     55380
     aattatctgc aattgcaggt ttgaattttt cctcggaaag tggttcacac tgtaacctaa     55440
     cactgattgg aacctgcgaa accgtaaaag accactgctt atttcatgaa atttatactg     55500
     cttatggaaa aggttggcaa gggataatgc ctcctgaaaa ccatatgtaa tccaatgaac     55560
     tcatagaaac acatattcat gaaagtgatc aaatgtcact ctggtacctg tgcaggatat     55620
     gaggttctct cagaaccatc agaggtccag ccataagggt caaaattgag ctgaccacaa     55680
     ccagcagcct caaaaatgcc atgaagtgta cgatcagaat agttgaaaag aaacaatggc     55740
     aaaccaatat caatcttctg cacgtatgga tagtggttag agggtaaacc tgtcaaaacc     55800
     atcagcggat tcaagaagca tatacataca aacattgcga aatagagttt agaaacaaaa     55860
     aaatgcaaca gcatacgaca atgagcaagc aaagaatcaa agtagacagc aaacaaacag     55920
     ctacattcag cagaagcaaa aacaagcatg ggaaaagaat aagctattca agaagactca     55980
     ccaaacaact gtttcgacat acattctttg atggtattct tagtgcagcc aaagacaaca     56040
     ccacctagtt gacttttcgt caggtttctg aaggaaaact ttcccctcct ttgagccatc     56100
     ctgacattga ttgggtaaaa ggaaagaata tcaaaggatt tacagtgtaa caacaaatcc     56160
     agtccttcca atgattgaaa cgggtcttat tgctcaagca tgtaatcaag acagacacag     56220
     tctccagatt tttcgtacgg ttttactaac tagacaacag aaggatgaaa accttcaaac     56280
     acatggtgtg cattattaag acactcaaga ggtagcttat gaggcagcca ttgatgtgaa     56340
     attacaaaat cacgaagaaa ttcacatgat gaaatacgaa acacaaatgt atacaatttt     56400
     cagtcagcta acgaacaagg ccatataact taacacacaa aaacccaacc aggagcgaaa     56460
     tcaacaaaca gataattctg aaacaaaagc gcagagcaga gtttccaaat cagtaaacaa     56520
     cgaaattcca accttacatc tcaactcctc gtgaaatcga aacacgataa gaaccatgcg     56580
     atgacaaaac cctaggaaaa taagcaaaag gcaacgactg aaacctaaat gctcacttaa     56640
     actggaatcg gagcttgatc aacagagaag ttgagtgaga gcggtgaaaa atcgaagaag     56700
     acgaggtctc agagagaaag agagagagag ggagaagaag cttaggccat catgactgat     56760
     ggcaatgcaa aagacgatga caaagccgga ggagcgacgg aaactgagcg acggaatttt     56820
     tagagccttt taagctgcaa attttaaata taccttcttc ttcttctttt ttttcaattt     56880
     cttctgcttt ctaatataca actttctcct ttttactttt tctacggtaa attttgaaag     56940
     aaattagaca ttagtcaaac tgtttacaag tatttccttc tgcggaaaaa tagacatcga     57000
     tgcaaaatat ttttaaaaaa tatatatcta ttaatttatc atttttaaga aaaaattatc     57060
     ctttgcatat aaaatgcgcg taacaatgaa tttcctcgat gaatttgaag aaaaacaata     57120
     attggtcata ttaaaagaaa aagaagaagt aaatataata ttatctataa aaaatcatgt     57180
     gttgtcaaat catgcaatga aaacatgaat acaataacac aattcaatat accttttagc     57240
     atataggcat ggtcataaac taattaataa gaatattgtt tcttttgttg ataaaatatt     57300
     gtttgtctcc gaagaaatat atgtagggag atattaagtt attatgattg tttctaatga     57360
     agtgagacat taagacttat tactaatagt agctaactta aatggaaaaa tgtaaaccgt     57420
     gaaaactata atacttctat caaacaaatg aaaaaggaga cacatcttcc tcttttatac     57480
     ttttaccctt tttagatttt attagatgtg gacatgcaat gttgcataag ccaaacagta     57540
     aaagttgtac taaacattat ataaatgctc aactaaacaa agagaaacag acattataat     57600
     aatcgctagt tttgtactta agtgtggttg cgtgatagaa atatttgttt tatagccatg     57660
     gtacgtatta cctaagtacg taggatcgta aatgggttga gagaatgaat gttcttgatc     57720
     ccattttctt atgacagtat tttgatttgg gtgatttgca gatataacat tttttcacta     57780
     aataattaac taactaacac cataaatttg taaatgtaat aaataacctt caaggggtgt     57840
     gaaaagacat cactgtcctg gtgttacgtt tgtcagcgag gaaggaaaat gtggtgacgt     57900
     ggctttatta ttagtgttga ggtgagaaaa gaaatcaggt ggtatgagag aagttccttt     57960
     ttctctttct tttttcttta ccccttccca attgtaattc atattatcta atctttaaaa     58020
     aattaattca agttcatgat atatcaatta aaaagttgta tagttttcta catatatcat     58080
     gacttaaatt ttttaaaaca gacacaaaat aatttagatg tgaatagtgt tgtcaatgaa     58140
     taacataacg ttctgtatag atacacaata tttttttatg gaaagatatt aaaccctaag     58200
     ggataatata tagggaaccc aagggtttaa atctaaacca ataattaaat cacttaacat     58260
     ccttaatcaa aacaaataat tcattttaaa acgtatataa aacaaggtat acgtaaatag     58320
     tatatttaca aatagaatag tatctctcaa cttgcaacaa caaaactcaa tttcataacc     58380
     aagacaccaa gcgcaacaac gaaagtcgat tccctgaatc caaattgtgt tcctctctct     58440
     gtaattcgaa acccccaaat caaatctcac ccaaaagtaa ttaagagact ctgatttgaa     58500
     aacaaaaaca agtaacgatg taggtgtgag gactttactg gggagaaaga gagggggagg     58560
     gaaaaagaaa gagagagaaa gagagagggg gagagagaga aagagagaag ggagagagaa     58620
     cggaagagag aggtacacat aaagagagat gagagaaata gatagagggg taaacttgga     58680
     attaatatac aaaatataga ggatatcatt tttttctttt tttaatgtta gtttcttaat     58740
     tataaacttt ttgttggtta gttttgccaa ttcccctttt gattttatga aaatagggtt     58800
     ttctcaataa ttaagttggt atcatgagta aaaaatcatt tcaagcataa acaatcttaa     58860
     actcttaaat tgtttacgac taaagctttt tttgttttcg taaacacatc agatttatca     58920
     caagatgcaa ccaaaagatt tgccaaatcc tcaaaaaaaa aaatcgatca aagcgtttgc     58980
     gttttttctt ttcttttatt ttttttaatg aaaaataatg aagaaaacaa tttcatgcaa     59040
     taattacgtt ggaagccttt ttgggctcga aattcgaatg ctttatctat gatgggattg     59100
     caagaatttt ttattaaaaa aaaaaagtta tggcgtttcg gttaaactca gaaactctaa     59160
     tcgagttaga aaactcacga tcgagttttg gagctttggt taggattgaa ctacaccagt     59220
     tattgcaaac tccgaaaaga aatcaaggtc cgcataacca cgaaccaaac aagaccggaa     59280
     ttaaatcccc aaaagattaa atgttccaat ttggaccggt ccacagaaac acaaaaccag     59340
     gaccggacca agcaaataac aaaagataaa attggtcaac gaaaagtcag ctataatctc     59400
     tgctctccac aacaaattaa caatgaagct agaggtgtgt gggagaatgg gttggcacac     59460
     acgggtcaca gtttcacaga cacgcggctc ctcgatggtt gtcttccgcc gacagccgcc     59520
     gcgtgtatgt ccttcccata cggaatctgc cacgttgcgt ttgtataatc tgcctgacta     59580
     gggctttagc agtgtataag agacgagacg agacgcgatt caccggagag tcaaagaggc     59640
     aaggaggaga aagccaatgg cacatgccac gtttacgtcg gaagggcaga atatggagtc     59700
     gtttcgactc ttgagtggcc acaaaatccc agccgttgga ctcggcacgt ggcgatctgg     59760
     gtctcaagcc gcccacgccg ttgtcactgc aatcgtcgag gtgattcgtc tttacaagaa     59820
     tcagtatttc tttttcctga ttccttcaaa ccatagtttt ggttcatttt ttggctcaat     59880
     tttgttttca gctttcatta acacagagct ttacttgtta ttgaccagta attactctcc     59940
     cattgaattt gcagggtggc tataggcaca tagatacagc ttgggagtat ggtgatcaga     60000
     gagaggtttc tttctctatc tctctttgtt acttactact actactactt gttttgtctg     60060
     aaagttttga gtttagaggt aaacaagtct tactcttttt taaggtcggt caaggaataa     60120
     agagggcgat gcacgctggc cttgaaagga gggacctctt tgtgacctcg aagctttggt     60180
     acacattaat tttaagaaaa atgattaatt tatcatcgcc actgatgaat gttttggttg     60240
     gtacatgttt aaacaaaagg tgcactgagt tatctcctga gagagtgcgt cctgctctgc     60300
     aaaacaccct taaagagctt caattagagt accttgatct ctacttggta agttgtgaat     60360
     caagttttag tctttcttgt tactcttctt cctctcttta caattcaatt ttctgcagat     60420
     tcactggcct atccggctaa gagaaggagc cagtaagcca ccaaaggcag gggacgttct     60480
     tgactttgac atggaaggag tttggagaga aatggagaat ctttccaagg acagtctcgt     60540
     caggaatatc ggtgtctgta actttacagt cactaagctc aataagctgc taggatttgc     60600
     tgaactgatc cctgccgttt gccaggtata ggttcttcat ttcacatgtg aaagttcatt     60660
     gaaaaacttt tgtagtgagt ttgttagctt ggccctcaga tggaaatgca tcctggttgg     60720
     agaaacgata ggatactcga attctgcaag aagaatgaga tccatgttac tgtgagtact     60780
     aatatgattc ttgatccatt gtatctggaa aaatattcac tgtttcaatt ggaactttga     60840
     aggcctattc tccattggga tctcaagaag gcgggagaga tctgatacac gatcagacgg     60900
     tggataggat agcgaagaag ctgaataaga caccgggaca gattctagtg aaatggggtt     60960
     tgcagagagg aacaagtgtc atccctaagt cattgaatcc agagaggatc aaagagaaca     61020
     tcaaagtgtt tgattgggtg atccctgaac aagacttcca agctctcaac agcatcactg     61080
     accaggtaaa cttaccaaac taccaaccag aatctctaga tgatctttta caacgagagt     61140
     aaattgcttg ctatgatgaa atcgcggtta ctgctttaat gggacagtca ttttatttta     61200
     gttaggaatc accgttattt ctgttagtga gaaacagagc acttgttagt cttctctgct     61260
     tcctgagttc ttgttatagt agtaactagt gaggaacagg acagagtaag gaaacagagc     61320
     acttctttat cttctgagtt tgttagagaa aactaacaat attttcagct tattcatttg     61380
     atccaaatgt tcacactttg ggtcttattt ggccctgatg cagaaacgag tgatagacgg     61440
     tgaggatctt ttcgtcaaca agaccgaagg tccattccgt agtgtggctg atctatggga     61500
     ccatgaagac taaaccgaac ccgagaatca aacataacta tgtaaggaat gtgtttgttg     61560
     taacttgtaa gatatcaaat gtacattttc tgaaaataaa agaaagcagt ctcccgtata     61620
     acctaaaaac tgtatacaaa tgctctatgc cattaaacct cctcgacgac agaggagagt     61680
     tgttgttgta cggccaaaac cgatgcagaa agcttgagat ccctggaaac gagcagatct     61740
     ccgatctctc caagctcctc gatctcactc cataccgata atccttgaag cacttcgaaa     61800
     cttttttcgt gtctgattcc aaccatgatc agatcgtaat tgttaccttc ctctctcagt     61860
     aggttcacca gatcactcgc ttcctttatc catacctaag accaaaatga acggttaaat     61920
     ctaatccgga tttgaaaacc ggagaaacgg agtcaagact tgtgtgttta cctctcgtaa     61980
     agcgacattg tgtttgttca tggtgtcttg acggaatttt tcgatggttc tgaaatcgag     62040
     tcttttctct acgacgtcgt ttaggtgtga gacgttttca ccgtcgacaa gtttaagaac     62100
     ggttaggttt acgtaaggtt ggtttgtcat tctaaccgca aaggccagtg tctcacggtc     62160
     gtctgctcca ccgaggaata ttgaacagat gttgattctc attgagccgt tcttcatcgc     62220
     cgttcccatg ttcttgaaat ctggaagccg tccttggtcc attagaaccg caacggagct     62280
     aggtgaggca ttccggacgt tgcgacagag ccttcgttct gctgcagtcc cgtcggccat     62340
     cccgaaaatg atgagatcgg tttctttttc gaaggccaag gcacatacat cctcgtgcat     62400
     cgtcttgctc ggtgcaactg ctgtgaaaca ttcaacggaa acgttttctt gcaaatcgtg     62460
     gccgcttcgg aatttctcga aggctttgga gatctgatct ctgcggctgg aagacgttga     62520
     tgactcgtcg ttgtgacctg gatggtgttg aatgaggaga gggacgttat tttgctcaag     62580
     ctcttcgaga ttaacggaaa cgatggagtg cgaagaggcg ctcgagggac aagtagagag     62640
     ctccaagacg gtgaggatgg gaggaacggt ttcacggtgg tagaaacaag tgaggatctt     62700
     gagaggtttg tttggttcgt agtgttgaac ggtttgtcgc cggtaagtga tgtgtttcct     62760
     ctgcacccac ccgtagagat ttttgacaat ggccgtgaaa atggtcgagt gaaccatggc     62820
     agagatcacc attatcccaa atgcctcgtg gcttatattc tgcatccctt aaaacaagta     62880
     gttaaaagtc aaaacactaa ttggcgatga atgatatttc atttgtacta aatcaatgtg     62940
     taccttgtag ttcaagagct gtttgaagat ttggacatcg tagatccctt gtatgcagac     63000
     gatgaagccg acaatcactg cgtgtgatat aggaacttgg aagtaaagcg atggaaggac     63060
     gatggaggca aactttgcag cactaatggt aaagataagg aactccaaag atatgatgtc     63120
     gcgtagattg aatgaaaaga aatccacttt gttaccaatc ccgatgacgt aacacggcat     63180
     aagaaccgca taacagaagc taccgatctt gtcagtgaga ccagtaccga aaggaggcgt     63240
     cttaggagtg acaagaccga gagccacgga tccgactacg taaggaaacc ctacagtttc     63300
     agacaggaaa gtggcggtgc acaacatgac gcaaatggtg catagatggg aagccttgag     63360
     tttctttcct tcaggggttc tcttcactat ccagttgaat attggtcggc acacaactac     63420
     tataccaacc agcagtagta cctttgtgaa ggtaggcaga taagtggtct tggagtaatt     63480
     ttgatgcaag aaactgtcaa aggtaatcaa aaggaggaaa aaaccccagc cgaagcagtt     63540
     agccaccatt atggaggaga gggctaacct tccgggctcc gagttcagca tcttgagatt     63600
     cgacaaaacc gaatacgcca cttgaaaata cactacggat tggtttgtta gtaaattgtg     63660
     gagctgctcg ggattatttt tcgccacggt tccacggatg ttgctcgtga ttactgtaca     63720
     tgctatggcg cccaccacgt aaggaaacag aaaaagagat aatccattga tgattgctag     63780
     cttgcctcct cgctttataa ctcccatgtc cacttgagcc gtgcttatgt atgagatgaa     63840
     catgaaggat attgcctcaa atgattctat tatgaaatag cttcttgtgt tgaataattt     63900
     ttttactaaa tcaatgtttt gtcccaaagc cgagggtcct aagaatatcc cagcctgttt     63960
     catatatacc aacaaaatat cacacttcta tagtttaaac ctttttttct ttgcgggaaa     64020
     tatagagaga tccaaaattt attaaaaaaa acgtagaaaa tggtatgata aagtgattac     64080
     ataccagaat ttgagtgacg aagtcgacat ttgcgagagg gcggagaaga gcttggaaga     64140
     cggaagagag agaagagacg agagaaatga gaagaagaag aagaggagtt gaatatttca     64200
     atggatcatc tcctctaagt aatccgccag agcttgatcc caaccatgcc tcgcatacaa     64260
     attcatgtgt gccattactt gtaacactat tgttcatctt gtttctcttt gggaatattt     64320
     tttcttctta aaactagtat tcacgttctt ctttataacc atttttgttt gtgtttttga     64380
     attcagcata acgctaacta attgagcaaa cagatcaagc ttgttgagct ggggaagaag     64440
     atacatgtat cttttttaag atattaaaca gtttttgttg ttttttcaag gattttgtgt     64500
     tgactttatt ataaccgtca gagaaaaata ggaaattata tatgtcatat ctcactttgg     64560
     cagatgtatt ttttggtatt ttacacattt tttttttatt atagttttat ttttttgttg     64620
     atcctgatct tttttaaatt aatacttata aggagtatta ctaggttgat tattaattaa     64680
     tctttttttg ttagggatct aacttcatgg atttagtagc taggttggtt attataacat     64740
     caacatgcaa aatatatatt acaaacacac atgtttgtgc aatcaatctc aggctataat     64800
     gatgatcatc tgaccatgct caagattttt gtaccacaca gaaaacatat atagaaaacc     64860
     ttaaaagtag gatgacctct aaagagaaat aaagaacaag aggataaaca acatgtacaa     64920
     ttaaacccct aaatatagct agagagagca gaaacaaaaa aaagaagaga ataattaata     64980
     ctttcttctt ttcttcaact cacaacacaa tctctctctt tccctctatg gcttgactct     65040
     ttaggggaaa tacctagcag gagggaatgg aaaatataac caaaactttt cagtacggag     65100
     gagttgattg gctttgcgag ccatgggtag gtgcaggctc tttggggatt ggccggggag     65160
     agaatccgct caagtttgct cttcctcttc ttctccttca gatttctgtc ttttccatat     65220
     tttccgtatc ttttcagttt cttcttcggc cttttggaaa atttgcattc ctcactcaga     65280
     tgctggtata cgtttccata tctaagcatc tataattgga agctttctag tggaaaaata     65340
     tggactagtc gtctcaaaaa catgtatagc catgcccata atggtgtaaa tgtgacttaa     65400
     tatttaatag tgaatttgtt tgcaggctgg gatctgctta ggaccgtccg ttataggacg     65460
     taacaaacag tacatggcta cattcttcta cgcgagaagc gtgtacataa tcgaatcctt     65520
     cgaggccata tgttttctct tcatttgcta catcacaaca tgtcaagtag acactaggat     65580
     gataaagaga gtaggcaagt tagcattcat aaacggcatc ttacttttcc tcataccttt     65640
     cgtatggggc caattcgcgg ccatcttgat ctccaagagg ctcaaaagcg ggcctgcggg     65700
     gatccctccc gtggagttcc accatgtagc gatcgtccag tccacaatgt tttttcaggt     65760
     ggtttacgga gtcttgtcga gcctaaagat gttgaacact gagccaggga ggttagcact     65820
     tgcatccatg atggtgcatg actgcctctc ttggtgtttt ttcatgctta acatcgccat     65880
     taaacttaat gttgacttac ccaataaaaa tcgcgctgct ttcttgtccg tcttacaggt     65940
     acccaagttg ataaataatt tcttaattaa tctacaaatt ttgctttgga acatcttcca     66000
     attttcttac tataaaaaca taattgactg tgtaaattcc tacaaaaata gacaaactaa     66060
     ctaagatcct aataaaatgc atgaatccaa taatatttac gtatagtata aacttgcttt     66120
     gatctatata tacgcttttt tattaatgat ataaagacgg aaatgaatgc agatgataat     66180
     gatattggtg atagcatatg tgttccgacc actaatgctg tggatgaaga atcgaacacc     66240
     agaaggacac tctctcaagg cctcctatct ctctgttata tgcgtcttgc tcttcatctc     66300
     ctgcctctgg gcagaatttg tgggtttacc ttacttcttt ggtgcggtcg tcttaggtct     66360
     agccacccca aaacgtccgc ctctaggcac gggactgtca gacaaaatcg gttgttttgt     66420
     ttggtctgtc ctgatgcctt gctacgtcat tgggattggc ctcaatatcg atctctcact     66480
     gttttcctgg agagatgtta tccggtttga gctacttttt ggggtggtca ggtttgccaa     66540
     aatgatagcc attgccttgc cttcccttta ctataaagtg cctctttggc acgccattct     66600
     tgtcgggttt atcgtcaata tacaaggact ttacgacgtt caaatataca aacagaattt     66660
     caattacacg gtaacaataa ttcatttagg atatactttg gaacatatat aattttaggt     66720
     caataacaat caataatggt caatgggtgc agaaaatatc aagcaaatct tttggagcaa     66780
     tggtgatgtc agcaacggta aactcgacaa ttttcatagt gatagtgaag aaactgtacc     66840
     aaaccatgag caaacgcaac ccttacaaga gacgtacggt gcaacactgc cgagtggagg     66900
     ctcccctaag gatcctcact tgtttccgga accgtgaggc ggtccgcccg gtgcttgacc     66960
     tcgtcgaact ctctcgtcca gccatcgggt ctcctctctc agtcttcgcg gtgaatctag     67020
     aagagcttaa taaccatagt cttcccctcc ttatccatca cacgcaagag attagtccct     67080
     tcctcgtgcc tagccgaagg gaccagatcg ttaaggcctt ccacaacttc gagaagacta     67140
     atcaggagac cgtgttgata gagtgcttca cggcagtggc accgcgaaag acgatgcacg     67200
     aggacgtgtg tgcgattgcc tttgaccagg aaacagatat tgtgatccta actcttgatg     67260
     ccgggatcga gttatgggag aggctcctgt gtcgtaatct cctgcacaac tgtccctgct     67320
     ctgttgcgct tttcatagac agaggaaggc tcccagattt caggttcgtt ccactgaaaa     67380
     agcttaccat caatattggt gctatcttct taggaggacc agatgaccgt gaaatgcttg     67440
     cgtatgcaac acgcttagcc agccatccaa gcgtcgagct ccaagtcttc cggctcgtgg     67500
     accagaacgg cgtctctccg ctcagagaca tggtcgagag gaatcacgac atgagagtca     67560
     tcaacgtctt ccgcaaagaa aattccgaga aaaacatcat cttcagagag gtaatgagaa     67620
     ctattttgcc ttggcttgga agctatctta tttcccctta gacgaaacct tctctatgca     67680
     acagaggttt ctattcggtt tagaaagttt cttgtgtaga cgaaacagag gtttttcttt     67740
     atctaaccta tcataatgtg ttcccctgtt tctaacattc ttaaaggtaa gaatagagga     67800
     agcagtgaat ctactggatc tactaaggaa ggaaggggac gacttcgatc tgatgatggt     67860
     cgggataaga cacgaagaaa atcttttgat gttggaagga ttgtcagaat ggagcgatat     67920
     gaaggagtta ggagaggttg gagatgtgtt gatctccaaa gatctcgagc tctctgtttc     67980
     ggttctcgcc gtacagcaat gagattggtg accgtttatc tcgttttcgt tccccgagtt     68040
     tatggatttg tacagccttt tgtagaatat tgaatacaaa tttttttcta aaaaagttct     68100
     accattcaag aagatatctt gtttacttat atctttcaaa tcattccaga gcatgtgatc     68160
     accaatgaaa tttcaacaga gattaacaga ttgttcaatc atttggttta gttaagtact     68220
     taccatcttt actttttttt ttgtagctgt tcaggttaat gcatttgctg cacaaaaaga     68280
     acttatgaat cttgaacaac tgtgaggttg aaatttggat ttgcggaaaa gaagaccaag     68340
     tccattagtt tgtctactct ttttactttt taatagcttc aaaaaacaaa cagaacacaa     68400
     aattatttca cacacaaata aagttgatgt tgagtaatat cgacacctca acaggttcaa     68460
     attttactaa acagttagaa acaacaacag taacaattat cctactatga aaccctttgg     68520
     gatagaccca atggtgacaa tggtgcggct ccataacact cgttattgct cttatttgat     68580
     ctccaggaaa tagttgatat tgctcggctc acgtttcctt ctcttgggta aggccggtgg     68640
     tttaggtaaa gcaccaccac cgcacagtca tcagcttttg aggctggaaa ctttgttctc     68700
     caagtccgag cggctcgctg aaccaacatc tcagctgcaa ctgaccggtc cttgcaggaa     68760
     cctacaactt tcaccacttc ttcgtttgac aaaacatccc aaatctgttc atccaaagaa     68820
     cacgcagaaa ccatttagta gggaatccat ttgtcagaag actgaaagct gtacaagttg     68880
     tttaccccat cagtagctag aaccacaaac tcgtcttctc tgctgacttt tctgcagaag     68940
     acgtcaggaa tgcagacaag tccatagtct ttgaggcaga aatcaccaaa agcccttgac     69000
     attgcgagcc ccgggcaatc atcatcaggc atccacactc tatacacatc gggttcctct     69060
     tccatagcaa acacccttcc cttgcatgac actattctct ctgcttcgcc tgtttacaga     69120
     aatcaaagcg aaaagttctt caggagattt atttgtacgt cccaactcaa catttggtac     69180
     ttttcaaaga gttattactt attaggccct aagttaaaag aaaaggataa gatgctaacg     69240
     ttggacacag ggtttcagat caaccgtgag ttggacagct ttgaaactgt tcttgcttcg     69300
     ggtgccaaga acggctcgtg aatgtcccaa gttggcgatc accaaacagt cagcctgcaa     69360
     aatgtttgac aaaacatctt tcaatttttt ttgatcaact gtcttaaaaa actcataaag     69420
     ctttagagac tgctgattta cctgtttaaa gacagttaca gcagttgtac cgctgcaaaa     69480
     actatcataa ggagagtcga gaccaagttc actgtctatt tgcttgaaga atgtcactag     69540
     aatgtcctcg aattcacgga agagttcctc ctgactctgt gaactattat tctctatgtt     69600
     ttcatcgccg gcagatttgg aagatctaat ttttgaatgg accctcgaag gtaaattttc     69660
     acatacgtga cgagaaatct tgtgacccat gggaccgtga ccgtcaaata caccgcaaaa     69720
     gatcgtatct tcttccccac caaagttctg cagcaaaggt tatgatgcag atatgattgg     69780
     tcattgcctt aagagaggca gtagcaagat gtaaaaaccc atgtaataaa gattaagaaa     69840
     acaaagcagt aatggctaca aatgctagcg cctgaaaccg aaccaagcga acaagaaaaa     69900
     tatgaaatga cccaacagga aacaaaaaag agttaaaact cttacctccc agactgtcat     69960
     ggcgtcttga tttattcctt ttttcccttg tttgattgac atggaaacgt gtttggatga     70020
     tccacgcgtc cttacaacag ctccatcatt tgtgtcccta acctcagcct ctccgtctcc     70080
     acattcatta ccatcatcag cgccatgctc cacaattatc cctgtgccct tgctacaaca     70140
     gacccccatt tagactgcaa gagactggta cgcaacaaga aacaaaaaca aacaggaaat     70200
     atctggaaac acgacgtgtg gctaagtcct ttggaagaag taattgaaga gaggagagca     70260
     gggcagagat gaaacaacca gataaaaact ttccatggga tcaccttgta aggcctttat     70320
     cggggaacga agtcaaagga agaggaaatg aggataaaga agggaaacta gaacagacaa     70380
     gcatgaaaga aaccttttaa gaagaatgat tgacaacaga ttacaataac accaaatgcc     70440
     atttttctct tgttgaagct taaattgaaa aattataatg gaaaagtcaa aaggtttttt     70500
     tcagatgaac aaaaaactga agagagagag agagagagaa agatcaggga tggagaaaag     70560
     atatgtttat tattttctct ctgtctaaca atagattgaa atcttgatgg ggatcatcca     70620
     taattggata ctaaagatac ccgataaaaa acgatctggc tttatcgatt ttcctccttt     70680
     aactctttat tacaatccac agcacaaaaa accagcttct ccttcaacaa atcatagcct     70740
     cgctttcgat aaccaaaact aacgaaacag gaaaaaacca tagtaccaaa actaaaataa     70800
     accactggct gtttctttgt taagttctca tatcaagtag acaaaacaga ttggccgatc     70860
     tgcccgatca tattaaagga aaggagaaat aattctagca taaaatgcac ctgagaaaca     70920
     gttattaatg aagattaaat gacaagagac aaacatacct gactcaaggc atttgcattg     70980
     ctccatttat aggaagatca ctttgaaaca ttcttccaga gtacaatatc taagatgagg     71040
     caaaattcca gaaaacaaac ttgtgtcctt accccatata tatagacaag gaaaggagaa     71100
     atcattacat atacatttgg atgcagagaa caccagaagc aagaaaattt taagaagagg     71160
     tgacagacag ttgcgagcgt aaaagaaact caaatttcca tttaaagcta aacttctttt     71220
     ttcttacagt aaaagggaat ttcagcacag acaacgtatt tttaatagaa acctacaata     71280
     tcccgcttta tatattctag aagaagaaag tacatttttc accaaatgca tagaagaagg     71340
     agacttttat gcagcatcct aaccattacc accattgatg gacaagcacc cctctttgtc     71400
     tgagcgaatt gaagagctct aagcattggt tataagtctt gttgtacttt tggctccttt     71460
     gaccaggaca acatctctgc cacctgttgt aatggcattc aaggaacaac tcatctatta     71520
     gacaaatcgc tcctgtcttg attagcctcg ggatcagatc gaattcggtt ccttcaacat     71580
     ccatcttcat cacaacaaag tccctctctc tcacactctt cttcaaccag tcagcgaaat     71640
     caaacccttg aatcaaattc acctctccag ctaagtcact cgagtcagac tttttaaccg     71700
     gctggattct gcccatcccc ctgccctttg ctttggcttc cacttccttt cccggatcgt     71760
     gattgatctc aaacgataac gtctcgttcc tcacccacgc tgcgtatggc aacaggttca     71820
     ccttcttctt tatcttatac tcttcgtgaa aggctttgtc agcctcaatg gcgaaaacat     71880
     caaaagtttt gttctgctta gggtactctt tcttgaacca actcccaata ctggatccat     71940
     aacttctagc accaacatca acgtaaacgt atctactctt gaaacgtata tcaaccatag     72000
     aaggcacata tttaatattc ttgatgttcc tcttaagtgt aatccatggc ttaagaggct     72060
     cctcttgaat cagtggctct gcatcccgaa tcaaatctct tttgtaaccc ggaatccagc     72120
     actttccacc agaatcacca ccaccacggt ggtgatgacc accaccatca atctctgagt     72180
     atttctgaat aacaaattct ctgatatgag gcatcgaagg atcaaaacca tcgatatcac     72240
     gcatcttcac caatctgcaa gaattaaaca aatcaaggaa tgaattgaaa ctgtacgtat     72300
     ctgtagcccc aacatgaacc accgcaaacc cttcgggttt cagtgttcga gtaatctcat     72360
     cggcgaattc caactgcttc aacgacttcc caaggcggtc accaccggag aatacaaaat     72420
     cgaaagcgtt atcctcaaag ggaatagcat gtccctcgcc tctaaccacc aacggcctag     72480
     aagctttctt agagatcccg acggagttct tcaccccaat ctctctgagc gagtgaacct     72540
     cttgtccaat cgccgtctct acacaaagcg tcttcgattc aggcgataga taaccgtcgg     72600
     cgatcagatc ctggaagatg gaggagtaaa actgaacgga tttgatccaa tccctggtgg     72660
     tgtagagatc atccccaggg gaagtagatc tgatggcgtc gatagcagaa gagccggagg     72720
     cagcaccgga gatgacaaag ttgagattct cagggagaga gaagaagcag aagtcgccgc     72780
     gattgcatga ttcaccggtg atggtgacaa cataagcaaa tctcacaacg atgataagaa     72840
     caccaaagag aagcacgcga accattatat tccgtaagaa gctgggtttc cccatggaag     72900
     tctccatttg tatgtatctc actgctaaaa ctactttaca agacggagag aataaagaac     72960
     gaaagaatag ctcttggttt gtttgttaaa ttggaagcaa atatccctaa atctgaggag     73020
     gagatggagc agagactaac gagaagagaa acgagcagag gtgtgattag ctccgattag     73080
     ggttgggaat tgacaagaag aattgcagat ccgacaagta gttggaggat aagggcaaaa     73140
     gaagcgcata gttcgcggag gtgttcgaaa atcaaaggga gataattttt ccggcgaatt     73200
     atacggcgga ggaggaaaga gacacagaca tggaatttgg agcgagagaa aaagaagaag     73260
     aaagagagat tgagaggaat cggaaaagag acggctgaag ataaaaaagc agagcgtttt     73320
     tctctaaacg cggttgctac agaggaaaga aggtttgcat tttaggacat gtttttatgg     73380
     tttattttcg gaattgccac gctgacttat agagtaatta atctcataaa tgaaatcatt     73440
     atcaataatc agtggggtgg tatcgtaatt ttaggagttt cgtgtccctt ttactcgtat     73500
     tgttcgatcc tttcctttca ttaattatct gaattcttta acctatcttt ctttttttct     73560
     ggagagaaat ttaaagttaa agtttattgg tggatccaat gcagcttaaa gctatagata     73620
     atcaatagat gtcgaaatta gaggaaatag taaatgttat tggtcatcac tgataaactg     73680
     atcaacaaga tttacgacat attatatgat tcacttatta ttagtgtatg aatggtttgc     73740
     atacgtgata cattgctgtt actgaataaa aataagtatt agttttatta tgtgacgact     73800
     tgaccaaaca tggttgacca tacatatagg gtcacactct gtttcattac tcatctgttg     73860
     cacttaacat tattttattt taagccttta atcattatgg atgagaagtg atgatgatat     73920
     gtaagattta aacatattaa gaggcattta gttgggaagt ttaattatta cgaaagaaaa     73980
     tgatcatgtt ttaataatgg ggggttccat tatgtaatta aaaaatggaa aacaaggggc     74040
     aggtgattaa ggaagtaatc atttggttta tctttcatga gcaaacaaaa tctgaatcac     74100
     tcatttgacg gtgatacttt ttggacttga ttgacatgtg tatgttttcg gtagtttgat     74160
     actacatagc tggatttctt ttgtaatgga atatgaggat ggaagtgtcg ggcgcattag     74220
     ccgtttttca acgagagagg gttgttgctg tcacaccgag tcgctgactc gctatttttg     74280
     tacagacggt gagagcctgg actggaccag taatgggccc tactgagtca cggcctttct     74340
     ttttactttt tttaccgcaa aacgcgacta aggtgacgtg gaaaggccgg ccctatccag     74400
     gcaagttgat gaggcattaa attacataaa actcatatga ttacagaaaa aaaagaaagg     74460
     aggaaaaagt caaaaaggca cagagaaggc atccccttgt gactctgtta cgtccgttaa     74520
     tttcggctcc ccaaccaaaa aaaaaaaaaa aagaaacaaa aactacatat acaacggtac     74580
     catgtcaccc accatgtgac tagacttata atgtaaggtt gtgtggggtt gttagaacac     74640
     gcgccgtcaa caacaacaca aaagagacca aaattgttcc agctaatcca cactgggccc     74700
     aaaacagggc ctgtctgctg gctcccatag gaactcctct ttcccatttc agaatgtttc     74760
     ttctcacttt taatttaagg cgccatctct tccagctgtt gcttccagta cttgggatct     74820
     aactccgcct gttcccacat catttacatt tccatatgtc agactccttc gctctaagat     74880
     tttcatttgt aatcataaaa agctacacca accttttgcg gctatttagt gtagtaagta     74940
     gtaatctaca tatacttgta tatatattca cctgaagggt attgtctttc cagaggaacg     75000
     cacaaccacg agcttccaag tggtggatta gagaaagagg aagcagtgat cttagggacg     75060
     catgtagttt cgctttcctt aatcctccac accccagcaa tgctgctgct actccgctcg     75120
     gtcttaaacc actcgagttc acaaccgcta tgttctgtaa acaccctatg ttggctaggg     75180
     agagaagtcc cacttcagtc acagctgtgt ctgacacgtt tatctgcaac atggggatcg     75240
     caatcagata acagattcaa ccagtatatt gtagtttttt cagctgtcag tgaaggattc     75300
     aacggtttat tacctgtttg agattctgag agaagtgagc cagagcgagc aaccccgcat     75360
     cattgatgga tgggcacttc ttcaagtcaa ccttggcgag tcgcttgcac cgaacagcaa     75420
     tggctgcaag tccttgggac gtgatgttag gacatcccct gctctcgaat gtttgtaaca     75480
     acgagcattt ggacaatgaa accagggact tgtctgttat gtcttggcag tatgaaatgt     75540
     ttattgtttc cagatgaatg cagccttggg caattgtgga gatgcctacg tctgttattc     75600
     ccactgacct ggagtagata aagactagat tgagaacgga gaattttatt attgacccga     75660
     ctgaaaaata aatttctacg cgagatacct atagagatca agttcacgga gatttgaaca     75720
     gcccatcccg atgtacgaga gccctttgtc tgttatgtta agacaaattc ccagctttaa     75780
     cgaggaaaga ctcagacaac tagatatgga tttcagtcct gcatcatacg aggaaagact     75840
     aacaagataa ggtataatcc aaaaaccacg gttctaagaa ttgatctgaa gaaaataaag     75900
     aaccttcatc atcaatctcg ttgtcagtta agtcaagctc ttcaagtagc cgacactttt     75960
     gtccgatcaa ccaaaaggct tctctggaaa caagagaaca agactccatc ttcaaagaga     76020
     ctagtaaagg acacgaattg gcgatttggg tgattgaaac tctacttagt ttccggcaac     76080
     atgtgatgtc aagttttctg aggtctttca gtttcattac tagagaagaa agaccttcat     76140
     cagttacgct cacgcatttg cttaggctaa cctctttcag ggaattgcac aatgtgccta     76200
     tcgccttcaa accatcaggc gtaacagaac aaccatccaa cctgatcgac tgtaatgctg     76260
     aaaccttctt taagctactc gcaaaatcca atgatatcac ctaaatcagt aaataaacct     76320
     catataagaa ggcatcatag aacttggtgg gtctgtgtac tgctatcgat ccatgacaca     76380
     aatggtctat tcggtggtat gtgcaattac tggttttgct actactaaag agttttagtg     76440
     ccaaactaag ttgactcagc catttagcaa atacttacat acaggccata accagagaac     76500
     aaagcaagga aagcatgtgt tctgatgata atgagaaaac ggagaactta cagaagaaca     76560
     gtgtgataga tcaagtcgct gaagatatcc tgccccgctt aaaagtgagg ttaaacctct     76620
     atgagttaaa ttctggcagc tggatgcatc aagcttctgc agaacacagg ttttggtaag     76680
     taaaatctca aatgtctatg gataagatga tgatgaaaac aatcaactat atagtcttcc     76740
     agcattagac tttcaatgat aaatagcttt ctgagtctaa gaaaacatga aacctgttta     76800
     tacatcttct ctcataaaag ttaaatgttt ccagaataaa tgcagcgagc aagaagaagc     76860
     gtaacatctt ctccaagcca tattctgaga ataccaagtt ttctgttcta aaatatcaac     76920
     taaaaagttt gtctgtcaag tcgattccaa aactattatg tgatctcatg tataagaatc     76980
     aaacaaattt cttggaatag aggttacctt caatgacttg caatcatgtc tgagtgattt     77040
     aagactgtca tcatctactc caaagcaccc ttctagaaga agttcttcaa ggtgttgaag     77100
     tttcagaatg tcatgtaaac actttcctgt gatctgtaga atacggaaca aaagaatagg     77160
     tttgaatttc cagctcctct gaagatataa tccaaacata tggcacttaa agtgtcgaat     77220
     tcagatagat aatgatccac agatgttgaa agaccaaaag ttcaaccaaa acttgttgtt     77280
     aacttgaaaa atcaaccaac aggtctcagg aagaacaaat ttagaaataa ttccaattcg     77340
     acaaacttac catattaatc gaaatttggc tctgcggatt aagaaaatgt gaagagagaa     77400
     gttaattacc ggcaagtagg agaggtctaa ggtgcgaatg tccttgcatt tgacggcaag     77460
     caagccaacc cctaaatctc cgacgccaac acaccatttc aagctaaccg tattgagctt     77520
     cttacatcca actgctatac atccgattcc catgtccgtc agcatcttgc atctgcccag     77580
     cttcagcctc tccagactcc tcgcctccgc caccaccgca gcatcggcgt ctctcatctc     77640
     cgtcgcattg gacaggtcaa tctcgactaa attgacacat ttgagggcca atcgcagtag     77700
     tcccgcggcg gagaaggagc cagagcgcga gaggtcgagg gagcgaagcg taggtccgga     77760
     gagacagcca acgacgctaa gcgcgtagtc agtgacacgc gggcagaagg taagatcgag     77820
     atcggtggtg ttccggtaac gagtcaagat gcgagggaga tagtcggagc ggagaggttt     77880
     taaggatccg cggtgcttgg actcgagctg gtagaaagat ttgcaagtaa gagagaagga     77940
     tttgagatcg gaagggttgg gagagatgag gtcaaggatg ataaagacga gctcttccga     78000
     gagaagatcg aaaggcttta agacacgaat ctgtttaacc ttcttcatct gctgctgctg     78060
     ctggtgggtt gaagaaattt tgaaatcagg aaggatccga gagaagtata gtctctcttt     78120
     gaggattttg gaaaaaaccc acagttatta acaacaaaca gtttgttttc tgtgggagag     78180
     agagagtctt gaaggagaag gatattgtca aattacttaa ttgcccttgc tcttccatct     78240
     cttattgaag aaaaataggg gtagaagtgt aactttggta aaaggtaaat aaaataaaga     78300
     aagagaaccg tacggggaag gacgggaggg gcaaaaaggt aaaaggaaga gagaagtcgc     78360
     aatcaacaag ttaggccatt ggtagtagaa gtatatggtg gagtaagcat gcgaggaagg     78420
     acagattcga gtgcggacag tacgatagat tgaaagaacc tctcttatct ttcttacctc     78480
     cctctcatta aatatccttt ttatcttttc ctccattcta ctttaattat tatattctta     78540
     acctttaata atcggctaaa ttattttact tattttccaa caccatctaa tctttacaaa     78600
     tactcttttg acgtcttcac aaaacatata cttgatatca tgtaaataaa aaaaaaaaaa     78660
     aaattagaca agccgaccaa gaaaatattc gggagatata tgttcttttt catcaaatgt     78720
     gtaatcttat tcttgtctcc caactttttt taaaaaaaac tagtgattct ccattgccaa     78780
     tgatatattc catatctaaa acttttcttt ttcacgtttt attagttttc tgtgtgtatt     78840
     atgtcacaac cacataattg taaaaaacca gtaagtgcct tttcttttgt cccgacctaa     78900
     tttttgatta tattttttag cttaattata catatgaaaa agaaaagaaa agaaaaggag     78960
     ttaaaagtca gataaaataa ttattgtatg gacaagttga caaaccaaca aaaatattat     79020
     tgaatggaca acgagagtgc gcagcaaaga caaaacagta aatgtagact gggaaatatt     79080
     atttcaaact ccaaggtgtg tgaccgtact tataataacc taaaactatt ctaggtaacg     79140
     atccaattct ttataagttt tattataagg ggcatgatat atatcagtac gcacaatttc     79200
     atatttaata atctttctgt cacgcataca tgtgtcttat agcgttataa tacgtgttat     79260
     catcaaataa gaaaacaagg ctgtgaattt ctagaatatt tctggccgtt tctccaaaac     79320
     aaaccatttt tcaacacata ctacaaatac caaattctgg aaactaacgt ggacaggaaa     79380
     gagaaaaagg aaagaaagaa gaagatggtt tagtctaaaa caaaattgat attgaaacag     79440
     acgtgtaaga ggaaacctga gttatcatgg ggttctacaa cagcaataga aatcagctaa     79500
     aaaggaggac tcatgagatg tgttatttct tttagctgta aatccaaatt tgaatcaagt     79560
     tacgtcatga ttaaatatta gtcttaaagt tagagaaaag ttatatgcca aacacctaaa     79620
     acatttgcta ataatctttt tttggtcaac agatttagtg aatttccaag ttcaaacaag     79680
     gagttttata gaaacttcaa tgccaaaatc ctttcaaaat tgaatccgac tcatctccag     79740
     cgcaactaca attgaactcc tataaaaaaa aagagtttaa acaaagcttt tttcaccaat     79800
     tagaaaacag agagcgtata taattaggat aacgagtata gccggcgacg gtgggatttg     79860
     gacgactcca aactacggct atttttttga aatgaccaaa ctaccctttg cgaaacagaa     79920
     cgtcgtcata gtaagagacg tgtcaactct accaggcaca aaaaagtaca gaattcacga     79980
     gacgttatga ctcttgaccg tgttaggccg gatatcgtac ggaatattcc taggatcgtt     80040
     tacacgtata ccgtaccact tccactaatc gtactttgat gacaattcaa ctcttagact     80100
     tgacttttta ttatcacttc ttttcttttt tcaacttgga aacgattgtt caaggagact     80160
     cagacataca ctacgtggct aaatattcca acgacgacta gtagcattcc agttcacact     80220
     tcaaatttca aaaagtttga acaaatcaga gaagtcataa caaaaactta gcgtttcttg     80280
     acttttaaaa atactttgct ctccaacatc gtttttcatc tactatcagt atttatcata     80340
     cttgttgatt tgtgcatatg cactgatgaa ggttgaattt aaaatgtatc ttgatgtaaa     80400
     ttacaagtcc tataacactt acttttactt atgtaaagta tttgtttatg tgaaaagatc     80460
     aaacatgcaa atatgctgaa acatcaactg gattgattcc ctttaaaaga gggtaaaatt     80520
     gggtgtacat ataaagggga aaaaaacaga gtgacttaca atgtgtcaaa aatacagcaa     80580
     taaaaacatt acttgtgaga atacatacaa tgtgagaatt cttctataca gagtgtgatc     80640
     tatatgtttg ttacctgcag atttgattca acgactcact cgctccagct atctgaatcg     80700
     tgctcgtcgt cacttcccgc cattgcctat ttatatgtat gtcacaaaac cactttatcg     80760
     atccccaaga ttattatatc tttttctttg tgcaacagat tattatatca agtgtccaaa     80820
     tttaaccaag aaggagagag ggagagacct ggcgaagagt gttggctttc tctagaattg     80880
     cagccacctt caagttggtt ttgggaacag ctacttgaaa gtttggtctc cctgaggcat     80940
     ctgctggtct caggttgaac gactgctaaa gtttttttca agttaaatgt tctataatag     81000
     aaaactgaat aaagtgaaaa ggaaaagatg aaatggtgat ttgaccttgc tccgtatgat     81060
     ctctagtagt gaatcattct cgtccactcg agctccaacg tgtgtcctgt tcccttcaga     81120
     tactttcctc aactgtaatc aaacacaaat tgagtctcat gattaacgcg tgagagagag     81180
     aagagaaaaa taagccattg aagtactaac catgcttctg tcaatgccaa taacaagcgt     81240
     atcctcgtct cttttaagct ttccagcttt ctgattctga ttatatgagt tattgtctcg     81300
     caaggtttgt cgaaatttgg tttgtccagg tttttctagt gggtgatcaa cctgaggctc     81360
     ttcctcttct aactttgcag ggtggggatt gttatgctct cttaagttct gactaaacca     81420
     ttcaagtgcc attgcttcag tcctccagtc agcttctaag ccttgggccg attctgccaa     81480
     agaaaatgaa tcctccggag ttctatttaa acacttgtgt ttactttcca tataggtgtc     81540
     gcttgtccca ttgactcctg aaggagactg ttcctcggtt gctttagatt cttctgtata     81600
     aatatgaaaa ttatggtttt caccatctgt aaccgacact tctgatggat attgtgcctc     81660
     gttcgcttga actgatccat tctgtgtgtt ttcatccctc tggatgttga aactgttgtt     81720
     tccactgcct gcaagtgatg gcatttcggt tgattcaacc agcttcccca tccaccattg     81780
     tgtcggagga agaggcggaa gcggaggtgt tatctccgga tttgcctgag gtgtttcatg     81840
     gagggacgtg gagaggggta gtatggactc aggggatacg ttcaagaaat cttcttcatc     81900
     agtcagaccc ttggaaagaa cagactcaga gatatgatca tttaatgatg tgaaaatttc     81960
     ctggtatggt gcatgaagag cttctatttc agttatgctt gaaggaaaaa catctaaagg     82020
     tgaactttga acaccaacag atccattttg tgtaggagga gactcgtctg atgatgttct     82080
     tgaatttgct gaccctgttt ctgatggact ttcttgcctt tggttctgta tctgtaagca     82140
     atactcagat gaaagacatt cttctgtacc taaaagactc tcctgtggat cactaatagt     82200
     ttccaattct ttctggggca cggtctcaat ggccttatta ttcaggccag tctggttatc     82260
     gtgatcgaca tcacctgcaa aacaagtacc atcaggaatt ggtacctcag ggtcactact     82320
     atcatctgaa acaatagaca tggtttgtgg atcctcctgt ccagaatatg atgatatctc     82380
     agccagatca gggttggcca atccgtcttc cagacaagat gaggctgaga ggctcccgta     82440
     tcctgtgtga agatctcttg gagtatctga catcagagtt ccattttctg aactgatttc     82500
     agaagttgaa atgtgttttg actgtgcagg attcatggaa gatccgtctt gggagttcgt     82560
     ttcatcttct tttggggcag cataatcctg tgcatcagca gacagagata aatcttcaaa     82620
     gttgtcaaat gtgctaatgt aatgatttgg aagaagaaaa tcggactcca atgccactga     82680
     tgtttcattt aaactctttt tggtatctgg aatgaaatga ccagcttcag aagaaatgtc     82740
     ctcggattcc agagcctcta tctcttgatt ggttatggaa gagaactggt cttccactaa     82800
     agcacttaca gatatctcag atgcagtctc cacactgaaa acatgttgag aatgaacatc     82860
     attggtccca ccctcatatg cgtcctgtgg cacttgtgta acctttaaaa gatgagtttc     82920
     aggggaaata ttaagcatgg gatcccttct gacttcaaag acctcacaag cttcagcatt     82980
     tgctttattg gactgaagct ccaagtgact tccagaatct tcgggaagat ttgcaggact     83040
     ctcgtagcaa gacaaactga aaggtgtttg taagatctcc agagtcccca tgcctgcgga     83100
     atctatgtcc ggtgtcatct gggaaaatga ctcgtctaaa tctacagcag cctcttcagc     83160
     tttatgtggt ttactttcag gagaagctct ctggatatca gtacacaaaa gactagattc     83220
     tccttcctcc ggtgagtggc gcaaaacatt agaaaactga gtcagaacct ctgtttgatt     83280
     cacttctgca ttagtacaga tctgcggctg accaaatcct ggaaatccat ggtcacatcc     83340
     agccttgtca tcactccctg cttcctttac ctctgactcc gtggaagcag gtgaatctgc     83400
     gtcattgttc gtcttgcaac acaaattcac agaagagcta ctttctaaac aaaccactgg     83460
     tgacttctca ttaaccgtaa tctcgtgagg aacaaaagga atttcaagta tttcatgacc     83520
     agcaatggat tctatctcca tctcattgta ttttctagtg cctccactgt tggaataaac     83580
     taaggaaggt attggtaagt cttcttgttc actgcatact gtaacttcag tttccattgc     83640
     cggagatgac tgatccatag tcccatgaac tctttcacag tatggtgaag aattcttgag     83700
     gaatttctcc atgtaacttg ccccagagct tgagttaatc ggaggtccat tcagctgtct     83760
     tctcttcagt ttcacatgga attcaggatt tctgtgtccg ttctcaacat gctccaaaaa     83820
     gaatagctga tgcaacctgt actatccaaa aagtagctca tgtcaccaaa tcaagtgccg     83880
     atcacatata tgaactttag acataggaat gacagaaaca gaagtagata tagagcaaga     83940
     gtgctcactt ggcatgtgat gtccgtgaat cctcaggcgt ctctttaata gttgtgtgag     84000
     atcctttctt ctgtatttga aatagatttg atcatatgta acacataata cccaaatgtg     84060
     catttttcag atgcttattt ttacagacag tggcagagtg ggcatagtaa aaccagaatt     84120
     aggaaatgtg taacatgatt gaataccttt gattgacgta gtcgcttatc tttcccgagt     84180
     ttggatgttg ctactactgc tgatgtagta tgtgtcttca ataaagatgg atcagagtaa     84240
     cgcttcaagc atgatccaga cccagcaaca tcaaacctga ataacagcag aaacatgatt     84300
     aaaaactgca aatggatatt tccttatggt gaaaattctc atgatatact gaaatgtact     84360
     tgtcgagaag gaaaagctgc ggcggaccat ggcattcctc gtacgaatcc attatacaac     84420
     gaggcaagtt ccgtggggaa atcaagtctt cttttgtttg cagatcagaa tgccattcca     84480
     agcctgagga cctaactaac aattcagtgc ttgggatcac caatagcagc ttatatctct     84540
     tatactaaac attagagtaa gatagatgac tggcctggct cataaaagaa tgtagaatga     84600
     tcggtttgag agagaatggg tatctcaact gaagggaagt ctgcttcgag gtgttggaga     84660
     cgcatcgcca aaccatgacc tcgtgctgca gttgtcatta gttgctcatg caggcaatgg     84720
     aatacctcag cagcaaacct tattagtatg aaaagagaca aaagaacata aatgccaagg     84780
     gattgattcc atagcgacat agaggtttca ttagaattag ataaccaaaa gaagaaaaat     84840
     catctcatca gcacacaaga aacttgaact acaccgaata agatttttaa gcaaaaaaca     84900
     aagagaccac cctagattca ggttttctct agattcagag tatatagcat cgaaattcaa     84960
     ttccacggaa ccttcagtgt cccattctct acagtaaaat tcctcaaacg gtagggtata     85020
     ttggaccgaa attgaattaa aaaaaaaaaa aaaaaaaaca tactcagaga ggtcgccaag     85080
     ctggcgcaaa acgccgacga gaccagccat ggaagcagct tcgagcaaag cttcaggatc     85140
     ctccttatcg gcggattggt agagctcctt atccgctaag ccgtactcgt tccgtatctg     85200
     gtatctcgtc aatgccattg tgctccaatc gattaaagta gaaaccctta attcttaaaa     85260
     acaaaaaaag agcatcagaa gaagaaactg tgcagaacga accgccaaaa cgcgtcagga     85320
     gaaagatgaa atcttttacc tttatagatt tttaattaat tttaacgacg cgagagtggt     85380
     ggaatttata taacggtccg tgacattcat ccaacggtta taatcatcgc ctcaccgtgt     85440
     ggttgccgca tgtgatcaga acctcaggta aaataattta ttcaaccggt gaacatgaaa     85500
     gtagttaaaa ccgttgatta tccatgctta aagatggaca aactttgctt agaatcataa     85560
     ggtattataa ttattgcaaa tcaattatat tgtactacaa gtatattgtc tacaagtggt     85620
     tgtggttgaa atcagttagt gtattcaacc tgcttttgat cgttacatcc accttcacct     85680
     aagtttttta ttttaattat aattcttttt ttatattatt gactaccaat agtgatcaaa     85740
     tagtgggaat tatatatata tttctcgtcg atttattagc atagaataca ttcttctatt     85800
     caattcttcg tatgtcttta aatttatttg ataatgcagt tcaaatcaaa agcactaata     85860
     tcacgcaagg cttccaagga aagattaaat gattactcca tttatttttg ggccaaaaaa     85920
     tactccagta aatgttaaat atataaacgc atacagtata tattctttat atgataaagt     85980
     atggtttggt agattgttat taccatcctg atgttatgta atgagcttaa ttcgtcgtgc     86040
     atgatgtgtc gttaaaaagt caaacatcaa atgacgacct taaatggttg ggcctgatgg     86100
     acttatttga gtctaataga agacagtaaa ctgttatgag cccattccat gacccatatt     86160
     aaagtgctgg ataaatatgc taaaatccac agcaaggaat aaatgaaacg cagcgtatca     86220
     agttgagcaa aggtcgtttt tgagtacgat ggaaacaggt caccaaacgt tatcactatg     86280
     cctaggcttg tgtttggtac ctgccccttc tacattggtc gatcaaagaa gaattactga     86340
     ccttataatt ttgtatatat cttaataata tataaaaccc acaattttga aatacagctc     86400
     agaaatggct ggataattag tgatttcgag gttcaaaatt ctatggcgag ggatggttta     86460
     tataagaatt actattacaa gcttagtttg ttttagctat aatcatactc tcatgtatta     86520
     gacgcgtttc tttcatttat atgttgtaat aaatgagacg cattttgtgt ggacgacaaa     86580
     tcatatacga gcaactattt tgatatatat ccccgtttcc tatacatgca ttagtttctg     86640
     aagagattat tggtacaaga tagagaaagg aggaagaggt gagtcgaccc                86690
//

If you have problems or comments...

PBIL Back to PBIL home page