(data stored in ACNUC16935 zone)

EMBL: AL163002

ID   AL163002; SV 1; linear; genomic DNA; STD; PLN; 99008 BP.
XX
AC   AL163002;
XX
DT   03-APR-2000 (Rel. 63, Created)
DT   14-NOV-2006 (Rel. 89, Last updated, Version 3)
XX
DE   Arabidopsis thaliana DNA chromosome 5, BAC clone F15A17 (ESSA project)
XX
KW   .
XX
OS   Arabidopsis thaliana (thale cress)
OC   Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
OC   Spermatophyta; Magnoliophyta; eudicotyledons; Gunneridae; Pentapetalae;
OC   rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis.
XX
RN   [1]
RP   1-99008
RA   Bevan M., Terryn N., Ardiles W., Buysshaert C., Dasseville R.,
RA   De Clerck R., De Keyser A., Neyt P., Rouze P., Van Den Daele H.,
RA   Villaroel R., Gielen J., Van Montagu M., Bancroft I., Mewes H.W., Rudd S.,
RA   Lemcke K., Mayer K.F.X.;
RT   ;
RL   Unpublished.
XX
RN   [2]
RP   1-99008
RA   EU Arabidopsis sequencing project;
RT   ;
RL   Submitted (03-APR-2000) to the INSDC.
RL   MIPS, at the Max-Planck-Institut fuer Biochemie, Am Klopferspitz 18a,
RL   D-82152 Martinsried, FRG, E-mail:
RL   lemcke@mips.biochem.mpg.de,mayer@mips.biochem.mpg.de Project Coordinator:
RL   Mike Bevan, Molecular Genetics Department, Cambridge Laboratory, John Innes
RL   Centre, Colney Lane, NR4 7UJ Norwich, UK, E-mail: michael.bevan@bbsrc.ac.uk
XX
DR   MD5; 5df08845e23ada3fae591a9c1b7a25e6.
DR   ENA-CON; BA000015.
DR   RFAM; RF00768; MIR405.
XX
CC   Information on performance of analysis and a more detailed annotation
CC   of this entry and other sequences of chromosomes 3, 4 and 5 can be
CC   viewed at: http://www.mips.biochem.mpg.de/proj/thal/
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..99008
FT                   /organism="Arabidopsis thaliana"
FT                   /chromosome="5"
FT                   /variety="Columbia"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:3702"
FT   misc_feature    1..12304
FT                   /note="Overlap with BAC F9G14"
FT   gene            1004..2011
FT                   /gene="F15A17_10"
FT   CDS_pept        1004..2011
FT                   /gene="F15A17_10"
FT                   /product="putative protein"
FT                   /note="similarity to various predicted proteins,
FT                   Arabidopsis thaliana"
FT                   /db_xref="InterPro:IPR001810"
FT                   /db_xref="InterPro:IPR006652"
FT                   /db_xref="InterPro:IPR015915"
FT                   /db_xref="InterPro:IPR036047"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9LYY7"
FT                   /protein_id="CAB86065.1"
FT                   /translation="MNESSESPPPSRTFSSLPYDIILNCLARVSRYHYPTLSLVSKEFQ
FT                   SLIASRELYATRSRIGKTERFLYICLNLTKSNPKYRWFTLPPVPNEQKLLPVPLFTYHL
FT                   NSSTVSSTDSEIYIIGGLVWGNRSKKASIFDCRSHQTRRLPKMRFPRASAAAHVIDGKI
FT                   YVIGGGEIRGEVYDPTTQTWLTTPVDHTTEECQKVYDKHGVNICFVEIDNLLCQTFVFN
FT                   GKLYWRHPRGDDFGWARVKGVEQELFRNHLSYVDKSGGGRRVTVWWKSVVVFGCQGLGY
FT                   STEFDTEIWCAEISFERRGLKELWGFVEWSRKVFTCKGCDSPTDFVMDSVLVTY"
FT   exon            1004..2011
FT                   /number=1
FT   gene            3820..5641
FT                   /gene="F15A17_20"
FT   CDS_pept        join(3820..3962,4053..4190,4278..4314,4658..5641)
FT                   /gene="F15A17_20"
FT                   /product="putative protein"
FT                   /note="similarity to various predicted proteins,
FT                   Arabidopsis thaliana"
FT                   /db_xref="InterPro:IPR006652"
FT                   /db_xref="InterPro:IPR015915"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9LYY6"
FT                   /protein_id="CAB86066.1"
FT                   /translation="MGGKVYAMDGLKIELKTNICLVEKCLRLVSYSNHSLYWNDPTEDC
FT                   VWSVTLWWKSVVIQPPNYHCTKECKTEIWCAGLSFERRGLKELWGFVEWIFRIIDRLRG
FT                   FKTIYIAFNCLARISRFHYPTLSLVSKGFRSLIASPELEATRSFIGETENHLCVCLNLN
FT                   KNNNYNPRWFTLSPIAKQKLKSIPWHRHQYPKSSTVVANGSDIYIVGGFVCGTSSKRVF
FT                   VFDSRSHQWRRLHDMRLPRVSAVVNIVDKKIYVIGGYKPRNIKDCGEVYDPNTQTWEPL
FT                   LPTTVNLTIQNCVVSGGLVMGGKRYTTNGTKMNTCFVELENLLLGLSETYRDLVWRELK
FT                   EDVWRVVRGLEQLSHNQNFTYVGNSGGGRRVAIWWKSMVVFRPRGRSHSTKKCKTEIWC
FT                   AEISVERRGLGELWGRFSFSFRDSFIYIFLWEFF"
FT   exon            3820..3962
FT                   /number=1
FT   intron          3963..4052
FT                   /number=1
FT   exon            4053..4190
FT                   /number=2
FT   intron          4191..4277
FT                   /number=2
FT   exon            4278..4314
FT                   /number=3
FT   intron          4315..4657
FT                   /number=3
FT   exon            4658..5641
FT                   /number=4
FT   gene            6279..7448
FT                   /gene="F15A17_30"
FT   CDS_pept        join(6279..7145,7251..7448)
FT                   /gene="F15A17_30"
FT                   /product="putative protein"
FT                   /note="similarity to various predicted proteins,
FT                   Arabidopsis thaliana"
FT                   /db_xref="InterPro:IPR001810"
FT                   /db_xref="InterPro:IPR006652"
FT                   /db_xref="InterPro:IPR015915"
FT                   /db_xref="InterPro:IPR036047"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9LYY5"
FT                   /protein_id="CAB86067.1"
FT                   /translation="MFCSCLEIVFFLAGRHHSQFPSLPDENETNKSSDSPPTVFSSLPD
FT                   ELILNCLARVSRFYRPSLSLVNKEFQSLIASPDLEATRSRIGVTENHLYVCLESNKNNP
FT                   NPRWFTLAPIPKEQKVKPIIPSFPYQHPTSSTFVSIGSEIYIIGGFVKRKRSRRVLVLD
FT                   CRSHQCRRLPNMALPRVSAAADVIDGKIYVVGGSKSKNIDNWGEVFDPETQTWEPIFPT
FT                   TVDLTTQKSVFPGKLVMGGKVYDMDGLKVNLNLNSCVVEIDNMMCQISVCKGILVWYDS
FT                   EEDLVWNKSMVFDRLGLDWTKEGKTEIWCAEISLERRGFGELWGFVEWSKKVFTYDGCD
FT                   SPSDFFLHSAIVTY"
FT   exon            6279..7145
FT                   /number=1
FT   intron          7146..7250
FT                   /number=1
FT   exon            7251..7448
FT                   /number=2
FT   gene            7695..8774
FT                   /gene="F15A17_40"
FT   CDS_pept        join(7695..8381,8502..8774)
FT                   /gene="F15A17_40"
FT                   /product="putative protein"
FT                   /note="similarity to various predicted proteins,
FT                   Arabidopsis thaliana"
FT                   /db_xref="InterPro:IPR006652"
FT                   /db_xref="InterPro:IPR015915"
FT                   /db_xref="UniProtKB/TrEMBL:Q9LYY4"
FT                   /protein_id="CAB86068.1"
FT                   /translation="MTPKSRGFVRRRRSRRVLVLDCRSQQWRSLPKMRQPRASPAAYVK
FT                   DGLIIVIGGCRSKNIETWGEIYDLKTNTWGRILLQSHDPTVQNAYLNRFKPNLQTNACY
FT                   VEIDKVSCLIFLSDGKLFWRETKQGFERCSVILGDDEQVSSYQLVSVANAAGGGRVTVW
FT                   WKSGLKVLDLLSGTETWECYTNIRCAEISFERRGLRELWGFVEWSREVFTVDGYDDTYD
FT                   FFLNSAIVVWCLMAFDEGEVFYFVSDFCLLVKERIMGTTFLLLHGKDNVEWSQGKNGVE
FT                   SGQGTWIAKHCVSVWWCTMLDHPYGRKVQISQSFPRES"
FT   exon            7695..8381
FT                   /number=1
FT   intron          8382..8501
FT                   /number=1
FT   exon            8502..8774
FT                   /number=2
FT   gene            10274..11317
FT                   /gene="F15A17_50"
FT   CDS_pept        10274..11317
FT                   /gene="F15A17_50"
FT                   /product="putative protein"
FT                   /note="similarity to various predicted proteins,
FT                   Arabidopsis thaliana"
FT                   /db_xref="InterPro:IPR001810"
FT                   /db_xref="InterPro:IPR006652"
FT                   /db_xref="InterPro:IPR015915"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9LYY3"
FT                   /protein_id="CAB86069.1"
FT                   /translation="MTEEMSKESPPPPPTSFSSLPDDVALDCRARISRFHYPTLSLVSK
FT                   GFRTLIASPELEATRSFIGKPENHLCVCLRLYKNPNPLWFIFSPIPKQKLKPIVPWFPN
FT                   QQYPQYPTVVSNGSQIYIIGGFVRRRRSNRVSIFDYRTYQWRRLPKMRQPRVYPAASVI
FT                   DGKIYVIGGFRGSMPTDIENSGEVYDPKTNTWEPILLTSLDLTVQNVFKKKHYFTTKAC
FT                   LVINKVSCLLYVSDGKLYWREDKEGFECRKVYGLAEQSSNLFRVVANSGGGGRVTVWWK
FT                   SMTKGCEFDCLLTEECETKIWCAEISLERRGLRELRGFVEWSKEVFTIDRCDYIYDFIS
FT                   QYVTVTY"
FT   exon            10274..11317
FT                   /number=1
FT   gene            11490..12524
FT                   /gene="F15A17_60"
FT   CDS_pept        complement(join(11490..11646,11948..12126,12522..12524))
FT                   /gene="F15A17_60"
FT                   /product="DNAJ protein-like"
FT                   /note="similarity to DNAJ domain-containing protein, Homo
FT                   sapiens, EMBL:AF126743"
FT                   /db_xref="GOA:Q9LYY2"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9LYY2"
FT                   /protein_id="CAB86070.1"
FT                   /translation="MATPMIAGAAVAAAAVAGRYGILAWQAFKARPRVPRMRRFYEGGF
FT                   QSSMTRREAALILGVRESVVADKVKEAHRRVMVANHPDAGGSHYLASKINEAKDMMLGK
FT                   SNNSGSAF"
FT   exon            complement(11490..11646)
FT                   /number=1
FT   intron          complement(11647..11947)
FT                   /number=1
FT   exon            complement(11948..12126)
FT                   /number=2
FT   intron          complement(12127..12521)
FT                   /number=2
FT   exon            complement(12522..12524)
FT                   /number=3
FT   gene            13391..15418
FT                   /gene="F15A17_70"
FT   CDS_pept        complement(join(13391..13935,13982..14048,14176..14295,
FT                   14581..14802,14955..15278,15359..15418))
FT                   /gene="F15A17_70"
FT                   /product="putative protein"
FT                   /note="There is a possible frameshift caused by additional
FT                   nucleotide, creating a small intron. EST data supports this
FT                   hypotheses. Nancy Terryn asked to check sequence."
FT                   /note="similarity to various predicted proteins,
FT                   Arabidopsis thaliana"
FT                   /db_xref="InterPro:IPR000048"
FT                   /db_xref="UniProtKB/TrEMBL:Q9LYY1"
FT                   /protein_id="CAB86071.1"
FT                   /translation="MGKKAKWFSSVKKAFSPDSKSKQKLAEGQNGVISNPPVVDNVRQS
FT                   SSSPPPALAPREVRVAEVIVERNRDLSPPSTADAVNVTATDVPVVPSSSAPGVVRRATP
FT                   TRFAGKSNEEAAAILIQTIFRGYLARRALRAMRGLVRLKLLMEGSVVKRQAANTLKCMQ
FT                   TLSRVQSQIRARRIRMSEENQARQKQLLQKHAKELAGLKNGDNWNDSIQSKEKVEANLL
FT                   SKYEATMRRERALAYSYSHQQNWKNNSKSGNPMFMDPSNPTWVPRKNKSNSNNDNAASV
FT                   KGSINRNEAAKSLTRNGSTQPNTPSSARGTPRNKNSFFSPPTPSRLNQSSRKSNDDDSK
FT                   STISVLSERNRRHSIAGSSVRDDESLAGSPALPSYMVPTKSARARLKPQSPLGGTTQEN
FT                   EGFTDKASAKKRLSYPTSPALPKPRRFSAPPKVESGGVTVTNGAGS"
FT   exon            complement(13391..13935)
FT                   /number=1
FT   intron          complement(13936..13981)
FT                   /number=1
FT   exon            complement(13982..14048)
FT                   /number=2
FT   intron          complement(14049..14175)
FT                   /number=2
FT   exon            complement(14176..14295)
FT                   /number=3
FT   intron          complement(14296..14580)
FT                   /number=3
FT   exon            complement(14581..14802)
FT                   /number=4
FT   intron          complement(14803..14954)
FT                   /number=4
FT   exon            complement(14955..15278)
FT                   /number=5
FT   intron          complement(15279..15358)
FT                   /number=5
FT   exon            complement(15359..15418)
FT                   /number=6
FT   gene            18314..18983
FT                   /gene="F15A17_80"
FT   CDS_pept        complement(join(18314..18449,18545..18618,18695..18844,
FT                   18933..18983))
FT                   /gene="F15A17_80"
FT                   /product="putative protein"
FT                   /db_xref="UniProtKB/TrEMBL:Q9LYY0"
FT                   /protein_id="CAB86072.1"
FT                   /translation="MEEDAGNGGFRKRMRASDEEGKGDSRDGISLDHTIENEEAETKLV
FT                   ASDEMELSIAQILDKIESFTQTVSNLLETGKTMLKELSNEFEERLIMIHKEHVEKWQDE
FT                   IKELRLLDASNEETTSLLHNARYLIQNPSIEQ"
FT   exon            complement(18314..18449)
FT                   /number=1
FT   intron          complement(18450..18544)
FT                   /number=1
FT   exon            complement(18545..18618)
FT                   /number=2
FT   intron          complement(18619..18694)
FT                   /number=2
FT   exon            complement(18695..18844)
FT                   /number=3
FT   intron          complement(18845..18932)
FT                   /number=3
FT   exon            complement(18933..18983)
FT                   /number=4
FT   gene            19734..20690
FT                   /gene="F15A17_90"
FT   CDS_pept        complement(join(19734..19975,20054..20690))
FT                   /gene="F15A17_90"
FT                   /product="putative protein"
FT                   /note="similarity to various predicted proteins,
FT                   Arabidopsis thaliana"
FT                   /db_xref="GOA:Q9LYX9"
FT                   /db_xref="UniProtKB/TrEMBL:Q9LYX9"
FT                   /protein_id="CAB86073.1"
FT                   /translation="MTGKSSARSNKSGKNKISSVATPTRRNLVVQEEILATKHEILKEN
FT                   YENLEKDYKSIEESFKQMNEMNEIMKFQYQKQIKELEEKILSLLKDLEKERSEKEEYMK
FT                   EMKGMISEKEAIINDLSVKNQELLIAKEEEVEKLKKMENKYAELKERFDAAESQCSFLK
FT                   SLFDAENLAGLGSSDVAFENEVIVVEDYNVTIKNEVIMVDDHNVNNTPTDTIVILDESD
FT                   AENDNPHPRESNIISENSVDVKQEQQSAGPSSSKVNRLLSSSSSSSSSSSVEHVFVELP
FT                   FKRSRDIYNKS"
FT   exon            complement(19734..19975)
FT                   /number=1
FT   intron          complement(19976..20053)
FT                   /number=1
FT   exon            complement(20054..20690)
FT                   /number=2
FT   gene            21480..24407
FT                   /gene="F15A17_100"
FT   CDS_pept        complement(join(21480..21644,21771..22076,22154..22186,
FT                   22598..22748,22917..22996,23085..23269,23355..23457,
FT                   23627..23780,23888..24110,24356..24407))
FT                   /gene="F15A17_100"
FT                   /product="importin alpha-like protein"
FT                   /note="similarity to importin alpha, Oryza sativa,
FT                   EMBL:AB006788"
FT                   /db_xref="GOA:F4KF65"
FT                   /db_xref="InterPro:IPR000225"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR024931"
FT                   /db_xref="UniProtKB/Swiss-Prot:F4KF65"
FT                   /protein_id="CAB86074.1"
FT                   /translation="MADDGSASNRRDPIKSSVGNVAGQRRRKQAVTVAKERRELLVRAK
FT                   RLCRVGTNGDVEDALVENEMMVDEEQPILEAQASKSVEELKSAVQYQGKGAMQKRVTAL
FT                   RELRRLLSKSEFPPVEAALRAGAIPLLVQCLSFGSPDEQLLESAWCLTNIAAGKPEETK
FT                   ALLPALPLLIAHLGEKSSAPVAEQCAWAIGNVAGEGEDLRNVLLSQGALPPLARMIFPD
FT                   KGSTVRTAAWALSNLIKGPESKAAAQLVKIDGILDAILRHLKKTDEETATEIAWIIVYL
FT                   SALSDIATSMLLKGGILQLLIDRLATSSSLQLLIPCLRSEHRVLKKEAAWVLSNIAAGS
FT                   IEHKRMIHSTEVMPLLLRILSTSPFDIRKEVAYVLGNLCVESAEGDRKPRIIQEHLVSI
FT                   VSGGCLRGFIELVRSPDIEAARLGLQFIELVLRGMPNGEGPKLVEGEDGIDAMERFQFH
FT                   ENEELRVMANSLVDKYFGEDYGIDE"
FT   exon            complement(21480..21644)
FT                   /number=1
FT   intron          complement(21645..21770)
FT                   /number=1
FT   exon            complement(21771..22076)
FT                   /number=2
FT   intron          complement(22077..22153)
FT                   /number=2
FT   exon            complement(22154..22186)
FT                   /number=3
FT   intron          complement(22187..22597)
FT                   /number=3
FT   exon            complement(22598..22748)
FT                   /number=4
FT   intron          complement(22749..22916)
FT                   /number=4
FT   exon            complement(22917..22996)
FT                   /number=5
FT   intron          complement(22997..23084)
FT                   /number=5
FT   exon            complement(23085..23269)
FT                   /number=6
FT   intron          complement(23270..23354)
FT                   /number=6
FT   exon            complement(23355..23457)
FT                   /number=7
FT   intron          complement(23458..23626)
FT                   /number=7
FT   exon            complement(23627..23780)
FT                   /number=8
FT   intron          complement(23781..23887)
FT                   /number=8
FT   exon            complement(23888..24110)
FT                   /number=9
FT   intron          complement(24111..24355)
FT                   /number=9
FT   exon            complement(24356..24407)
FT                   /number=10
FT   gene            24988..26163
FT                   /gene="F15A17_110"
FT   CDS_pept        join(24988..25660,26030..26163)
FT                   /gene="F15A17_110"
FT                   /product="putative protein"
FT                   /note="similarity to contains transmembrane region and ATP
FT                   binding region, Mus musculus, EMBL:AB030189.1"
FT                   /db_xref="GOA:Q6NLA5"
FT                   /db_xref="InterPro:IPR000326"
FT                   /db_xref="InterPro:IPR036938"
FT                   /db_xref="InterPro:IPR039666"
FT                   /db_xref="InterPro:IPR039667"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6NLA5"
FT                   /protein_id="CAB86075.1"
FT                   /translation="MDLIPQQLKAVTLTHVRYRPGDQLGHFLAWISLVPVFISLGGFVS
FT                   HFLFRRELQGIFFGIGLVISQFINEFIKTSVEQARPETCTLLEACDSHGWPSSHSQFMF
FT                   FFATYFSLMGCKGIGFWFGLRSRWIMNLLHWSLAVVTMYSRVYLGYHTVAQVFAGAALG
FT                   GIVGASWFWVVNSVLYPFFPVIEESVLGRWLYVKDTSHIPDVLKFEYDNARAARKDMDS
FT                   AKYLICFIHLQVENSGISGLVILFLCYIISGMARRWEIPFMLPFYD"
FT   exon            24988..25660
FT                   /number=1
FT   intron          25661..26029
FT                   /number=1
FT   exon            26030..26163
FT                   /number=2
FT   gene            28293..28974
FT                   /gene="F15A17_120"
FT   CDS_pept        join(28293..28311,28700..28974)
FT                   /gene="F15A17_120"
FT                   /product="putative protein"
FT                   /note="ESTS overlap this sequence but there does not appear
FT                   to be any clearer ORFs"
FT                   /db_xref="UniProtKB/TrEMBL:Q9LYX6"
FT                   /protein_id="CAB86076.1"
FT                   /translation="MKTTNKYGGSLVDLQWGTLALDDCSRSDGFLLQPLHGGTSPPMSL
FT                   LGGGGSVLRRYRGRWIVVFELGCEDLTDPGQIYMFQGLLAMLPPTTPNGKII"
FT   exon            28293..28311
FT                   /number=1
FT   intron          28312..28699
FT                   /number=1
FT   exon            28700..28974
FT                   /number=2
FT   gene            29844..31510
FT                   /gene="F15A17_130"
FT   CDS_pept        join(29844..30698,30813..30859,30964..31105,31244..31510)
FT                   /gene="F15A17_130"
FT                   /product="putative protein"
FT                   /note="similarity to various predicted proteins,
FT                   Arabidopsis thaliana"
FT                   /db_xref="GOA:Q501G5"
FT                   /db_xref="InterPro:IPR001810"
FT                   /db_xref="InterPro:IPR032675"
FT                   /db_xref="InterPro:IPR036047"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q501G5"
FT                   /protein_id="CAB86077.1"
FT                   /translation="MKRAGGGVDFISSLPDEILHHILANTPTKLAIRTSVLSKRWKHVW
FT                   YETPSISIVCNRVDPDSLNKTLSSYSTPKIKSFDVTISRDVTVPEIDTWINLALSRKAE
FT                   NVSLRFTSHYRFRDTFFINSSLKQLSLTLVYCILNPKCVVSWSSLRNLSLNRCKVSDDS
FT                   IAKILTGCSLLESLTLNLCDRLNDLDLSKSLSLRRLEILGDRWTPERIVAPHIRYLRLE
FT                   NYQRPSTLVDVSSLTEANLGLSKHVLDYFTCEMETESLQYMVRQTVVKLQNIKKLTIGG
FT                   IFLQEHMKSLCGIWKLEVVRLPEFNIEALTVETRIDQSVIPGLARLLQNSPGLKRITVN
FT                   ITKCNTTPDKHLDRHLKLRGLNPDQSWISKYGVFPTVEQTSAKMKHVDSFIKLVMGNTK
FT                   TLEKLVLQFGDYLDAAYQMVPTLSYDDIQIVIKKRRS"
FT   exon            29844..30698
FT                   /number=1
FT   intron          30699..30812
FT                   /number=1
FT   exon            30813..30859
FT                   /number=2
FT   intron          30860..30963
FT                   /number=2
FT   exon            30964..31105
FT                   /number=3
FT   intron          31106..31243
FT                   /number=3
FT   exon            31244..31510
FT                   /number=4
FT   gene            33358..34209
FT                   /gene="F15A17_140"
FT   CDS_pept        33358..34209
FT                   /gene="F15A17_140"
FT                   /product="putative protein"
FT                   /note="similarity to various predicted proteins,
FT                   Arabidopsis thaliana"
FT                   /db_xref="GOA:Q9LYX4"
FT                   /db_xref="UniProtKB/TrEMBL:Q9LYX4"
FT                   /protein_id="CAB86078.1"
FT                   /translation="MMISRRPVSSPGRVEKYPPPFMGFLRSKSNGGSTSRSRSRSRGRS
FT                   RASPLFVRRNKSAAAVAQEPSSPKVTCMGQVRVNRSKPKIKPESRDNPTRRRCEWLRNA
FT                   SFYNKFAGKIKTMTFWPKWRLCSFSCACRNLKEKDSPRSQLDHPTTESVREIKEEIEGE
FT                   ENFEIPKLFVSPATTPPINALLLTRSRSAPYRSSSLAFRFWEENNQREVESQQNVRSEK
FT                   TDSEVPIEKINGFHEPEYVDRDEEEFTKLRFVRQPVLTRSKSEPARIGEKMMVLLPDEE
FT                   EG"
FT   exon            33358..34209
FT                   /number=1
FT   gene            37074..37695
FT                   /gene="F15A17_150"
FT   CDS_pept        join(37074..37143,37236..37391,37691..37695)
FT                   /gene="F15A17_150"
FT                   /product="putative protein"
FT                   /db_xref="GOA:Q9LYX3"
FT                   /db_xref="UniProtKB/TrEMBL:Q9LYX3"
FT                   /protein_id="CAB86079.1"
FT                   /translation="MKSTVMMIFLIIYLLIAVPCFAKGSEQTDSEVYEIDYRGPETHNS
FT                   RPPPETMHGKPPYIHHNTSAAGLGAHVGGKN"
FT   exon            37074..37143
FT                   /number=1
FT   intron          37144..37235
FT                   /number=1
FT   exon            37236..37391
FT                   /number=2
FT   intron          37392..37690
FT                   /number=2
FT   exon            37691..37695
FT                   /number=3
FT   gene            39162..39572
FT                   /gene="F15A17_160"
FT   CDS_pept        join(39162..39263,39429..39572)
FT                   /gene="F15A17_160"
FT                   /product="putative protein"
FT                   /db_xref="GOA:Q9LYX2"
FT                   /db_xref="UniProtKB/TrEMBL:Q9LYX2"
FT                   /protein_id="CAB86080.1"
FT                   /translation="MYFTPKDGHELCHSHQCLLIWFTVRDVVLIGMKMRGWSRSSKDKH
FT                   NARAPSYIYKPLHFVVSRFLDSCSLRRMQLNLSLMM"
FT   exon            39162..39263
FT                   /number=1
FT   intron          39264..39428
FT                   /number=1
FT   exon            39429..39572
FT                   /number=2
FT   gene            40762..42897
FT                   /gene="F15A17_170"
FT   CDS_pept        complement(40762..42897)
FT                   /gene="F15A17_170"
FT                   /product="receptor like protein kinase"
FT                   /note="strong similarity to receptor like protein kinase,
FT                   Arabidopsis thaliana, EMBL:ATLECGENE"
FT                   /db_xref="GOA:Q9LYX1"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR001220"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR019825"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9LYX1"
FT                   /protein_id="CAB86081.1"
FT                   /translation="MLKLPPRFFSVYSTLIHILASFLCSSDVRGDFPATRFDLGTLTLS
FT                   SLKLLGDAHLNNGTIKLTRELSVPTSTAGKALYGKPVKFRHPETKSPASFTTYFSFSVT
FT                   NLNPSSIGGGLAFVISPDEDYLGSTGGFLGLTEETGSGSGFVAVEFDTLMDVQFKDVNG
FT                   NHVGLDLNAVVSAAVADLGNVDIDLKSGNAVNSWITYDGSGRVLTVYVSYSNLKPKSPI
FT                   LSVPLDLDRYVSDSMFVGFSGSTQGSTEIHSVDWWSFSSSFEESSESPPPMPNSPPPSS
FT                   PSSSITPSLSTVRRKTADPSSSCRNKLCKKSPAAVAGVVTAGAFFLALFAGVIIWVYSK
FT                   KIKYTRKSESLASEIMKSPREFTYKELKLATDCFSSSRVIGNGAFGTVYKGILQDSGEI
FT                   IAIKRCSHISQGNTEFLSELSLIGTLRHRNLLRLQGYCREKGEILLIYDLMPNGSLDKA
FT                   LYESPTTLPWPHRRKILLGVASALAYLHQECENQIIHRDVKTSNIMLDANFNPKLGDFG
FT                   LARQTEHDKSPDATAAAGTMGYLAPEYLLTGRATEKTDVFSYGAVVLEVCTGRRPITRP
FT                   EPEPGLRPGLRSSLVDWVWGLYREGKLLTAVDERLSEFNPEEMSRVMMVGLACSQPDPV
FT                   TRPTMRSVVQILVGEADVPEVPIAKPSSSMSFSTSELLLTLQDSVSDCNEVLAPISTTS
FT                   CSSSEHDIFIVGKDRSV"
FT   exon            complement(40762..42897)
FT                   /number=1
FT   gene            48861..51690
FT                   /gene="F15A17_180"
FT   CDS_pept        join(48861..49047,49428..49821,50654..50910,51023..51690)
FT                   /gene="F15A17_180"
FT                   /product="putative protein"
FT                   /note="strong similarity to zinc finger protein,
FT                   Arabidopsis thaliana, EMBL:AL132953"
FT                   /db_xref="GOA:Q700D2"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR033243"
FT                   /db_xref="InterPro:IPR036236"
FT                   /db_xref="PDB:5B3H"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q700D2"
FT                   /protein_id="CAB86082.1"
FT                   /translation="MQMIPGDPFSISSSMGGFVHQETHLHHLQQQIPDLNPNSNPNPNA
FT                   KPNSSSAKKKRNQPGTPDADVIALSPTTLMATNRFVCEICNKGFQRDQNLQLHRRGHNL
FT                   PWKLKQRSKQEVIKKKVYICPIKTCVHHDASRALGDLTGIKKHYSRKHGEKKWKCEKCS
FT                   KKYAVQSDWKAHAKTCGTREYKCDCGTLFSRKDSFITHRAFCDALTEEGARMSSLSNNN
FT                   PVISTTNLNFGNESNVMNNPNLPHGFVHRGVHHPDINAAISQFGLGFGHDLSAMHAQGL
FT                   SEMVQMASTGNHHLFPSSSSSLPDFSGHHQFQIPMTSTNPSLTLSSSSTSQQTSASLQH
FT                   QTLKDSSFSPLFSSSSENKQNKPLSPMSATALLQKAAQMGSTRSNSSTAPSFFAGPTMT
FT                   SSSATASPPPRSSSPMMIQQQLNNFNTNVLRENHNRAPPPLSGVSTSSVDNNPFQSNRS
FT                   GLNPAQQMGLTRDFLGVSNEHHPHQTGRRPFLPQELARFAPLG"
FT   exon            48861..49047
FT                   /number=1
FT   intron          49048..49427
FT                   /number=1
FT   exon            49428..49821
FT                   /number=2
FT   intron          49822..50653
FT                   /number=2
FT   exon            50654..50910
FT                   /number=3
FT   intron          50911..51022
FT                   /number=3
FT   exon            51023..51690
FT                   /number=4
FT   gene            53298..55683
FT                   /gene="F15A17_190"
FT   CDS_pept        join(53298..53427,53754..53919,54019..54220,54308..54468,
FT                   54553..54646,54733..54945,55022..55099,55186..55404,
FT                   55498..55683)
FT                   /gene="F15A17_190"
FT                   /product="putative protein"
FT                   /note="similarity to P58 protein, Bos primigenius taurus,
FT                   PIR:A56534"
FT                   /db_xref="GOA:Q9LYW9"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR013105"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9LYW9"
FT                   /protein_id="CAB86083.1"
FT                   /translation="MDLFRVWSGMDFLAWRGMAYTLLLLNFVFACQLLLLQPLVSALDG
FT                   QSVDAAELFERASQSIKVKRYSDALDDLNAAIEADPALSEAYFKRASVLRHFCRYEDSE
FT                   NSYQKYLEFKSGDSNAEKELSQLHQAKSALETASTLYESKDIAKALEFVDKVVLVFSPA
FT                   CSKAKLLKVKLLMVSKDYSGAISETGYILKEDENNLEALLLRGRAYYYLADHDIAQRHY
FT                   QKGLRLDPEHSELKKAYFGLKKLLKKTKSAEDNANKGKLRVSAEEYKEAIALDPEHTAN
FT                   NVHLYLGLCKVSVRLGRGKDGLNSCNEALNIDAELIEALHQRGEAKLLLEDWEGAVEDL
FT                   KQAAQNSQDMEIHESLGKAEKALKMSKRKDWYKILGISRTASISEIKKAYKKLALQWHP
FT                   DKNVGNREEAENKFREIAAAYEILGDDDKRARFDRGEDLEDMGGGGGGGYNPFHGGGGG
FT                   GQQYTFHFEGGFPGGGGGFGGFGF"
FT   exon            53298..53427
FT                   /number=1
FT   intron          53428..53753
FT                   /number=1
FT   exon            53754..53919
FT                   /number=2
FT   intron          53920..54018
FT                   /number=2
FT   exon            54019..54220
FT                   /number=3
FT   intron          54221..54307
FT                   /number=3
FT   exon            54308..54468
FT                   /number=4
FT   intron          54469..54552
FT                   /number=4
FT   exon            54553..54646
FT                   /number=5
FT   intron          54647..54732
FT                   /number=5
FT   exon            54733..54945
FT                   /number=6
FT   intron          54946..55021
FT                   /number=6
FT   exon            55022..55099
FT                   /number=7
FT   intron          55100..55185
FT                   /number=7
FT   exon            55186..55404
FT                   /number=8
FT   intron          55405..55497
FT                   /number=8
FT   exon            55498..55683
FT                   /number=9
FT   gene            55910..56650
FT                   /gene="F15A17_200"
FT   CDS_pept        complement(55910..56650)
FT                   /gene="F15A17_200"
FT                   /product="arabinogalactan protein-like"
FT                   /note="strong similarity to arabinogalactan protein
FT                   Pop14A9, Populus alba x Populus tremula, EMBL:AF183809"
FT                   /db_xref="GOA:Q8LEJ6"
FT                   /db_xref="InterPro:IPR000782"
FT                   /db_xref="InterPro:IPR036378"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8LEJ6"
FT                   /protein_id="CAB86084.1"
FT                   /translation="MATSRTFIFSNLFIFFLVIATTYGQAPAPGPSGPTNITAILEKAG
FT                   QFTLFIRLLKSTQASDQINTQLNSSSSNGLTVFAPTDNAFNSLKSGTLNSLSDQQKVQL
FT                   VQFHVLPTLITMPQFQTVSNPLRTQAGDGQNGKFPLNITSSGNQVNITTGVVSATVANS
FT                   VYSDKQLAVYQVDQVLLPLAMFGSSVAPAPAPEKGGSVSKGSASGGDDGGDSTDSSDAE
FT                   RTGFGFGIRITTVAAIAASSSLWI"
FT   exon            complement(55910..56650)
FT                   /number=1
FT   gene            57213..59417
FT                   /gene="F15A17_210"
FT   CDS_pept        complement(join(57213..57362,57463..57554,57638..58093,
FT                   58174..58342,58501..58956,59346..59417))
FT                   /gene="F15A17_210"
FT                   /product="putative protein"
FT                   /note="similarity to various predicted proteins,
FT                   Arabidopsis thaliana"
FT                   /db_xref="GOA:Q9LYW7"
FT                   /db_xref="InterPro:IPR011016"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR033275"
FT                   /db_xref="UniProtKB/TrEMBL:Q9LYW7"
FT                   /protein_id="CAB86085.1"
FT                   /translation="MDDKDKYREVVEHWSCEGTSPALMVGDSTEITEMLSPSQHQRWRG
FT                   LVLDIQSREAHGDFLRANGSLIHSPVSKRFKFSPMSSPRTGRRVGSMSPSSSRNRTNQK
FT                   NFKNRNHSADIEEGVVSPLGDGSDKSYIPRTWSLTNLLAPRKSKKTESFITHSNPESMN
FT                   GRYAVEVDPVTSMKGERLLPIRRTRSVPTFFNKDGSVKPSSVFRVIPTPSRGDEKRLEM
FT                   TQASKLSKLHDENDDGGEDVPEEEAVCRICMVEMEEDEEAFKMECMCKGELALAHKTCT
FT                   IKWFTIKGNITCDVCKQEVRNLPVTLLRVQDSQNRSRAARDIEISRFNNVWQDIPILVI
FT                   VSMLAYFCFLEQLLIIDMKSSAVAIALPFSCIIGLLASMISTTMVKKNYVWIYATVQFG
FT                   FVVLFAQLFYRVVRFDVKQPVMCIVLATMIGFGLTMTGTTAINEYLKWRRSNSHLPEEP
FT                   ASTQVV"
FT   exon            complement(57213..57362)
FT                   /number=1
FT   intron          complement(57363..57462)
FT                   /number=1
FT   exon            complement(57463..57554)
FT                   /number=2
FT   intron          complement(57555..57637)
FT                   /number=2
FT   exon            complement(57638..58093)
FT                   /number=3
FT   intron          complement(58094..58173)
FT                   /number=3
FT   exon            complement(58174..58342)
FT                   /number=4
FT   intron          complement(58343..58500)
FT                   /number=4
FT   exon            complement(58501..58956)
FT                   /number=5
FT   intron          complement(58957..59345)
FT                   /number=5
FT   exon            complement(59346..59417)
FT                   /number=6
FT   gene            61805..63160
FT                   /gene="F15A17_220"
FT   CDS_pept        61805..63160
FT                   /gene="F15A17_220"
FT                   /product="putative protein"
FT                   /note="There appears to be an extra residue at position
FT                   63159 which causes a frameshift and the introduction of a
FT                   small intron in the gene models. EST data supports this
FT                   observation. Nancy Terryn asked to check this sequence."
FT                   /note="similarity to various predicted proteins,
FT                   Arabidopsis thaliana"
FT                   /db_xref="GOA:Q9LYW6"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q9LYW6"
FT                   /protein_id="CAB86086.1"
FT                   /translation="MGIKILKLNIFRGSTNRHALFRALIIASALSVVPLLELTAKNHVF
FT                   GDHGAVDLVDLGRFVIPGPKLFFHKLVQPFWGKIETEKYPQVVIADLVDELMGLKLLHY
FT                   DAKILCIGQGSDSAVSGFKEMGFSVVQGVPKHPLFSFFSRKHVNELELSGDKSFDFVLC
FT                   GDVDHVASPALLVLEMERVLKPGGTGAVLVSTNANRLVKSVTSGLKQSEIVRVNNLDKF
FT                   TVIVFKRNVTETAYCIGKSQLPRDCKSVDTNRPYTEFMEPLLEQKPADFPKSVAYLPKF
FT                   LDLSLKKSLVYIDIGAAEHMDANLTPNWFFPLYPLDSKAFNVYFVDHNTSVMLSYVKKP
FT                   GVTFVYHPDLAENNSTGKKITPLEQLEPFPEDERFDFLAWFEETAKYADFVVLKMNTNQ
FT                   VEMKFLTVLLETGVICYVDELFLRCSNHKSDCINMLQTLRARGVFVHQWWED"
FT   exon            61805..63160
FT                   /number=1
FT   gene            63462..64679
FT                   /gene="F15A17_230"
FT   CDS_pept        complement(join(63462..63566,63654..64119,64237..64679))
FT                   /gene="F15A17_230"
FT                   /product="putative protein"
FT                   /note="similarity to various predicted proteins,
FT                   Arabidopsis thaliana"
FT                   /db_xref="GOA:Q9LYW5"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9LYW5"
FT                   /protein_id="CAB86087.1"
FT                   /translation="MGNLISLIFCCGRRQRSNIPPAMETAPLELPPNRFVFAAVPPYLN
FT                   PNPNYVDQYPGNCLPPPVTEPPMLPYNFNHLHHYPPNSYQLPHPLFHGGRYPILPPPTY
FT                   VHQKAVTIRNDVNLKKKTLTLIPDPENPNRLLVSFTFDASMPGRITVVFFATEDAECNL
FT                   RATKEDTLPPITFDFGEGLGQKFIQSSGTGIDLTAFKDSELFKEVDTDVFPLAVKAEAT
FT                   PAEEGKSGSTNVQITQVVYTKEKGEIKIEVVKQILWVNKRRYELLEIYGIENTVDGSDE
FT                   GKECVVCLSEPRDTTVLPCRHMCMCSGCAKALRFQTNLCPVCRQPVEMLLEINKNG"
FT   exon            complement(63462..63566)
FT                   /number=1
FT   intron          complement(63567..63653)
FT                   /number=1
FT   exon            complement(63654..64119)
FT                   /number=2
FT   intron          complement(64120..64236)
FT                   /number=2
FT   exon            complement(64237..64679)
FT                   /number=3
FT   gene            66082..66207
FT                   /gene="F15A17_240"
FT   CDS_pept        complement(66082..66207)
FT                   /gene="F15A17_240"
FT                   /product="putative protein"
FT                   /db_xref="UniProtKB/TrEMBL:Q9LYW4"
FT                   /protein_id="CAB86088.1"
FT                   /translation="MEAVPPQIISPAKPSVSPILETILEGGETEEDNQEQENEDV"
FT   exon            complement(66082..66207)
FT                   /number=1
FT   gene            70629..71596
FT                   /gene="F15A17_250"
FT   CDS_pept        complement(join(70629..70689,70819..70892,70980..71146,
FT                   71311..71380,71462..71596))
FT                   /gene="F15A17_250"
FT                   /product="putative protein"
FT                   /note="similarity to MED7, Homo sapiens, EMBL:AF031383"
FT                   /db_xref="GOA:Q9LYW3"
FT                   /db_xref="InterPro:IPR009244"
FT                   /db_xref="InterPro:IPR037212"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9LYW3"
FT                   /protein_id="CAB86089.1"
FT                   /translation="MATATYPPPPPYYRLYKDYSENPNSAPEPPPPIEGTYVCFGGNYT
FT                   TEDVLPSLEEQGVPQLYPKDSNLDYKNELRSLNRELQLHILELADVLVDRPSQYAKRIG
FT                   EISSIFKNLHHLLNSLRPHQARATLIHIMELQIQQRKQAVEDIKRRREEAQRLLKDAYL
FT                   TLDGQ"
FT   exon            complement(70629..70689)
FT                   /number=1
FT   intron          complement(70690..70818)
FT                   /number=1
FT   exon            complement(70819..70892)
FT                   /number=2
FT   intron          complement(70893..70979)
FT                   /number=2
FT   exon            complement(70980..71146)
FT                   /number=3
FT   intron          complement(71147..71310)
FT                   /number=3
FT   exon            complement(71311..71380)
FT                   /number=4
FT   intron          complement(71381..71461)
FT                   /number=4
FT   exon            complement(71462..71596)
FT                   /number=5
FT   gene            72648..73148
FT                   /gene="F15A17_260"
FT   CDS_pept        72648..73148
FT                   /gene="F15A17_260"
FT                   /product="putative protein"
FT                   /note="similarity to various predicted proteins,
FT                   Arabidopsis thaliana"
FT                   /db_xref="InterPro:IPR007608"
FT                   /db_xref="UniProtKB/TrEMBL:Q9LYW2"
FT                   /protein_id="CAB86090.1"
FT                   /translation="MASRKLFFVKPKYIYPEPKPEMSDENVFEFDESDIHNLGDHQLPN
FT                   SFDAKRSISISRLRRKPTKTGDSGNREITKTGSLPVNIPDWSKILKSEYRGHAIPDDDS
FT                   DDDDEDDDDSNDGGRRMIPPHEYLARRRGSSFTVHEGIGGTAKGRDLRRLRNAIWEKIG
FT                   FQD"
FT   exon            72648..73148
FT                   /number=1
FT   gene            74988..75908
FT                   /gene="F15A17_270"
FT   CDS_pept        complement(74988..75908)
FT                   /gene="F15A17_270"
FT                   /product="polyubiquitin (ubq3)"
FT                   /db_xref="GOA:Q1EC66"
FT                   /db_xref="InterPro:IPR000626"
FT                   /db_xref="InterPro:IPR019954"
FT                   /db_xref="InterPro:IPR019956"
FT                   /db_xref="InterPro:IPR029071"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1EC66"
FT                   /protein_id="CAB86091.1"
FT                   /translation="MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF
FT                   AGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
FT                   KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
FT                   TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV
FT                   LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
FT                   RTLADYNIQKESTLHLVLRLRGGSF"
FT   exon            complement(74988..75908)
FT                   /number=1
FT   gene            77603..79867
FT                   /gene="F15A17_280"
FT   CDS_pept        join(77603..77661,77962..78031,78144..79367,79442..79867)
FT                   /gene="F15A17_280"
FT                   /product="photoreceptor-interacting protein-like"
FT                   /note="strong similarity to non-phototropic hypocotyl 3,
FT                   Arabidopsis thaliana, EMBL:AF180390"
FT                   /db_xref="GOA:Q9LYW0"
FT                   /db_xref="InterPro:IPR000210"
FT                   /db_xref="InterPro:IPR011333"
FT                   /db_xref="InterPro:IPR027356"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9LYW0"
FT                   /protein_id="CAB86092.1"
FT                   /translation="MAFMRLGSKSEAFHREGQTWLCTTGLVSDVTIEVGDMKFHLHKFP
FT                   LLSRSGLLERLIEESSTDDGSGCVLSLDEIPGGGKTFELVTKFCYGVKIELTAFNVVSL
FT                   RCAAEYLEMTDNYGEGNLVGMTETFLNEVFGNWTDSIKALQTCEEVIDYAEDLHIISRC
FT                   VDSLAVKACADPSLFNWPVGGGKNATSGQNTEDESHLWNGISASGKMLQHTGEDWWFDD
FT                   ASFLSLPLFKRLITAIEARGMKLENIAMAVMYYTRKHVPLMNRQVNMDEQVIETPNPSE
FT                   EDQKTCLEEIVGLLPSKKGVNPTKFLLRLLQTAMVLHASQSSRENLERRIGNQLDQAAL
FT                   VDLLIPNMGYSETLYDVECVLRMIEQFVSSTEQAGIVPSPCIIEEGHLVKDGADLLTPT
FT                   TLVATLVDGYLAEVAPDVNLKLAKFEAIAAAIPDYARPLDDGVYHAIDVYLKAHPWITD
FT                   SEREHICRLMNCQKLSLEASTHAAQNERLPLRVIVQVLFFEQLRLRTSVSGWFFVSENL
FT                   DNPDNQHGANGGLLKPRGENVRERVSELEKECMNMKQELHKLVRTKRSWKNFTRKLNFK
FT                   KKSECCKPKDQATPAI"
FT   exon            77603..77661
FT                   /number=1
FT   intron          77662..77961
FT                   /number=1
FT   exon            77962..78031
FT                   /number=2
FT   intron          78032..78143
FT                   /number=2
FT   exon            78144..79367
FT                   /number=3
FT   intron          79368..79441
FT                   /number=3
FT   exon            79442..79867
FT                   /number=4
FT   gene            80210..82344
FT                   /gene="F15A17_290"
FT   CDS_pept        complement(join(80210..80340,80432..81355,81448..81576,
FT                   81666..81910,81997..82148,82258..82344))
FT                   /gene="F15A17_290"
FT                   /product="laccase precursor-like"
FT                   /note="strong similarity to laccase precursor, common
FT                   tobacco, PIR:JC5229"
FT                   /db_xref="GOA:Q8VZA1"
FT                   /db_xref="InterPro:IPR001117"
FT                   /db_xref="InterPro:IPR002355"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR011706"
FT                   /db_xref="InterPro:IPR011707"
FT                   /db_xref="InterPro:IPR017761"
FT                   /db_xref="InterPro:IPR033138"
FT                   /db_xref="InterPro:IPR034285"
FT                   /db_xref="InterPro:IPR034288"
FT                   /db_xref="InterPro:IPR034289"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8VZA1"
FT                   /protein_id="CAB86093.1"
FT                   /translation="MGFLFLFCYLLAFLGYSPVDAAVKKYQFDVQVKNISRICNAKPIV
FT                   TVNGMFPGPTVYAREGDRVIINVTNHVQYNMSIHWHGLKQYRNGWADGPAYITQCPIQT
FT                   GQSYLYDFNVTGQRGTLWWHAHILWLRATVYGAIVILPAPGKPYPFPQPYQESNIILGE
FT                   WWNKDVETAVNQANQLGAPPPMSDAHTINGKPGPLFPCSEKHTFVIEAEAGKTYLLRII
FT                   NAALNDELFFGIAGHNMTVVEIDAVYTKPFTTKAILLGPGQTTNVLVKTDRSPNRYFMA
FT                   ASPFMDAPVSVDNKTVTAILQYKGVPNTVLPILPKLPLPNDTSFALDYNGKLKSLNTPN
FT                   FPALVPLKVDRRLFYTIGLGINACPTCVNGTNLAASINNITFIMPKTALLKAHYSNISG
FT                   VFRTDFPDRPPKAFNYTGVPLTANLGTSTGTRLSRVKFNTTIELVLQDTNLLTVESHPF
FT                   HLHGYNFFVVGTGVGNFDPKKDPAKFNLVDPPERNTVGVPTGGWAAIRFRADNPGVWFM
FT                   HCHLEVHTMWGLKMAFVVENGETPELSVLPPPKDYPSC"
FT   exon            complement(80210..80340)
FT                   /number=1
FT   intron          complement(80341..80431)
FT                   /number=1
FT   exon            complement(80432..81355)
FT                   /number=2
FT   intron          complement(81356..81447)
FT                   /number=2
FT   exon            complement(81448..81576)
FT                   /number=3
FT   intron          complement(81577..81665)
FT                   /number=3
FT   exon            complement(81666..81910)
FT                   /number=4
FT   intron          complement(81911..81996)
FT                   /number=4
FT   exon            complement(81997..82148)
FT                   /number=5
FT   intron          complement(82149..82257)
FT                   /number=5
FT   exon            complement(82258..82344)
FT                   /number=6
FT   gene            84882..87009
FT                   /gene="F15A17_300"
FT   CDS_pept        join(84882..85019,85256..85345,85554..85725,86551..86621,
FT                   86702..86845,86935..87009)
FT                   /gene="F15A17_300"
FT                   /product="lysine decarboxylase-like protein"
FT                   /note="similarity to lysine decarboxylase, Eikenella
FT                   corrodens, EMBL:U89166"
FT                   /db_xref="GOA:Q9LYV8"
FT                   /db_xref="InterPro:IPR005269"
FT                   /db_xref="InterPro:IPR031100"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9LYV8"
FT                   /protein_id="CAB86094.1"
FT                   /translation="MENEEGKREMTKKQSSRFKSICVFCGSSNGNKASYQDAAIDLAKE
FT                   LVMRKIDLVYGGGSIGLMGLVSQAVHDGGRHNNNNNGNDDALFCHSVNVSQTNSKLTGE
FT                   TVGEVKEVADMHQRKAVMAKHSDAFITLPGGYGTLEELLEVITWAQLGIHDKPVGLLNV
FT                   DGYYDALLLFIDKAVEEGFILPTARHIIVSAPTARELFIKLELNMVSLDRISKHALSLF
FT                   QVMSKAG"
FT   exon            84882..85019
FT                   /number=1
FT   intron          85020..85255
FT                   /number=1
FT   exon            85256..85345
FT                   /number=2
FT   intron          85346..85553
FT                   /number=2
FT   exon            85554..85725
FT                   /number=3
FT   intron          85726..86550
FT                   /number=3
FT   exon            86551..86621
FT                   /number=4
FT   intron          86622..86701
FT                   /number=4
FT   exon            86702..86845
FT                   /number=5
FT   intron          86846..86934
FT                   /number=5
FT   exon            86935..87009
FT                   /number=6
FT   misc_feature    89201..99008
FT                   /note="Overlap with BAC F12E4. Please refer to this BAC for
FT                   analysis and annotation."
XX
SQ   Sequence 99008 BP; 31410 A; 17597 C; 18391 G; 31610 T; 0 other;
     cgcacacaga agaaatgtgc aaccaacggt gtcctttctt ggctcatgtc aatgtacagt        60
     gaagccgaat gtgaactaat cggatttcga aaacccattc acatatggca ggtgagttct       120
     gcaccataca atgcatcagt tagtttgttt agtaaagtta atcaaacctt gatttctgtt       180
     tctttaaagg gaatggagga tcgagtggct ccaccatcaa tgagtgacta cattagcaga       240
     atgattcctg aagcaactgt acataagatt cgaaacgaag gtcacttctc gttcttctat       300
     ttctgcgatg agtgccatag acagatcttc tatgctttgt ttggagaacc caaaggccag       360
     cttgaaagag taaaagaaac agaggacact gtagtggaaa cagaggcaca taaggacact       420
     tagtactaat acaaccacca aaaaaagagt aaagaagtaa aaaaggaaag gtgaaaatta       480
     gctatagcta gaaaatcaaa aactagatat tttttgtttc atatttttta ggggttacac       540
     caagcagaat tttatactag atggcatttt acattcctaa agatgattta tcaatggttt       600
     tattagataa gtgagctata tttaatgaca tgctcaagca acctttatat ttcgttgttg       660
     ttctcttgac tttcccatgc taaatgtttt ttagacgtgt gcttttgcat tcaccgccta       720
     ggaaataaaa agttgataat ataaccgtaa taaaaaatat ttaaaaatta attacgataa       780
     tctcgaaata tattttaaaa actatcataa attccccaca atatcataag agatcacaga       840
     gatacaaaaa ttctattcaa taaaagcttc cgaaatctag gcgtagtaat cagaatttta       900
     gttttaacct gaaggtgctc cataataaat aaataaaatc tcatatttta caaagcacag       960
     aaaccctaag tcatctgaga gatagataat gaaaacggaa gagatgaatg aatcatcaga      1020
     gtctcctcct ccttctcgta cgttttcttc gttaccatac gacatcatac tcaattgttt      1080
     ggctcgtgtc tcgagatacc attacccaac tctatctctc gtctccaagg agttccaatc      1140
     tctcatcgcc tcccgtgagc tctacgctac acgatcccgc atcggaaaaa ccgagaggtt      1200
     cctctatatc tgcttaaacc tgactaagag caaccctaag tatcgctggt tcacacttcc      1260
     cccagttccc aacgaacaaa aactactacc cgtccctttg tttacttatc atctcaattc      1320
     ctcaaccgtc tcctcaactg attcagagat ttacataatc ggaggcctcg tttggggaaa      1380
     tagaagcaag aaagcgtcca tttttgactg tcgatctcat caaacgcgta gactcccaaa      1440
     aatgcgtttt cctcgagctt ctgctgccgc tcatgtcatt gacggtaaga tctatgttat      1500
     tggaggcggc gagattcggg gagaggttta tgacccaacg acccaaactt ggctcacaac      1560
     accagtagat cacaccactg aagagtgtca aaaagtttat gacaagcatg gcgtgaatat      1620
     ttgctttgta gagatagaca acttgctgtg ccaaacattt gtattcaacg ggaagctata      1680
     ttggcgtcat ccaaggggag atgattttgg ctgggctagg gttaagggag tggaacagga      1740
     actcttccgt aatcatcttt cttatgtgga caaatccggc ggaggaagaa gagtgacagt      1800
     gtggtggaag tctgtggtgg tgtttggctg tcaaggtctt ggctattcta cggaatttga      1860
     tacagagatt tggtgtgcag agatttcgtt tgagagacgc ggtttaaaag agctttgggg      1920
     atttgtagaa tggtctagaa aagtgttcac atgtaaggga tgtgattctc ctacggattt      1980
     tgttatggat tctgtccttg tgacatattg atcaatggga tgtatttttg ttttttttag      2040
     attttttctg tgaggagtct ttttagtata attcgagaat ttaagagaca ataaacagct      2100
     tgtgtgtctc ttaataagca aataatttaa gaacataaac atcaacacac ttgtgaaaga      2160
     atttggtaat tagtcctcga atttagacct tcaattatgt gaaaatttta ctaacgttcc      2220
     ttcgtttcaa tacacaagat tagactatta tgactttgtt tggtttgtga gcacaactca      2280
     tatatagggg ttgtatgctt ggttggtata gaaatattgg attctgattt ttgtacatca      2340
     ataacacttc ctaggggttg cttctttaca tgaaaccggc cgatagcaaa acaaagccta      2400
     tggccggttt cgattgagag cagagctggc cctgaccaca gccaattgaa ataattgcta      2460
     tggcccatta attctcagga ccggccctga ttgagagacg tggtctgaca gagctttggg      2520
     gatgtgttga atggtctaag aatgtgttta cctttgacgg gtgtgaccct cgttccgatt      2580
     tcttcttgaa ttctgcgatt agcacacatt aattgatatg tccaagtatt tttaggatca      2640
     ttagatagat tctgcttatg agattttgtt gtagtatctg agagagtttt atattttctt      2700
     tgtcgggaat gtttttgaac atcttgagta tgttttcaag agatgcatga tgataaaaaa      2760
     aattacatga atgtaactct aaattactaa ataagcatgt ggcctaagaa cataaaatat      2820
     cgacccacca cttgtgaaag gttttgtcgt tgggttaggt aatggtactt gaaatcttgt      2880
     ttgaaatagt gttctcgaat ttagaccttt cacgatatgt tatttattat tgttccttcg      2940
     tttcaattct tctttctcac acaagatttg actacgattt tttctttttg tatacacaga      3000
     tttattttga tcatataatt ccttggccgg tcaaaaaggc tcatttaaat aaaagcccat      3060
     cagaccttga attcctctct aattgatgat taggtttttt tttgggtaaa gtaatgatga      3120
     ttagggttta aagactcaaa tgaagaaaaa aaatcgaaac acaaacgacg acggaagaga      3180
     tgagctcccc gaaatcatca tcatcagagt cctcgtctcc tccgacgtcg ttttcgtcgt      3240
     taccgttcga cgtagctctg aattgttggg ctcgtgtctc gagaatccat tatccaactc      3300
     tattcttagt ctccaagaat ttaagatctc tcatcgcttc gcctgagctc gaggccacac      3360
     gactccgcat tggaataaca gaagatttcg tttgcttaga cctcaataag aaaaacccta      3420
     accctagctg gttcatactt tcctcaactc caaaacaaca gaagttacta cccatccctt      3480
     cgtttcctta tcaacatccc aaatactcga ccattctttt agtcgattca ttgatttaca      3540
     ttatcggagg catcgtgaat agacaaagga gcaatagagt gttgatactc aattctctat      3600
     ctcaccaatg gagtagtctc ccaaacattg cgcctacctc gagtttctcc agccgctgat      3660
     gtaatcgacg gtaagttgta cgtgattgga ggctcttcgt ccaaaaatat cggggattgg      3720
     ggagaggttt atgatccaaa gacacatact tgggagccaa tattgcctac aacactagat      3780
     ctcacagctc aaaagagtgt ggttcaagat agattagtaa tgggtggaaa ggtttatgcc      3840
     atggatggtt tgaagattga gctaaagacg aatatttgtt tggtagagaa atgtttgcgt      3900
     ctagtgtcgt attccaatca tagtctttat tggaatgatc caacggaaga ttgtgtgtgg      3960
     aggttggttc gagggcttga agaactttgt gatcattatc catatttttt taataatcat      4020
     aattcgcttg caaactccgg cggagaaaga agcgtgacat tgtggtggaa gtcggtggtg      4080
     attcaacctc caaattacca ttgcactaag gagtgtaaaa cagagatttg gtgtgcaggg      4140
     ctttcgtttg agagacgtgg tctaaaagag ctttggggat ttgttgaatg gtctaagaat      4200
     atgtttacct ttgaagaatg tgactctcgt ttcgatttcc ttttgcatta attcacacat      4260
     taattgatat gtccaaggat ttttaggatc attgatagac taagaggatt taaggttttc      4320
     ttttatttta ttttattttt aatgattttc taatagagat tttatattta ctatatattt      4380
     tgtcacagat atcaaaaact gattgtaaaa atttatttat tgttttggat aaatctaaat      4440
     taattatttt cttgaagttt ataattcacc atcaatagtc agtaactaat aaaaatgcat      4500
     taaaacaaca agtctattaa ttctaggttt tcttcgtaaa ttagtttgaa ggtataaaac      4560
     cctaattcga aaacctcccc aaatcaggaa ataatgacga cgaaaaagag gaagaaataa      4620
     tcaaagtctc ctccgacgac gtttctttct ttaccagacg atatatatcg ctttcaattg      4680
     tttggctcgt atctcgagat tccattatcc aactctatca ctcgtctcca agggtttccg      4740
     atcactcatc gcttcgcctg agctcgaggc cacacgttcc ttcattgggg aaaccgagaa      4800
     tcacctttgt gtctgcttaa acctcaacaa gaacaacaac tataatcctc gctggttcac      4860
     actttccccg atagccaaac agaaattgaa atccatccct tggcatcgtc atcaatatcc      4920
     caaatcctca acagttgttg caaatggttc agatatttac atagtcggag gcttcgtttg      4980
     cggaacaagt agcaagagag tatttgtttt cgatagtcga tctcatcaat ggcgtagact      5040
     ccacgacatg cgtttacctc gtgtttctgc agttgtaaat atagttgaca agaagatcta      5100
     tgttattgga ggctacaagc ccaggaatat caaagattgt ggagaggttt atgatccaaa      5160
     tacccaaact tgggagccat tattgcccac gacagtaaat ctcaccattc aaaactgtgt      5220
     ggtttcaggt ggcttggtaa tgggcgggaa acgttataca acgaatggca cgaaaatgaa      5280
     cacttgcttt gtagagttag agaacttgct gttgggtcta agtgaaacgt atagagatct      5340
     agtgtggcgt gaactgaagg aagatgtttg gcgtgtggtt aggggacttg aacaactgtc      5400
     tcacaatcaa aattttactt atgtgggaaa ctccggcgga gggagaagag tggccatttg      5460
     gtggaagtcg atggtggtgt ttcgccctcg aggtcgtagc cactcgacta agaaatgtaa      5520
     aacggagatt tggtgtgcag aaatttcagt tgagagacgc ggtttaggag agctttgggg      5580
     aagatttagt tttagttttc gagatagttt tatatatatt tttttgtggg agtttttttg      5640
     aacatcttga atctgatttc aagagataat acacaaaatt aaattggtgt tgtatctcta      5700
     aattactaaa taagcagttg cctaagaaca taaatatcat cccacgctac ttgtgaaaga      5760
     gtttatcgtt gggttaggta tgacctttaa ctcttgcgtg aaataatgtt ctcgaattta      5820
     gaccttccac tatatgtccc ttcgcttcaa ttcttgtttc tcatatacaa gatttgacta      5880
     tggggttttc tttttgttcg caacgcacga atttattttg atcatattcc ttggttggta      5940
     aatatttgga ttataatgtt gcatatcaat aacacctcct tggtttgctt tttctaatgc      6000
     atctatgaaa cccggtagcg agaatatctc tctattttat attataaaag tttaatcgtg      6060
     atattcttaa aactatctta gatctcggaa attttcctaa atttccattt ataaatgttt      6120
     ccgaaatttt agggtttagc ttagtcgtag taaacatgcg ttgatgctag acctagacgg      6180
     agtaaaataa ataaatagat cgaaggtaaa aaaagctcct atctaaaatc aaagcacaga      6240
     aaccctaaag cctcccagaa aggcagaaac agaacaccat gttttgctcg tgtctcgaga      6300
     ttgttttttt ccttgccgga agacatcatt ctcaatttcc atcgttaccg gacgaaaatg      6360
     agacgaacaa atcatcagac tctcctccga cagtattttc atcgttaccg gacgaattaa      6420
     ttctcaattg tttggctcgt gtctcgagat tctaccgtcc atctctgtcc ttggtcaaca      6480
     aggaattcca atctctcatc gcttctcctg atctcgaggc cacgcgctcc cgcataggag      6540
     taacagagaa tcacctctat gtctgcttgg agtcgaataa gaacaaccct aatcctcgct      6600
     ggttcacact tgcaccaatt cccaaagaac agaaagtgaa acctatcatc ccttcgtttc      6660
     cttatcaaca tcccacatca tcaacttttg tctctattgg ctcagagatt tacatcatcg      6720
     gaggcttcgt taagcgaaag agaagcagga gagtcttggt tctcgattgt cgatctcatc      6780
     aatgtcgtag gctccccaac atggctctac ctcgagtttc tgcagccgct gatgtcatcg      6840
     acggtaagat ctacgtggtt ggaggatcaa agtctaaaaa tatcgacaat tggggagaag      6900
     tttttgatcc agagacccaa acgtgggagc caatatttcc cacaacagtt gatctcacca      6960
     ctcaaaagag tgtgtttcca ggtaaattgg ttatgggtgg gaaagtttat gacatggatg      7020
     ggttgaaagt taacttgaac ctgaatagtt gcgtggtaga gatagacaac atgatgtgcc      7080
     aaatatcagt ttgcaaaggg atactagttt ggtatgattc agaggaagat ttggtgtgga      7140
     ataaggtaag aggacttgaa ggactactgc cccgtaattc atattttcct tgctatcttg      7200
     tttcggttgc aaatcatgac cgaggaagaa gagtgacagt ttggtggcag tcgatggtgt      7260
     ttgaccgtct aggtctcgat tggactaagg aaggtaaaac ggagatttgg tgtgccgaga      7320
     tatcgttgga gagacgcggt tttggagagc tttggggatt cgtcgaatgg tcaaagaaag      7380
     tgtttactta tgacggatgt gattctcctt cagatttctt tttgcattcc gctattgtga      7440
     cttattgatt aggatttgtt ggaatgtttc tagaacattt attactattg actttgattt      7500
     caattattga actttttctt ttcgtatcaa tcatttgctt tcatttgtag tttctttaca      7560
     caagattgtc tttgaatgtt aatattttgt agtggctaca aaacaagtaa atctaatcaa      7620
     tagaggccca tttaaggccc attaaacctt gaatattaaa aattgattca gagttagaaa      7680
     aagaaaagaa acacatgacc cctaaatcga gaggcttcgt taggagaagg agaagcagaa      7740
     gagtgttggt tctcgattgt cgatctcaac aatggcgtag tctccccaaa atgcgtcaac      7800
     ctcgagcttc tcctgccgcg tatgttaagg atggtctgat cattgtgatt ggaggttgca      7860
     ggtccaagaa tatcgagact tggggagaga tttatgatct aaagaccaat acttgggggc      7920
     gaatactgct ccaatcacat gatcccacag ttcaaaatgc ttacttgaat cgctttaaac      7980
     ctaacttgca gacgaatgct tgctatgtag agattgacaa ggtgtcgtgc ctgatatttt      8040
     tatccgatgg gaagctattt tggcgtgaaa caaagcaagg ttttgagagg tgtagtgtta      8100
     tattgggaga tgatgagcaa gtgtcctctt atcaacttgt ttcggtggca aacgccgccg      8160
     gaggaggaag agtgacagtt tggtggaagt cggggttaaa agttctggat ctcttaagtg      8220
     gcactgagac ttgggaatgt tacacaaata ttcggtgtgc agagatttcg tttgagagaa      8280
     gaggtttaag agagctttgg ggattcgttg aatggtctag agaggtgttt accgttgatg      8340
     gatatgacga tacttacgat ttctttttaa attctgctat tgtgacctat tgatcagtgg      8400
     gactttatct tacttgtact gtgggaattt tgagtatgat tttaatagat aaataaatgt      8460
     gatttgctaa caacattaca acatagatct aagcattcaa ggttgtgtgg tgcctgatgg      8520
     cttttgatga aggggaggtt ttctactttg tatcagactt ttgcttgcta gtgaaagaga      8580
     gaataatggg cacaacattt ttgttactcc atgggaaaga taatgtagag tggtctcaag      8640
     gaaaaaatgg tgtggagagt ggtcaaggga cttggattgc caaacattgt gtttcagttt      8700
     ggtggtgtac aatgttggat cacccctatg gtcgtaaagt gcagatttcg cagagctttc      8760
     caagggaatc atagaatcgt caacagagtt gtgtttcgaa ccaaaggatg tatatttcgt      8820
     tccactttct tcttgcactc tgctacagta acacatggat ttgtatgctc tcatgggagt      8880
     gtacaaactc ctagtgattg gtgtttttat ttgtcctttg gaatgcttaa agaatgatat      8940
     acaacagcag gaagaaatca tagcacattc attacaaaac caatggaaaa tacatacttt      9000
     ttgttgaggt cgtatcagaa acatgacaat caaaaggcag agccggtgtt gttggatttt      9060
     cgaagcatca tatctttggc ttcattaatc ttagaagcca gatagtgact gcctccagcg      9120
     tccgggtgat tgatgtaagt cttaggtcta agacatgagt aatagaggaa agagttgtat      9180
     aagtatatgt gaaagaatgt gtaataagat ttaacaatgt acaagttaag caaagcgttt      9240
     cccttgttgt ctctgtagaa caaagaaact aaatctgtgt gagagataga gatgaagaga      9300
     actaacctga gaggttagaa gtgggaaaag aaaaccaaca caatgatcaa tgtgatttta      9360
     atcttttatt cagattttaa ttattaaact ttttataaat acatctaaat ctaataaact      9420
     gttttttttg tctcatcaac aaacaagtca atttatttaa atcaataaaa taacaaagtt      9480
     aatcaattta ttgcgtaaaa tgtatttcta aatttcttta agaagaagaa aaaagtcaca      9540
     aacatttata atactttgga tatttttcct ttttagtaaa ttaaaaaaaa aactgatata      9600
     ataataataa atcaactgat attttattaa tattgatctt atttatgata tgtttatgaa      9660
     ttattgtcta aatattttga aattttgtag taattaactg gtatcaaata tctcaacggt      9720
     ttgatgctta taatcgaatt gttatagtta tgcaaaaaaa taatatcaaa aatgataatt      9780
     ttgtaatttt taaatgatat taaatatttt ggaagttttg ttttagtaac taatcgtgta      9840
     gttaatgtag aaagattttg ggaagatagt taaatgtcaa atatttaatt cgaagattta      9900
     ctttctaatt atcaaaaaca attattaaat gctagtggca gtcacagtaa ataagtctca      9960
     acttgaggat ttatttcaca aagtgattgc aaaaatgtat atgtagatga tcaatatgat     10020
     tttatttaga ttttattttt ttagcaatac atctaataaa tagttatctc atcgacaata     10080
     taagtcaatt taattcaatc aataaagaac aaagttaatc aatttatcaa aagttattta     10140
     taaaaattat cctaaatttc tttaagaaat agacaaaagt caaaagcatt tataatattt     10200
     tggatataac ttttggccat atgcatggac cctataaata ccatccttga agaagaagaa     10260
     aaaaaaaact ccgatgacgg aagagatgag taaagagtct cctcctcctc ctccgacgtc     10320
     gttttcttcg ttaccggacg acgtcgctct cgattgtcgg gctcgtatat cgagattcca     10380
     ttatccaact ctttctctcg tctccaaggg tttcagaact ctcatcgcct ccccggagct     10440
     cgaggccaca cgatccttta tcggaaaacc agagaatcac ctctgcgtct gcttgaggct     10500
     gtataaaaac cctaatcctc tctggttcat attttcccca attccgaaac agaaattgaa     10560
     acccatcgtc ccatggtttc ctaaccaaca atatcctcaa tacccgaccg ttgtctcaaa     10620
     tggttcacag atatacataa tcggtggatt cgttaggaga aggagaagca acagagtgtc     10680
     gatttttgat tatcgaactt atcaatggcg tagactcccc aaaatgcgtc aacctcgagt     10740
     ttatcccgcc gcgtctgtaa tcgacggtaa gatctatgtg attggaggct tcagaggctc     10800
     catgcccaca gatattgaga actcaggaga agtttatgat ccaaagacca atacttggga     10860
     gccaatattg ctcacatcac ttgatctcac tgttcaaaat gttttcaaga aaaaacatta     10920
     ctttacgacc aaggcatgct tagtgattaa taaggtgtcg tgcctactat atgtttccga     10980
     tgggaagcta tattggcgtg aagacaagga aggttttgag tgccgtaagg tttatggact     11040
     tgcagaacag tcctctaatc tgtttcgtgt ggtggcaaac tccggcggcg gaggaagagt     11100
     gacagtttgg tggaagtcga tgacaaaagg ttgcgagttt gactgtctgc tgactgagga     11160
     gtgtgaaacc aagatttggt gtgcagagat ttcgcttgag agaagaggtt taagagagct     11220
     tcggggattt gttgaatggt ctaaagaggt ttttaccatt gatagatgtg actatattta     11280
     cgatttcatt tcacaatacg ttactgtgac ttattgatca atgaaatgta gtaaaaactc     11340
     cttagagatt ggtgtttgta tttatcaaat gacttctttt aaaattctta aagaaataat     11400
     atacaacaag aaggagaaac atagtggtag cacattcata acagaatcaa tggaaagttc     11460
     tgttgggttc gtatcagaca catgacaaat caaaaggcag aaccgctgtt gttggatttt     11520
     ccaagcatca tatctttggc ttcattgatc ttagaagcaa gatagtgact gcctccagcg     11580
     tctgggtgat ttgcaaccat cactctccgg tgagcttcct tcaccttatc tgccacaaca     11640
     ctctccctgt tataaaaaaa ccaccacaca aacttagtca acccattcat tttaaaatca     11700
     ataatctcct acacaaccaa caatgaaaaa taggattcaa gaacataatc tatgtagttt     11760
     gctttcatct aaagggtgtt aaatcaataa cttttgacct caaataacta gcagaacaac     11820
     actataacca cattttcaaa caggattctg aagggtatat agcttctatg aatctcagcc     11880
     tcaggaccag ttcaatctga ggagcaaaaa caaaaagatg aagcaggtat aagaaagccg     11940
     gacgaaccta acaccaagaa tgagagcagc ttctcggcgg gtcatagaac tttggaaacc     12000
     accttcataa aacctgcgca ttctaggaac acgaggtctt gccttgaaag cttgccaagc     12060
     caatatacca tatctaccag caacagcagc agcagctaca gcagcacctg caatcattgg     12120
     cgtagcctgt gtatagccag aaccaataaa aaccaacgtc agatacaaaa aaaggaacac     12180
     actttggctt tggaaatcaa agataaaaaa cattcttaat tgatatcggc aaaccacaga     12240
     taagatcatc taatgtatcc attttgttgt gactttaaca taagacaaca aaaggatcct     12300
     gatctgaatt catctgaatg tgacaccaat caaacccatc tgaattctga aattttttgg     12360
     tgttgtcaac gtcgtttttg ctgtaaattt taagtttaat tcgattacaa acgaacaaga     12420
     ctgactagaa tttcaagata ctcctacaat aattcagagc gagagagaga aatagattaa     12480
     tccagcttaa acggaaacaa gatcagacca aaaaaactta ccattattca gctaagtagt     12540
     tgttcggaga aaactcaatc ggaataaaaa aaacaaaatt tcctgataaa ttcttcgatt     12600
     gtcgagtttc tcgatcgaat tggggaatgg gtttagggtt ctgggaggag agaaataaaa     12660
     attcgctgct gctttttttt tgtttttttt ttgcgtgggc aggaggtcgg tttgaagaga     12720
     acttccttct tcttttctat ttaatactgt cggttcaaca aatttgtcgg ttcaacaaat     12780
     ttgtcggtta agtaagtcaa aaccgaccat ttttgtaaga aaaggtcaaa acccctcttc     12840
     ctctaccgga gggtttggta tacagttttg ttcctttcat atcgccgcca aggcaaagta     12900
     ctatacctaa tcttccagag aatgtttgat ttctcgccaa gtaaataaaa aaagggaatc     12960
     ttcaaagatt ctttgacagg attatgtttg cgattacaag taaaaaagat atgaatattt     13020
     tttgaaggaa aaacatacaa gcacagatat tcatagttca tagtacatac aagcacaacc     13080
     taacgtagaa taagatattt acgactacaa ataaaaggta ttacaaatta attaagcttt     13140
     aaaggatctg cattacaata caaataacat catcatattc caattcatcc aacattaata     13200
     aaaataactt aaatattcaa agaaacaaaa gaacatgaat tttaaaaggt tataaaattt     13260
     attatagtaa aaaaataaat gactggcgct tacactgcac aaatgaatta cgaaatgaag     13320
     ggaacacata agagacaaca atctcggaca cattcataag tgggaaaata attatattaa     13380
     ataaaatacc tcagctgcct gctccgttgg tcacggtaac gccgccactc tccaccttag     13440
     ggggagctga gaaccgccgt ggtttaggca atgcaggcga agttggatac gagagccgtt     13500
     tcttagctga tgccttgtct gtgaaccctt cgttttcctg tgtggtacca cctaatgggc     13560
     tttggggctt gagcctggct cgagctgatt tagttggaac catgtagctc gggagagctg     13620
     gtgagccagc gaggctctca tcgtctctga ctgatgaacc agcaatgctg tgtctgcggt     13680
     tcctctcgga caggaccgag attgtgcttt tggagtcgtc gtcattggat ttcctcgagg     13740
     attggtttag ccttgaggga gttggaggtg agaagaaact gtttttgttt cttggggtcc     13800
     ctcttgcgga tgatggtgtg tttggttgag ttgagccatt gcgggttaga gattttgcag     13860
     cttcgttgcg gttaatagag cccttgaccg aggcagcatt gtcattgttg ctgttgcttt     13920
     tgttctttct cggaactctc tagtggccta ccagccatcc atctctctaa ccagctccaa     13980
     ccccatgtcg ggttgcttgg atccatgaac atcgggtttc cagatttaga gttgttcttc     14040
     cagttttgct gcaaacatga acatatagga tcattacaac attcaaatga accacagatt     14100
     caacttcaat ggatgtgttc actttttaat tgtatctttc cacacattca gcattatagg     14160
     taacgactgg agtacctgat gagagtatga ataagccaat gccctttccc ttctcattgt     14220
     tgcctcgtac ttgcttagca aattcgcttc aactttctcc tttgattgaa tgctatcatt     14280
     ccagttatcc ccgttctgtg agcagcaaca ggaaaaatag tacttttata agcaaaggcc     14340
     caaagattcc attttcagat aaaaaaagag acagtaaatt gatagtgtaa gtaaacatct     14400
     atttgatatg aatggtaatg ctactattaa ccctttccag actaataagc agaaacataa     14460
     tagcaactgc taggaagaaa tcaacagttc ttacttctta gcaatcctct caccaaaaac     14520
     aacggaagaa actttgaata acaagaaaaa aactgaatca gatgaatatg agagacagac     14580
     cttcaagcca gctagctctt tagcatgttt ctgaaggagt tgtttctggc gagcctgatt     14640
     ctcttctgac atcctgattc tcctagctcg gatctgcgac tgtacacgag agagagtctg     14700
     catacatttt agagtatttg cagcttgccg cttaacaaca gatccttcca tcaataactt     14760
     aagtctgacc aaacccctca ttgcccgcaa cgctctcctt gcctgtattt cagatattac     14820
     acaaaataag attatactca acaaagcagc ttccttcaca caaaatcaag tgcctcggtc     14880
     aaactcatac gaaattccga aggaattaag tttctgcaga taataaagcc aattgcaaga     14940
     gtagaattac ataccaaata acctctaaat atagtctgga tcaagatagc agcggcttct     15000
     tcgtttgact ttccagcaaa tcgagtaggt gtagcgcgac gaacaacacc aggagcagat     15060
     gaagatggaa ctacaggaac atcagtagct gtaacattca cagcatctgc tgtagaagga     15120
     ggtgaaagat ccctgttccg ttcaacaatc acttcagcta ctctcacttc acgaggagca     15180
     agagcaggag gaggagaaga agaagattgt ctaacattat ccacaacagg aggattagag     15240
     ataacaccat tttgtccctc agccaatttt tgcttcgact tctgaaaaca catcaacatg     15300
     tcaatatata cagactataa cattaagtca catcaatata caaaaaaaaa aacttcacct     15360
     ttgaatctgg gctgaatgct ttcttaacac ttgaaaacca tttagctttt ttccccatct     15420
     ctatgtaatc cttcacagag aagaaacaaa ttattccaca aggaaactga atctactgat     15480
     ctcagtagct aaattacgac agatctcgaa atctagagct aaaattcacc aattgatact     15540
     gaatcaggga gagaatgaat cgtacctatg agaagacagt gacaccagat ctgatagacg     15600
     aaaaagcttg aagataaaac ctggaggagt caactaaacc acaacgcggc ttctaagtag     15660
     tgaccttatc ggagaagacg aaaaagctta agaatcgaat cgattggatc tttgctgagg     15720
     tgcgaagata acttttcttc ttcgaattgc tttcacatta tcataattgc aaatggagaa     15780
     gagagagaga ggagaagaca gatggattca aagctgtgtg aagaagagta tttgtgacgg     15840
     tgtgtgtttg tgcgtgatgc cacttaattg ggcctctttt gtgggcccca ttctactctt     15900
     ctttttttcc ttttcttctt cttaatttac caacttcgtc tctcttttac tctattcttt     15960
     tcactttttt tttttagtga tgagttttat ttcttaagtt tcataaacac tgttttgtta     16020
     atttttcttt ttatagtata gtatctttag atttattatt atttggtgca tttcaaaaat     16080
     agtatacata gttgacatgg tatattggtg ttttctctaa aaatgtttga aattttctta     16140
     aaatatggat aacgtgtaaa ctggaaaatg tattggattt tgtacctttt ttgaaactag     16200
     ataatttaat gaacaagtta tgaggatcga taaaacagtg accatataaa ttttaaatta     16260
     atttataact ttatccggta agattggtct ttaatttcac ctaataaaac aaaattgttg     16320
     caataaaaag tttttattcg tctttaattt ttgtctttag gcgggttaaa atataacact     16380
     atatttttgc cgttaaatat ctgttattaa tcgaattaag atttaagatc gtattttttg     16440
     tcgtcaaata ccaattgttt atcgaattaa ttcatctgca taatccgtat aaagtatgtg     16500
     tgttttaata cacgcttaca ttactacaac cgacaaaaca tgtgaacaaa atatgtccac     16560
     cagtgagaca gcctttatca ttttaaaata tactcgttaa caagccacca tatacgatac     16620
     ttaatacttt ctggatttga taaatcatga aaattagttg gtcattgtac ttgtacacca     16680
     tatcatattt tatgttcaga tccacccaca ctactaagtt aatctccgat ggatgaacaa     16740
     agaaaatatt tgactcataa tacctagtga cacaaaccat aaataatgct ttggaaaaac     16800
     tcgttttatg caacagctat tagcagactg tattttgctc tatgatcgtg tatatccacc     16860
     acaaaagcaa tttcccaaat tatatggatt gacatacagt gaactagaac gatgattgaa     16920
     agagtatata atttttgtcc actggattaa gtattatctg cctgaaatca ttgacttttt     16980
     tcggagataa acccaaaagg ttccttatcg gtggccagct tgtaccagtc ttcctgtaat     17040
     ttttgtggtt aagaaaaaaa aaaaaaaaaa aaaaaagcat atatatgtcc aatcactcca     17100
     tgtggcgtct tctctgtttc gttagtataa catccctaaa attattttca tataaaataa     17160
     gtgagaacta gccgttggaa tttgataatt tattttagct aatcatatgt ccaacatatc     17220
     aaagtcctat gtataactgt ttatataaag atatgcctct gataacttat aatattaata     17280
     ggtatctgta tatccaaagt cggtagttga attggggata tggacattcc acctaatgta     17340
     taattcaaac tttgtcgttg ccaataaaat aaaaaataat tataagctat tatgaaaatt     17400
     tctctccccg tcggtcaact ttgagttggt ctttgcattc tagcaagtga aatttataag     17460
     ttaattaaac cgggggaaaa aaaagataac taaaccaaaa ttgaaccgaa aaatccattt     17520
     ggcattatct gaaatgtaag tggggcatgg aaataaggtc agggccgtta gcgttttaaa     17580
     gatatttaga tgagccagtg agtttggtaa cgacccgaca tttaagtctt gtcgttttgt     17640
     aacagagcaa cggtagaaga ttcctatatt ggctaacacc taaacctgaa cccatgataa     17700
     cgccatacct ttttcttccc agtgaattta attgaattaa cagtttacaa cttcatatat     17760
     agattagtcc atgtccatct atatcacctc agagaattta atttcaccac tattcaactt     17820
     ttgttactac ttcagttcat ctattttttc agttaaacat acacatttaa aataatattt     17880
     atagttataa gaaaacaatt ttataataat attttttaaa agatagggtt acgttcagca     17940
     tgagagtttt tgggagattg agttgaaaca agaactgaga aaaacattta agaattgcaa     18000
     aagagaatga agagttactg gtttttgatc gaactagaga tatgagtcat tttctatatt     18060
     cactccaaaa tctaataaag aagcaaacac aattctggtt ttaattagct gagaaaggtt     18120
     catgataagc tatttctatg tttccttcaa aacatcataa agtttttgaa actgaagaaa     18180
     tctaaattct caaaccaacc atatgttgat ctaaagttat atatatgact tcttacacca     18240
     ctggacgaca gaagataatc tattcttagt aatggctgat agtacttctt gatagggttt     18300
     tagactgttt acctcattgc tcaatgctag gattctgaat cagatagcga gcgttgtgta     18360
     agagggaagt agtctcctcg tttgatgcat caagcaaacg caactccttg atctcgtcct     18420
     gccatttctc aacatgttcc ttgtgtatcc tgtttcataa atgtgaacag tgttacacat     18480
     gtgagtgtat aaacatctca atcatggtac atacagaaac attatagaat ctcttcaaac     18540
     tcacatgatc aagcgttctt cgaattcgtt actgagttcc ttgagcattg ttttccctgt     18600
     ttccagcaag ttagaaacct accacaagaa gcatcaatca atatcagatt cttcctaaac     18660
     ttaagcaatc agggaaatga taagagcagc ttacagtttg tgtgaagctc tcaatcttat     18720
     cgagaatttg cgcaatgcta agttccatct catcagaagc aacaagtttc gtctcagctt     18780
     cttcattctc aatggtatga tcaaggctaa ttccatctct cgaatctcct tttccctctt     18840
     catcctaaca aatttcacag gacaaaatca aaaatctgat ccaccacaaa atcatcatca     18900
     ccagatcaac gacaaattca aaaaaaactt acagatgctc tcatgcgttt ccgaaatcct     18960
     ccattccctg cgtcttcttc catttcagtg ttcatcaaaa ctgcagtaat ttaaaacgat     19020
     gctcatgaac gcataaacag attaagaatt aagttttcta ctcgatgcga ttgaatccac     19080
     tagctaaagc atcgcagcag attccgattt caaaatctaa aaaccgtacg attacatccc     19140
     caacaatcta gcttaggatt ctacaataga acggaagaaa ctagatcgag atcgacgaaa     19200
     aaacctccga aagagattaa cagagaactt acgcgatgaa gatcgaagaa attgctcagt     19260
     acgaattgga gagaagaaga tgaagaagtt ttagagagag tccagtgagt gtagagaatg     19320
     aggaagaaaa gccaatttgt ttattccgag aatccattta aataagcgtt tagatttaag     19380
     acttatttta ttttattgtc tctgtttcat aatcatcact aattaagtaa ttatgcttat     19440
     acaatgctat tggcgtttta agtatggagg agtgactcaa gaatcaaagc gatttagatg     19500
     cgatttgata ttaagccgag taatccaaac attttacaaa aaacatacag ccaaaatatt     19560
     cacctaatca gatactaatc gtttttttta tctatctcgt ccaaaaaatg ttacaacctc     19620
     cgggacaaaa caaaaaacaa taaaccggag gatcgataag atatacctta aactagctta     19680
     acttaagagt gagcaacttc ttctggctca gtgatcactg catcgagaaa ggttcaagac     19740
     ttgttataaa tatcccggga ccttttaaag ggaagctcaa cgaatacatg ttcaactgat     19800
     gatgatgatg atgatgacga cgatgatgac aatagacgat ttacttttga tgagcttggt     19860
     ccagctgatt gttgttcttg ttttacatca acagaatttt cagagattat gttactctct     19920
     cttggatgag gattatcatt ttcagcatca ctctcgtcaa ggatcacaat cgtatctgca     19980
     cacaacagaa aatattcaaa taaattttct tacaagagag gttcaccaac atatcaagaa     20040
     catacataca tacctgttgg agtgttattc acattatgat catccaccat aataacctca     20100
     ttcttgatag tcacattata atcctccacc acaataacct cattttcgaa agccacatcg     20160
     ctactcccta gaccggcgag attctcagca tcaaaaagcg atttcaagaa tgaacattgt     20220
     gattcagccg catcaaatct ctctttcaat tcagcatact tgttctccat cttcttcagc     20280
     ttctccactt cttcctcttt cgcaatcaaa agctcctgat tcttaacact caaatcattg     20340
     ataatggcct ctttctcact gatcattccc ttcatctcct tcatatactc ctctttctca     20400
     cttctctctt tctctaaatc cttaagcaag cttagaattt tctcctcgag ttccttaatt     20460
     tgcttctgat attgaaactt cattatctcg ttcatttcat tcatctgctt aaaactttcc     20520
     tctatacttt tgtaatcttt ttccagattc tcataattct ccttgagaat ttcatgtttt     20580
     gtcgccaaaa tctcctcctg aacaaccaaa tttcttcttg tcggagtagc caccgacgag     20640
     attttgttct tccccgattt gtttgaacga gctgatgatt ttccagtcat gacgtcgaaa     20700
     ccctaaccct ggatatcaac acaaacagcg gtcaagcttt tactagagct tctttatctt     20760
     tgccaaattt acaaaatttc acagatttct aaagaaaccc taaaactcaa attcgttcta     20820
     agctccaccg gaagaagaac ggggaaacta acactagcgg atctttaaac caaaatgtac     20880
     aacggaagaa gaagaagaat cttacccaga aaatcttttg aatcttcttc ttcttcaaac     20940
     gaccagaaga gagaaagagc tagctactgg aaaatgaaag tagctacaga gaagggaaaa     21000
     agcaaatccc tagaaacaga gaaaatgaag cgggaatacg aaaggacaac atattcatga     21060
     tcaagttaat aattgaatct ttgtttagtg ttaaattgaa cttaatccaa atttttgttc     21120
     tcttcccatt catgtcctca aacaagtaaa atcatttact ttagtttagc ttagattaaa     21180
     aagataattc gatattcaaa taaaatacca ccgtatctaa aaatcataat tacattgaca     21240
     gtgtatctta taattggatt tgaagtgaca aggaggatac gacaaaaagg aatcaaacct     21300
     tcggtgagac aaaactgtat tacaagtagt tacaacaaca acccaaaaga caaaacctaa     21360
     agactattgt ctttctctct cactcactat cgttacaagc aaacgctaag atgactagtt     21420
     tccttttgat ttcatcatcc gactttcttt gtattctcac cctaaaatcc gaggcgattt     21480
     cattcatcga ttccataatc ttcaccaaag tatttatcca caagactgtt cgccatgact     21540
     ctcagctctt cgttctcatg aaactgaaac cgttccattg catcgatacc gtcttctcct     21600
     tccacaagct ttggcccttc cccgtttggc attcctctta aaacctatcc accaaagaaa     21660
     tcaaaaccaa ttaggatcat tcctgttcca aatatgacta tgcgacatca acatataagc     21720
     aaaactcgtg tctcattgag cttttaagag ccatttaatt agttgcttac cagctcaatg     21780
     aactgaagac caagcctagc agcttcgata tcaggagatc tgaccagctc aatgaaaccc     21840
     cggaggcaac cgccactgac aatagagact aaatgctctt gaattatcct tggttttctg     21900
     tctccttctg cagattctac acagagattt cccaagacat aggcaacttc tttccttata     21960
     tcaaaggggg atgtggaaag aatccgtagc aacaatggca ttacttcagt agaatgtatc     22020
     attctcttgt gttcaataga tcccgccgct atattagata gcacccaagc agcttcctac     22080
     agaatcgagt atagtgatga aagcttcata taattgtaaa aaattaaaac cacaacggga     22140
     atgtgatact gaccttcttt aaaacacggt gctcgcttct taagcacttt gcaagcacac     22200
     caatgatgct ttctgaaatt tagtttgcaa tataagtatc ttgaatatat aggattaagg     22260
     tgatgatgtt taacccggaa aagataatag atactagcct tcagtgttct gttcacggat     22320
     aagaattgtt aatactgctt tgggatcaac agcgacaaaa ttgcctaaac ttcggagaac     22380
     ctggattcac atttttgttt tagagataat caagaatgca acatttgaaa attaaggacc     22440
     acgtagtgag tattctgatt ctaatcattc atgctaatat gagtataaat gacatcgatg     22500
     ggacttggaa ctggaagcaa ttgaatagca taatctgagg taatatttta actagaatcc     22560
     tgtttctttt ggacgataag gtctatctga aagttaccgg gatgagaagt tgtaggctac     22620
     ttgaggttgc taatctgtca ataagtagtt gaagaatgcc tcccttcaag agcatacttg     22680
     tagcgatatc tgagagggca gataggtaaa caatgatcca tgcaatttcc gtggcagttt     22740
     cctcatccct gaatccaaca atcaataata ttttgatcaa attattcacc aaaattgaac     22800
     aatagaatat caatggcata aaacagaccc ctataaatct aaagaatcac taaaaagcaa     22860
     gacaccacaa cacgctaaga aattgttgaa attcagagag atgtaacttt gctcacgttt     22920
     tcttcaagtg tcgaagaatt gcatccagta tcccatcaat tttaacaagt tgtgctgctg     22980
     cctttgactc aggtccctgt attaaggtat aatgaaaata gtttgtaaca aaggcttgta     23040
     aattataacc aaggtgataa tatccgtgcc aggtttttcc ccaccttaat cagatttgac     23100
     aatgcccatg cagctgttct cactgttgaa cccttgtcgg gaaaaatcat acgtgctaga     23160
     ggtggcaaag ccccttgaga caaaagaaca tttctcaaat cttctccttc accggcaaca     23220
     ttaccaattg cccatgcgca ctgctcagcc accggtgcgg agctcttttc tgaatataaa     23280
     cttggaatca tatgaaatct aatccaacaa aaacaataga gtaataacag acttggttgg     23340
     ccagtacaac aaacctccaa ggtgagcaat gagtaacggc aatgcaggta atagagcttt     23400
     tgtttcttca ggttttccag cagcaatgtt ggtaagacac caagctgact caagtaactg     23460
     cagttagaca gaactgtgat caaaagatta caactctcct taatatatct tctttcaatg     23520
     catgagttac ttgtcaaaat ctacagtaaa gtgccggacg aatatataag caaataaatg     23580
     caagaacaaa ggtatagtat taaagcatat ataaggcaaa tgtaacctgt tcgtcggggg     23640
     agccaaatga aagacactgc acaagtaaag gtattgcacc agcacggagc gcagcttcaa     23700
     caggagggaa ctcagatttt gataataaac gcctgagttc ccgaagagca gtcaccctct     23760
     tctgcattgc accttttccc ctgaaaattg agataagaag tagatatcag aaaaaaatca     23820
     cgaacaatac ctgaaacagt gaagaaaacg aaaagaatga caaacaaaaa ttgacagatt     23880
     cacttactgg tattgaacag cggacttgag ctcttccaca gatttactgg cttgagcctc     23940
     caatataggc tgctcttcat caaccatcat ctcattctca acaagagcat cctcaacatc     24000
     gccattagta cccaccctac aaagccgctt tgccctaacc agtaattccc ttctttcctt     24060
     cgccactgta acagcttgtt ttcgtcttct ttgtcccgca acatttccaa ctacacacca     24120
     ccatttccag aattacaatc aaatccatgc caccaattgt aaatttatat ggttctgaac     24180
     taatcaatat acatgaaaaa ccaatactaa aaggaatgaa gcatctaaat ttgttcctac     24240
     cctaatcacc aactaaccta attatctcga gaagcaaaca aaaacactac actaacacta     24300
     ctcaggtgcc aaaatcaagt tgagggttta cagtaaaagt cagaaggaaa atcacctgaa     24360
     gactttattg ggtcccttcg attagaggcg gagccatcat ccgccattga agaagcttga     24420
     gcacagcaag tttcttcgag agtagggttt ttgattcggt aatttcaccg gagtaagaat     24480
     aggatttcgc cgaaaacgaa ttggttaatt tggatccgtt ccctcgcgcc cgcccagcaa     24540
     aaaaaagaaa cacgaaaatt ttgccgactc atatttgcat ataatttcat attagtccct     24600
     agtatttcca agtatacaat aaatagccca tttaacttta ttaccaattt ccgaatggat     24660
     caacgatcgt ggtttcacga agtctttgac attcgcctat gttgcaaact aaaataatga     24720
     catggcgact catcattggt tctttacgta caccgtaatc taatgtgacg catgtggtaa     24780
     taactcttgt gtcataatac acgtgtcacg catccacatg atcctcttcc ctgaacatga     24840
     tgagttcaca ccggctggct ttttctcacc cacttttccg tcactttctc ggttcatttt     24900
     ctcgagaaaa taaagaagac gaagacgaaa cctgaaacca aagccaaatt ctctcgatta     24960
     acagaaattc ctttggatct atcgtcaatg gacctaatac ctcagcagct caaggccgta     25020
     actcttacac acgtccggta ccgtcccgga gatcagctcg gacatttcct cgcctggatc     25080
     tctctcgtcc cagtcttcat tagcctcggt ggattcgtct ctcatttcct tttccggcgt     25140
     gagcttcaag ggatcttctt cggtataggt ctcgtgatct cacaattcat caacgagttt     25200
     atcaaaacat ctgtagagca agcgcgtccc gagacatgta cgttgctcga agcttgcgat     25260
     tcacatggat ggccatcaag ccactcgcaa ttcatgttct tcttcgctac gtatttcagt     25320
     ttgatgggat gtaaaggaat tggattctgg tttggtttaa gaagcagatg gattatgaat     25380
     cttcttcatt ggtctttagc tgttgttacc atgtattcta gggtttattt aggttaccac     25440
     acggtggcgc aggtttttgc tggtgcggct cttgggggta ttgttggtgc gagttggttc     25500
     tgggtggtga attctgtgtt gtatccattt tttccggtga ttgaggagag tgtattgggg     25560
     agatggctat atgttaagga tacttcgcat attcctgatg tgttgaagtt tgaatatgac     25620
     aatgccagag ctgctaggaa ggatatggat tctgctaaat ctgattaatt tggctaattt     25680
     gatttggtaa gtcgaaattt tcttcactgt ttcattgatt ttgatctgat taggtcttag     25740
     aataagcatt tttgggaatc agctttagct tttgatactt gtaggtcaag aatgtttgtt     25800
     ttgctatatg agtaggtagt cacatttgtg tataatgtac cactgtagca ttagaaaata     25860
     caggaagaac aatgtttgtg taaaagcagt ttaagtcatt cttcttggag tccattagtt     25920
     gttctgctca tccctcatga cattgaatct gttttctcat tgcttaatgc cgacaacaaa     25980
     tcagttctgt ttgagttttt tcttgtcttc ttctttgttc cgcaagcaca tctcatttgc     26040
     ttcatccatc tgcaggtcga gaactcgggt attagcggtc ttgttatcct ttttctttgt     26100
     tacattatat caggaatggc aaggagatgg gagattccat ttatgctacc gttctatgat     26160
     tagctgctca cctgaacatt tcacaaaatg aaacttcttc acacttatgt tatgaagtga     26220
     tctttgtatc ttttttcctt ttctttcttt gcatattcac ttatctattg aaagaaacag     26280
     tttcgtaaat taaagaaagt tatagaggtc tgtggttttg gcatctaaat tgatgttcta     26340
     gtttgttaaa ttactgttac ttattaactc gttgcaaaaa aatagtctta ctaggaacaa     26400
     gcttcaatgc aatgcaagtt tcgagttcta aatgatacac ttcattatgt gatgagattc     26460
     ttatttattt accctatgtc aatattctaa gatgagaatc gagaagattg gaataatgca     26520
     tttttgttta aatcatgttg acaaaattag taaataaaaa ctatgtaaac tatagttaaa     26580
     aaccatttaa aatgtaaaca ttttgaataa tcaaatataa agtttttaaa agtagttttt     26640
     acatgaataa atatattttt ttaaaccata aaaattaatc taagtattaa atacattcgc     26700
     gtgaaaagcg gttgaactaa taacattctc ttacagaccc gtcagatggg aaaagtgctt     26760
     aaccggttta ttttcaatgc attgaaattc aacacttaga ttttttgaaa acaaaaatat     26820
     tttctataat aaaaaaactt agttaattct accaaaaaaa acttagttaa acgaaaaaaa     26880
     tattttcata atcaaaaaat agtttacata ataaagatat tgaaaaaaca ataaaaatta     26940
     atctaaacat tacttccatg ataagagatt gaactaataa catctcttac agacccatcg     27000
     gatgaaacta ataacacctc tcacggaccc atcagcatcg gatgaaacta ataacacctc     27060
     tcacggatcc atcagatggg acggggtgct tagtccggtt tatttttaat gcattgaaat     27120
     tcaacattta gattttttga aaaccaaatt attttatata ataaaacaaa ttgttgacaa     27180
     taatcaaaaa tataactaaa aagatagttt acataataag aatattttaa aaaaaccata     27240
     aaattaatct tagtgttaaa tttacttgcg tgaaaagcgg ttgacctaat aacacggctt     27300
     aaggacccgt aggatgggac ggcatgctta gtccgatttg ttctcaatgc attgaaattt     27360
     aacacttcga ttttttaaaa accaaaataa tttatacact aacaacgttt agttaaaaaa     27420
     aatatataca ttttatataa ttaaaaagat agtttacata ataagaatat ttttaaaaaa     27480
     ctataaaaat taatcttagt gttaaattta cttgcgtgaa aagcggttga actaataaca     27540
     cgacttaagg acccgtagga tggcacggca tgcttaatcc ggtttgttct caatgcattg     27600
     aaatttaaca cttagttttt tttaaaacca aaatagttta taaaacttta gttataataa     27660
     aacaaaacaa aaaaagcata ttcaaaaata taattaaaac atagttattt aataaaaaaa     27720
     taatttgctt aaggagagag aatgatacca atttatgatc gagattgaag cattcttgtg     27780
     ttatcaaaca ttcagaagaa ccctagattt gaagaagaac ggaagataaa ataccacgga     27840
     agagaggaaa ctactttctg cgtttaatgt ctcgttacaa taatcctgca taaaatagag     27900
     cccaagtagg aaagttaatt gaagatgaac agctgatgat accaattcac aacgaatcag     27960
     aatcaaatct caaaaataat tttaaataaa aaaatctctt accataagtt tttggattta     28020
     aaggatccgg gagaatcgtc gtccttgctt ttgcttaaag cagaaaccta gatgaatcat     28080
     acctgttgac gtgcaaaaat cagaaaacag agtcacgtaa cgataaaaag agaatcgatg     28140
     aaccctagaa gaccccaaca tatatgaatc atcaacgacg gagtgaaata gagagagaga     28200
     taatgaattt aagttaacct gatcgtagag atggctctct cagactgaga tcgctgatcc     28260
     tttagtcaat cagaataaga gaattagaga gaatgaagac gacgaacaag tgtaagaaat     28320
     tgttgttgca aaaattgtaa tattggggat aaatagaagc atagcattag taaaaaagaa     28380
     aaaaggaaat aacaggagcg tggaaaatca ctaacgttaa taattggagt caaatcaacc     28440
     gactctacca attaataaat atagcattca gttctctctc tctagtcgcc gccgcaaacc     28500
     agaccccttt tccaaacgcc ttttgcctct ccggtgatcg gcttcggccg gcgccgtgag     28560
     agggcttctc ttcctctctt ctctttttag tttttctttt ttctttgtgt cgttttcttt     28620
     tagtcagcgg cggctcctcc ttctttgtgg cttaatcaga gacttttaag ctgacggcga     28680
     gcggttgttg ttctctcaga tggaggttcg ttggtggatc tacaatgggg aacattggct     28740
     ctcgacgact gcagcagatc tgatggtttc cttcttcagc cccttcacgg aggtacctct     28800
     cctccgatga gcctccttgg tggtggtggt tcagtgttaa gaaggtacag agggaggtgg     28860
     atcgtggttt tcgagcttgg ctgtgaagat cttaccgatc ctgggcagat ttacatgttt     28920
     caaggccttc tagctatgct gccgccaacg actcctaatg gaaaaataat ttgaagtggg     28980
     agagaaaaga aaaccatttg gatggttgaa gaagaaggaa agctctccaa taaagccccg     29040
     gcttcaagaa cttttgtctc agcccggtat tcggttgagt ttcagtcgga ttagtatatc     29100
     cgttttaggc ttaggaccga aatagtgaaa gccaaggagt caaaaccttt ctgaagttgc     29160
     gcttttggcg tagatgctat taggacacgt tctacactcg gatcttgagg gactaatagc     29220
     ttggaattgg attggatctc aggataggat ttgatgtgct ttgtgttagt aattgttttt     29280
     gtgtcattgg gtgaatttag gtggtttaag agatgatttc acttagagtc gtggtgtaat     29340
     ttatctcgtt atggttgaaa aaatacagtg aatttcagtt gggtaacgtt gaatccatct     29400
     tagtgtttca gggtgatact agactgattc attgtatttg gttaaaatat gttgtggtct     29460
     aatgatttgt acctttgaat tggttaatgg aaagttgttg ttgagccaaa aaaaaataaa     29520
     aaaaaatcaa ccgactctgc taagaaaagg aaaatcagtc gattactaac ggctacttat     29580
     ggaaacaaat ggaaattaac cgactttaat tttaagctaa cagtaaaaaa aacactgacg     29640
     ttatatgttg aaaatttgaa ataaccgact ttggtttatt atttgtatca tcactattca     29700
     aattaccttt acggcccaac taaataatat agggctttga agaagcccat ctagaagtta     29760
     atataaatta agtttttaag ggcacaagaa tgacgtcata ttagtaaacc ccaattacaa     29820
     ctctgattct ccttcccggc gatatgaaac gagccggcgg cggtgtcgac ttcatcagct     29880
     ctctacccga cgaaatcctc caccatatcc tcgccaatac acctaccaag ctcgcgatca     29940
     gaacctccgt cttatccaaa cgatggaagc atgtatggta cgagacacct tctatctcaa     30000
     ttgtttgcaa tagagtagat cctgattcgc taaacaaaac cctaagtagc tactcgactc     30060
     ccaaaatcaa gagtttcgat gttactataa gcagagatgt caccgtacct gagattgata     30120
     cctggattaa tctcgctctg tcacgcaagg ctgagaatgt atctctcaga ttcacatctc     30180
     attatagatt ccgagataca ttcttcatca attcctctct gaagcagctt agtttgactt     30240
     tggtttattg cattctgaat cccaagtgcg ttgtctcttg gtcatcgtta aggaacttgt     30300
     cgttgaatcg ttgcaaggtg tctgatgatt caattgccaa aattctcact ggttgttcat     30360
     tgctcgaaag cttgacattg aatctctgtg atagactcaa tgatcttgat ctgagcaagt     30420
     cactaagttt gagaagactg gagatacttg gagaccgttg gacaccagag aggattgtag     30480
     cgccacacat tcgttatttg agattggaaa actatcagcg accatctact ttagtggatg     30540
     tctcatcttt aaccgaagct aatctcggtc tttcaaaaca tgtacttgac tatttcacat     30600
     gtgaaatgga gactgaatcg cttcaataca tggtgcgaca gacggtggtt aagttgcaaa     30660
     acataaagaa gcttactatt gggggaattt ttcttcaggt aatgatgacc aattctctaa     30720
     tgcctacgat tttctatgtc gtagagtcgt gctataggat aacttagttg cacattcaaa     30780
     tgttggatta tggataagtt ttcaacttta aggagcatat gaagtctctc tgtggaatat     30840
     ggaaacttga agttgttcgg tatagtagag atatatgtct ctgtagtcac ttactttttg     30900
     tgcttttgtc attcttttgc tagattctat ctcttgccga gctctgtggt gttactcttc     30960
     cagtcttcca gaattcaata tcgaagcttt gactgttgaa acgaggattg atcagtctgt     31020
     gattcctggt ctagcaaggc tgctacaaaa ctctcctgga cttaaaagga taacagttaa     31080
     cataacgaag tgcaacacca caccggtatc ttttctacag attattcttt ttaagaaccg     31140
     tttccttcac tttttgggct aatgcagata gatgtgagat attttgtaga atcaaagatc     31200
     acttctagta gtttgcttga gcattctttt tttatgtcga caggataagc atcttgacag     31260
     acacttgaaa ttgcgaggct tgaatcctga tcaaagctgg atatcgaaat atggggtctt     31320
     tccaactgtg gagcagacat ctgcaaagat gaaacatgtg gattcgttca taaaacttgt     31380
     catgggaaac acaaagacat tagagaagct ggttttacag tttggagatt accttgatgc     31440
     agcatatcaa atggttccaa cattatctta cgacgatatc caaattgtga tcaagaaaag     31500
     acgatcttaa atagtactag tatattagta tatgctatgg accaccgtag atggcttaat     31560
     tgtcttggtt aacgtgtcta caaattaatt gttttgatct taaatttatg attcagagct     31620
     ttaggtttct gtgttcacat tgaagggaac aacagttata gctagtcttg taggttagtc     31680
     tccgtgtgat tgtcgttttt gatgtgtctt cactgatcag tacacgcaaa aggcaaaact     31740
     ttcctccgtc caaagcggat ctctatatta cgtttctgta gaaacttaag gtctctctca     31800
     cacatgtggt gaaaagtgat agttgaagca atgtttgaaa attaatatct aaagcttcta     31860
     attgacaaat aaaaagtgtc aaaaaggaaa aaataaaatt tcaagggttg attttttttt     31920
     tttttttttt tttttaatat atatatatat atcatgcttt tgctttagtt tgatttattt     31980
     gacttcttgg tatagttttt ggtttattcc attcacgaaa attaatttga agagaaatct     32040
     tttgactttt gctttgaatg tttagatgaa tgaaatctag aaaccaaaca acaacttgaa     32100
     atttaatttg gtttaatata gattggttta gttggattcc atttccccca ttcgttattt     32160
     ttgtttaggt tatatgtggc taaaaaggaa tatatttgca tccatttgta tttttgggtt     32220
     gatatgtttg atgggtttag tgagaatatt ggtagtggga gacaagagtt gatttggata     32280
     gttgagtgtt gctattgttt gtctcaaaag atttccactt tatgttttta gtcatttcca     32340
     aatcattaac atcaaaagct aggtcaaatt catacttcat atgtcccaaa atatttatca     32400
     aggattctgc ttttagacca tcaacttcta gtgatctctt attattattg gccagtatat     32460
     agcaattctg gagttgggtc cattctataa tccatagaca aatttctttc aaaactttgg     32520
     gtagattttt gtaatatcgt ctttaagttt attattcaga acaatgttac ttctagagat     32580
     tgtaatttta cgtatgtaga ttgtagatcc atcatattta tttattatcg tagaattatc     32640
     ctaaacacgt gtatgaaata ttttggttta aatcgaacga gtcacaaaaa tcaaaatttg     32700
     tggacatgca aattttgaaa tgtactcata tttcttttgg atataagtct tcgtccaaaa     32760
     caaagtcttg tttgtgtatg atgttgaact tcacaaatga ctgataacgt aacgtaattt     32820
     cacacgagtg acctcaatat aaaaaaggga ttgtgttcca tattcaacaa aacgacacta     32880
     atgacccatg attaaactaa gaaatgtaga tttaaatgtt ctataagatt cgtttcaaag     32940
     cagtcaaaga ctcaaagtcg cataaaagca caaattaaag aagattagtc tatagggaat     33000
     cttaaagaat aagttgttgg gtttacccat atatgcactt attaatctat atagtaggga     33060
     accacaaaga aatttaaaaa ccaaagtaga ttaagaagtt aatctccaaa ataagtagag     33120
     aaaaattaaa aatacattaa tcaacctata aagtgatatc ataaagagcc taaaatcgat     33180
     tcgtccgttg aggacaaaga caaataaaag aaatgttttc tttaaaacca ttaataagtg     33240
     atgcataaaa attaaataaa aataaaaaac ggaaaaaaaa acaagtgcag acaaaacgaa     33300
     accagaacac ggtgaagaga agaggcgaga gagagagaga gagggaaaag gaagacgatg     33360
     atgatttctc ggagacccgt ttcaagtccg ggtcgggtag agaaatatcc accgcctttt     33420
     atggggtttt tgagaagtaa gagcaacggc ggaagtacaa gcaggagtag aagtcgaagc     33480
     agaggaaggt cacgcgctag tcctcttttc gttcgccgga ataaatccgc ggcggcggtg     33540
     gctcaagaac cgtcgtctcc gaaggttact tgcatgggtc aagtccgggt caaccgatcg     33600
     aagcccaaaa ttaaacccga atctcgagat aacccgaccc gacgacgatg tgagtggctc     33660
     cgaaacgcgt cgttttataa caaattcgcc gggaaaatca aaacgatgac gttttggcct     33720
     aaatggagac tctgttcgtt ttcgtgtgct tgtcggaatt tgaaggagaa agattctccg     33780
     agaagtcaat tagatcatcc gacaacggaa tcagtcagag aaatcaaaga agaaatcgaa     33840
     ggagaagaaa atttcgaaat ccctaaatta tttgtgtctc cggctactac tccgcctata     33900
     aacgctctgt tgttgacgag aagcagatct gcaccgtata gatcgtcgtc gttggctttc     33960
     agattctggg aagaaaataa ccaacgagaa gttgaatcac agcaaaatgt gagatcggag     34020
     aaaactgatt cggaagttcc catcgagaaa atcaatggtt ttcacgagcc ggagtatgtt     34080
     gacagagatg aagaagaatt cacgaagtta agatttgtac ggcagccggt gttgacaagg     34140
     agcaaatcgg agccggcgag gatcggcgag aagatgatgg tgttgcttcc cgatgaagaa     34200
     gaaggttagg tagggtttag gtctctcacg tgattagtca ataattgcac taatcttaat     34260
     taattaatcg ctggtatgac taatttaatt tgcattgttt aggataattt gactgtgttt     34320
     tagatatagt agaggaaaca aatttgtata aagatttgta accatacata taacgtaagg     34380
     tgtagatatg tttggcattc aaaaaaaaaa tgtttaacaa tacactatgt aatcattttc     34440
     aatttgtaaa tttacattat ctgtttgatt ttagtatgct atttaaattt tggcaatcaa     34500
     acaaaacata actttttcta gcttctagag caattcaaaa caaaatttac atattcgaga     34560
     attgaaccgt agtattattc ttttatgttt tacgttattg taaagtacta aaatgtataa     34620
     atgtttgagc aaaccatgtt tgacttgttg ttataagaaa aaagaaaaaa agagctaatt     34680
     ctggcccaac gtatagatgg gcttatatat tgtaggccat ttgttcgata ctaaagacca     34740
     attgaagacc caaaatgtaa atatgtttgt aaattcattt tattactaat ccgatattag     34800
     atcattgatg cataagttaa tgcatggtaa tgacatatga aaaataagac aaaaaaaaga     34860
     tgggtgggtg tgaaaatgaa aggaggcgtg ccttaaggaa aaacacagcc atgaaatagc     34920
     tgtagagatg gatatggacc cattacaatt tatgatttat gaataagaga accacgaaga     34980
     tgttagacaa aattatttat ggagttctct cactagcact tataatatat agtagtacta     35040
     tatactatat aataccaaat atttaaattt gacttcccca agactgagac atctctgatc     35100
     acctatattc ttgaaaattc aacttttttt ttatttgtga ttttattagt atctcatttt     35160
     atgaaaccac aatgatttga aaacggatgt cgttggattt ttaagattat actgttcaag     35220
     gtttgatggt tttcttaaaa aggtttcgaa taaatatgaa tcaaaatata gttcttttcg     35280
     catctcagta cggtgacaag gaatacaaaa tgaagaaaga aaaaaatgac attttgaaat     35340
     ttcacttata agtcaaaagg ttttcttttg ttttaagagt atgagattct caaaaggttc     35400
     atgcatgcat aattgcatat tcattggaat gtacggatgt acttcggtta tatataaact     35460
     atataatatt tcaataagga tttaaagctt tcaaacaagc tagttgatga tttttggagt     35520
     caaactttct taaacatgac tacatgagta tagttattgg tccaatttgt acgcgtccat     35580
     tttctatagg atcggatagt ctctggcttc aattagtgat acgttggagt ttgaagtaaa     35640
     aaaacgaaga tgaatgtttt gctctgttta atattacagt agcattaata ttatcatcct     35700
     acacatatat gtttaatgat ggatgaggaa tataaaatat gtgttgatag tgtatattgg     35760
     gggtgcacga tccatccatc gaccgacttg aaataaatgg aaaggtagag agagtacaga     35820
     gatgtacagt tgtaagaaat aagtggggga tagaggaaac attataacat tatcatctcc     35880
     tcatttaatt ttatcattaa actctatata atgtttcaac ttcataccag cgatttctcc     35940
     aattaataat gatgtttatt taggagaatt ttataaaaat tctatatttg tatatcaccg     36000
     ccaaattaca ataactgtga atggaatgta cttacctgtt tttctaacga cattttctaa     36060
     aacgaaatgg aatctatcat aaattttatt ttctagctat gtcagttttt gtactgtaaa     36120
     ctgtaaagta ataatacgac ccaaataaga ttgtcattgg actaaagtca tcacaaaaca     36180
     tagttctagc agcgacttgg atcttattga tccactatcg acttaggttt actttggaac     36240
     gaacttcgta actaaatgtt tggtttggta tggatttgtt attgtatgtg ttcaatatta     36300
     acaaagcaac atttattttt caatagagta agtaatgcta tatataagtc gtccttcgac     36360
     gaaaataaat gactactact aatggtcaat aaatacgttt ggatgcaaga aagatgatac     36420
     tagataggaa cacgaattca gcttggaagc catgagattg aaagctaata ttgtccctca     36480
     cacatgaact tgtcttttct tatttttatt tttagatgaa tggtcgtgaa aagaaaagaa     36540
     aattaatact atgttccagt ctttttaacc cgccataaca tgttgcccat ctatacgaat     36600
     acaagagcac agtgttcaag acttcaaata caagtggcat acaaattcaa taatacgaaa     36660
     gacacaaaca ttattcaaat ggccatgtaa taaatcaaaa ttttgcatat attgaaaaaa     36720
     cggatacaat gtaggtacct ctttgcatgg acctctaata aattgttttt tcttttcttt     36780
     tcagttgatc acctagaaaa aaaagattct atgttatagt ggaacagaac tagctactca     36840
     caatagacag agtgattggg gaaaaatata tagaatacaa agttagacat atttacttct     36900
     ctattttaat tattttgaag aaacaaaaaa catgacacgt ttttcagtcc acgttatata     36960
     taaatatggc catcatgtac ctgaaatatc accattcaaa ttgattgagt ttgttataca     37020
     aaaaaaaaag agaagaagaa gccagaagtc tgagagtttt ataagtaacg aaaatgaaat     37080
     cgaccgtcat gatgattttc ctcattatct acctcctcat cgccgtgcct tgcttcgcta     37140
     aaggtatttt tttagttctt tgtttttctt aaaacgttta actaggattt ttatttgtat     37200
     attatatcga cgttgtacta taaaacataa ttcaggatcg gagcaaacgg attcagaggt     37260
     gtacgagatc gattacaggg gaccagagac tcataactct agacctccac cggaaactat     37320
     gcacggcaag ccaccgtaca tccaccataa tacctccgcc gctgggctcg gtgctcatgt     37380
     aggaggaaag agtaagttgc catctccacc tttactaata tttatttatg gcatttacgt     37440
     aaatatgagt ctttggtttt ttaaggggaa aaaggtaaat aacagtcatt aaatgatata     37500
     tttattatta tcaaatattc aaattgtata ttttattctt attcttcgaa attattatga     37560
     tccaatcaaa tgaagtaaat ttccctttct tgcatataat ggtgaccaaa acatgcagga     37620
     ttaattaatt aactctgaat ttgtttccaa attccatgta ttttgatatg ttctcttctc     37680
     catatatcag actagagaga gagcgagacc ttttccaagg agaagactca gaagttgaag     37740
     aggaagatta cgagagttgt gatatatata tgagtaatta atgatgttaa ttgatacaaa     37800
     tttatacttt aattatttat catatgaaga tgatcatcga tgtgtgatca gtacagttag     37860
     tgtgaataac acactactct cctgatgtca tgtccggtct tttatttatt tcatttttca     37920
     attctcatgc accgttctct atatcatttt tttcggtctg aatcgttttg aacttttttt     37980
     tttttaatta ttaaatcagg gtaatgtgtc actaaatgaa tatcaatata gtaattgttt     38040
     aaatgtttgt ttaaaacgat aaatgtataa taattttgca ctctccatat acaaaatgtt     38100
     tgggatgttg ttattacaat tacaaatacg tttattatat catctatttt gtatctatgt     38160
     ttacaaataa gtgtattata tactaacata agaatattgg actatattat atttgatatt     38220
     aagaaaatat ttagacactc caactccaag aatgcaagat tgcaactttg caaggtgcca     38280
     aggtctgaaa caatccaaac acttatcatt gacaactgac gaggtttatt ttggttgttg     38340
     tctttctttt attattctat gaaaattata atttaaaatt cgcaagaaat tgtttgtatt     38400
     attgtaactt gtacatgata ttcaacaaat taaaattatg atatagatga tcatatatgg     38460
     agtaatctaa gacactggct ccttcggacc caccttttaa tcacttcctc aatcattttc     38520
     atttttcaat tattcattca ttttaaaact ggaccatgtg tattatttat cacaattttt     38580
     agccagtaca gtaccatttc tttcgcctga gagaaaagtt tatgaattat gaaaactttg     38640
     taatagagag tttgatttga tttattttat gatctgtcaa tgttggagta taattattta     38700
     taaacatgac tttttaatga cacacgaaca cgagtacacg acaaatgttc tatttaaaat     38760
     ctatatcttt gtagttttta atgacacatt actattattt atatctttgc aaacgctttt     38820
     tattttaatt aaattttaac ggcatgctta gtcagttttt tttttatgta atataaactt     38880
     taattaaaag aaaaaccttt tgcaaaaaaa acctaaaaag atgaaaaaca cttttttatg     38940
     aaaatgccaa gaataataac attaaagaga agaaacaaac tagggataca tcggccgact     39000
     tatgttgaaa atactatagg cctcataaac agaatgggcc gtggctttaa gcccagttaa     39060
     taactaatga aactcgttca gctggggttg aacaagttct tgatgttgga tgtggagttg     39120
     ctagctttgc agcttatctt cttcctttag gtataaagac aatgtatttt acccctaaag     39180
     atggtcatga gctctgccat agccaccaat gtcttttgat atggttcact gttcgagatg     39240
     tagtcttgat tggcatgaaa atggtacgac tcttgtgttc ttctttctgt ttctaaatgc     39300
     cttgcttggt tttgtatcaa ttggaactaa agacagtcat ctgggcttga ttctgcagat     39360
     ggtatcttga tattattatt ttgtttctaa gatttgggaa attctttttt tgttttgttt     39420
     tgttgtagag aggttggtcc aggagcagta aagacaaaca taatgcacga gctccttcat     39480
     atatatacaa gccattgcat tttgtggtct caagattctt ggactcatgc agtcttcgga     39540
     ggatgcagct aaatctgtca ttgatgatgt agtagctcca cctgtaagat ctgctcttta     39600
     ggatttcttc atcttatcta cataatgtgg ttgatctgct ccattgtatc ttcagtactt     39660
     tcccgtgaac aaaaatttgc taaagaacgt tgggacacat catgtcactt atttaacgaa     39720
     ttgcagcaaa ctcacacttg aagatcaaag agcttctagt ggttgcttgc ttatgacata     39780
     atcctagcat ccaaactcta tcaacttctg gtttcttgta gtacttgtaa acaaacgcac     39840
     acctgcttaa gtagaataag ggccaatgct tcaccactaa aaaaaagttt agttaaagtt     39900
     ttgatttgat ttattataat attttgtata ttgattgatg ttagaaatta gtaagattcc     39960
     catttagtgt atgccaattt tttatgatta tgaccaacct ccattttcta acatatttta     40020
     tttagttaga ctttgccatt cttctactca atctcttgct cactttttgt attacttttt     40080
     ctttctattg catgagataa tttgtctgaa ttttgttagt aaaaacactt accaaaatct     40140
     agacgttaac ttgaacttga attacaagac gtttttatta ctaatgccag agtttatatc     40200
     attcaagcca actgtatgta agccacacaa cgctctgcaa gctatgtatt cttattatgc     40260
     aaaaacaact tttttggtgg acgcaaaaga acaacatttt gtgtgatatg atactacgag     40320
     tggtctactt gatatgttgg tatgattacc aaccaaatta tacaggttat acagtttttt     40380
     tctctgctcc cacttgtagt taactaatta tagacatggg accaatttcc aaaccctttc     40440
     ttatacagta gaactcttat caaattcaac gtaaagaaag cgacattcac caaactttac     40500
     catccaaagt tgaactagta aaagtgtcga actattatag tatttctctc tactgaaatt     40560
     gaactatttt atacacattg ttacaaactg tagtcttgac tcttgaggtt ccaaaaccaa     40620
     gaattattaa aatcgaacag aaaatataca tgtaaatcca acatttttac aattagtatg     40680
     tttttggttt ttgtttattt tcaatttacg tacaaaattg tgcttcgtat tttatattaa     40740
     ttgtcatttg aataatttat ttcaaaccga tcggtccttg ccgacaatga agatgtcgtg     40800
     ttccgacgag gaacaagaag tcgttgaaat cggagccaaa acttcattac agtccgatac     40860
     actgtcttgt aacgtaagca ataactccga cgtactaaaa ctcatcgacg acgacggttt     40920
     cgcaatcgga acttccggca catcagcttc accaacaaga atctgaacca cacttctcat     40980
     agtgggcctg gtgaccggat cgggttgtga acaagcaagg cccaccatca taacccgact     41040
     catctcctcc gggttaaact cactcaaccg ctcgtccacg gcggtcaata acttcccttc     41100
     tctatacaaa ccccaaaccc aatctaccaa actcgacctc aaaccgggtc ttaaaccggg     41160
     ttccggttcg ggtcgggtta tgggtcttct accagtgcat acttctaaaa caacggctcc     41220
     gtagctaaaa acgtcggttt tctccgtcgc tcgaccggtt aacaaatact ccggcgctaa     41280
     ataccccatt gttccagcgg cggcggttgc gtccggcgat ttatcgtgct ccgtttgcct     41340
     cgcgagtcca aaatcaccta acttcggatt aaaattcgcg tcgagcataa tgttacttgt     41400
     tttaacatca cggtgaatga tctgattctc gcactcttga tgcaaataag ccaaagcaga     41460
     agcgactcca agaagtattt ttctccggtg aggccagggt aatgtagtcg gagactcgta     41520
     gagtgcttta tcaagtgatc cattaggcat tagatcataa attaacagaa tttcgccttt     41580
     ttctctgcaa tagccttgaa gacggagaag attccggtga cggagggttc cgattagaga     41640
     taattccgat aagaattctg tgtttccttg agaaatgtgg ctgcatcttt tgattgcgat     41700
     aatttcgccg gaatcttgta agattccttt gtagacggtg ccgaatgctc cgtttccgat     41760
     gactctcgat gagctgaaac agtcggtggc taatttcagc tccttgtaag tgaactctct     41820
     cggcgatttc attatttccg atgctaaaga ttcagacttt cgagtgtatt tgatcttttt     41880
     agagtaaacc cagattatca ctccggcgaa taatgctaag aaaaatgctc cggcggttac     41940
     tactccggcg acggcggctg gtgatttttt acagagtttg ttacggcaag aggacgatgg     42000
     atcggcggtt tttctccgga cggtggatag ggatggtgtg attgatgaag acggtgacga     42060
     cggaggagga gaattaggca tcggcggtgg tgattccgat gattcttcga aagatgaact     42120
     aaagctccac caatcgacac tgtgaatctc agtgcttcct tgtgttgatc cagagaatcc     42180
     aacaaacatt gaatcgctta cgtaacgatc aagatcgaga ggaaccgaca aaatcggcga     42240
     tttaggtttc aagtttgagt aagagacgta aactgttaaa acccgacccg acccgtcata     42300
     agtgatccat gaattcacgg cgtttccgct cttgagatcg atgtcgacgt ttcccaaatc     42360
     ggctaccgcg gctgaaacga cggcgtttag atccaatccc acgtggttcc cgttaacgtc     42420
     tttgaattgc acatccatta acgtatcgaa ttcaaccgcc acaaaacccg acccggatcc     42480
     ggtttcttcg gttagaccga gaaatccacc ggtggatcct aagtaatctt catcagggga     42540
     gattacgaaa gctaatccac cgccaattga ggaaggattg agattcgtta ccgagaagga     42600
     gaagtaagta gtgaaactcg ccggagattt agtttccggg tgccggaatt ttaccggttt     42660
     cccataaaga gcttttccgg cggtggaagt gggaacagag agttcacgag tgagcttaat     42720
     agttccgttg ttgagatgag catcgccgag aagtttgagg cttgagagag tcaacgttcc     42780
     gagatcgaat ctcgtcgccg ggaaatcgcc tctgacgtcg gaggagcaga ggaaggaggc     42840
     aagaatgtgg atgagagttg agtaaacaga gaagaatctc ggaggaagtt tcaacattag     42900
     tttaagtttt tcattggatt cctttggaga tctgaggaag aatttggagg ttgttgggtt     42960
     ctctcactga tacaatcata caaaagagag acgatgacaa atctctactg aatcagacag     43020
     aggaagacga aagacgacag aagagagtgg gaaataaaaa gcagaagtga agaagacagg     43080
     tggatctgct gattgacacg tggaattatg aactgtttta aaaaaatgga attttccagc     43140
     gatggagaag gtcctcacgt gcaagcgcgt gttggcttct gtttgagatc tcgtcaaaaa     43200
     agtctttgga agtctttagt aatgttattg actttatgga acttatgatc aaagtacttc     43260
     tcgaattaaa gcacttattt atttcagcgt tatagaaaaa aattttttaa aaattcatta     43320
     gttgtcataa tagttacaga tttttttatt atttattatt ctatgtaaga aataaactta     43380
     tatcgttgtg aaagttttat gtcatatgat tctttttatt tgacttttat gttgcatatt     43440
     gtacccgttt tcttcaaaga tacttccttt tataattttt cgaaaggaaa gttcgtatgg     43500
     atcatcatat cagcataaac aaataatact tcaatgtctt aatcattatc tctaactaat     43560
     ccacaagttc acaacgcagc cactcgttgt cattaccagc tcgtgtcgat atttgtattc     43620
     cttgttgctt ttgttttatg tgtatttctt tatctccaaa tgtactaaga gactgttaat     43680
     aaatttactt ggttggtagc aaaaaaaaaa caagggaaaa taatcgccaa tctacgagac     43740
     atcgtgtcac agtttgaagt atttatgtct atctgacgta tatttattgt ggtcaatatt     43800
     agatttaaga catctctttt tcttttcatt tccttactct tttgaattta tagtctaaat     43860
     tttggttggt gataagattt cctcaagtcc taccaaaaaa aaaaagattt cctcaaatgg     43920
     aaacgtacta gtacaaaact taaaaagcct caaacgtatc ttatggactt gggcctgata     43980
     taaacaaact tgttattaac ttgggcttca gcccaaattg gcacacaagc taacgttgta     44040
     caagagtgtt atctcgcgga ggtggggata atcctgatga aaattaaaga gcctccatat     44100
     tagtatgttt atgtgggctt ttaattgcga agaaacaaaa cagatcaatt actatctggg     44160
     tttctattgg gcctaaggat ttgggcctat cctctttatc tactagccca tattgttttt     44220
     catacaaagc aaagtgaata ttagtctttc aaagcgggga tgtttaatta aaatcatgtc     44280
     ggtccctgac cttgtgttct agttgtaact tgtacttgta acatactaac attgaaccca     44340
     caacgtatct gtctttcaaa gttccaacta aaataaacta gaaaactaat gctgaaaaaa     44400
     gaagaagaag aaaatgtcga tatttcatgc tcaaaataat gcatcactat agctttcaaa     44460
     gaacagaata gaggaatggg acctcatatc cgaaaaacat acctttatat aaaattctga     44520
     tgtaatgtct ttggtttatc aaaatcatgt ttttctcttt aaacgttgaa atgatagata     44580
     atgctttaca atgacgtcga actaattttt ttgaatattg accggttgag tttaataaga     44640
     ccggcgtcca tattcaaata gaattgtgac acagtaataa ttaataaaat acaagttgag     44700
     atataaaatg aagtttgtaa caatattaat tagttgctgc tcatttcata attgtatgca     44760
     tatctattca aatttaacta tacatctaag cacttttatg gttgaagcca aaataattaa     44820
     ttaagtttgt atatttgtgt atatgcatat aattaatgtg tgactatgat aataattata     44880
     ataatacgtt tcttaatcgt agacacaaac tttggatacc aagaggggaa tatgatagca     44940
     tccaatggac caaaagaagg caaacacaaa aggccaaaag agaggttgag ttgcattatt     45000
     tatggaattt ttaatgtaat ctaatctaat ctataatata tgataattat tgtactacta     45060
     gttcatttta tttaatatct agacaatcgt ctttcataag aaaaaaaaac aaaaattaaa     45120
     aactacggtc ggtcttcata tatctgtatg tctgcgttaa tatttatact tttttcaaga     45180
     catctttttt cttctttttt tttgctattt agaaagttca gacccattat cttaatattg     45240
     tgatgcgtca actgtatttg gtaactagca agtggaacta gaagcgttta agaaacccat     45300
     cgctattaga cttgaatcca aaatcatatt catagtagac tcacagtcac tattatcaaa     45360
     aggatgataa tagaagactg atatgctcat gagcttctat atgactgaag atgattgatg     45420
     aataaaaaaa actatgattc aaagggatga taatagaaga ccaatgtgca tgagaatcat     45480
     agctccaaaa agagggtcct acagacagag agacaggcgt cacggactgt cctatcgtct     45540
     tcatcgggaa atgccaaaag atcctctctc tctctctcac attacacaaa taacatgcaa     45600
     catgctatgt ttggtccaac ttgtaattat gccttaatca tttcttttga tctatttcct     45660
     taaaggcaat tcccttttct tgtaacttcc tcgattgcac aaaccaaaag aagaaaagca     45720
     aaagatgatc acacttgaat gagtaagaaa ataatttgta gtccattcaa gaaatccaat     45780
     aattttattt tgtccaaagc acatgatcaa tcgcatattt cagatctgtt tgtactcttt     45840
     ttttgggtgc tcgaattaga agaaaaaaac aaatcaatcg tcaatgaacc catgcttgtt     45900
     ctacttctaa caaaactttc gttatgattt tggctaacta tgtacatgtt tttattttat     45960
     tttttgaaca aagatgtaca tgttttacta ggtgaagttt attactagac tatcatttca     46020
     tcgcttctga atttatttat tagtgaaaat agaggttaga tttagtgcca atatattgtt     46080
     cgatatcaca ttttgacttc tctcgggtgt acactaaatt acgtttaatt cttcgtatta     46140
     cttttcttgg ctttaatttt gtttacgagt aatttgtact tccaagtttt gtaaaatctt     46200
     tatataaaaa gtagtggaaa aataaataca aattacaaaa aggctttttt gagttcctaa     46260
     aactttttgg gagtcaaaga tggtgctctc tttaaacaac gggaactttt tgcatcgacc     46320
     tatatgcttt gttcttggga cacagaacat tttcctttgc caaatacaat ttcttgggtg     46380
     gataaaattt tccttttata ttaaaatagg agttgaaact atgtccaatt aaattaatat     46440
     gtagatccga aacatagcta gtacatatca acgtagattt tttataaaat aagtaataaa     46500
     taaagagcta ctgtttctta gtctcaaaat accttataaa aagatattgt tttgttttat     46560
     aaagaataaa atgaaatttg ttaagaagat atatatatat atatatatct caattagtct     46620
     atatataggg agtatatata tatatagtta ttgattactg cttctaaaat atgcaacaat     46680
     tatattggta cgtatataaa ttgttttttt ttaaaaaata aataaattca atttgtagaa     46740
     aaaaaaaact tattacaaat aacataaaac aataaaatgc cgaaactaag aaacccttta     46800
     aagttatgac cgtaatagtt aaatgttgta tctacaatcc tttgaaacta tatctatgtg     46860
     aatgaagatt ttagttgaat aaagaataaa tccaaaaata tcatcaaatt atgcatcaac     46920
     attaagggtg tcaaaatgga tcaaaattca tggatcaagt caactcaact caatccgtaa     46980
     actctaatga gttcaaaatt ttgactcaaa tgagttgatg agtcaaatga gttgatgagt     47040
     caattggttt gatgagtaaa atgagttgat gagtcaattg gtttgatgag taaaatgagt     47100
     tgatgagtca attggtttga tgagtaaaat gagttgggtt gtaatggtta atggtttcaa     47160
     tggtttaccc aattaaccca tcaagttttg taaaattgaa ttaaaccaac taaaatctct     47220
     aaaccaatgc caatttaagt ttaaccaaca caactaaacc gatttaataa aattaatatt     47280
     tttctaaatt tcttaaatat acaagcgatg aaattgagaa aaaagtaaac tcgtaatttt     47340
     ccaccaaaaa acataaaccc gtgattttcc tgccaaaaat ttaaacccgt gatttttccc     47400
     ccaaaaacgt aacccgagat ttttctgcca aaaatataaa cccgtgattt ttctgtcaaa     47460
     aacttaaacc cgtgattttc ccgccaaaaa cgtaaacccg agatttttcc gccaaaaacg     47520
     taaatccata atttttccgc caaaaacgta aactcataat tttcccgcca aaaaacataa     47580
     acccgtaatt ttcccgccaa aaacgtaaac ccatgatttt tccgccaaaa acgtaaaccc     47640
     gtgattttcc cgccaaaaac gtaaatccgt gattttcccg ccaaaaacgt aaacctaaga     47700
     ttttcccgcc aaaaacgtaa actcgtaatt ttcccgccaa aaacgtaaat cttttaaaca     47760
     ccgtgatttt cccgccaaaa atgtaaatcc gtgattttcc cgccaaaaac gtaaacccga     47820
     gattttcccg ccaaaaatgt aaacccgtaa ttttccgcca aaaacgtaaa cccgtgattt     47880
     tcccgccaaa aacgtaaatc cgtaaaaagt ggaatccgta aatatcctaa gtttgatgat     47940
     aatgaattaa taatgataat tatttattat tgttttataa tagtaattaa ttaaattatt     48000
     atttaaatgg gttaatccat ttaacaactc aacccatcaa attaaatgag ttatgggttg     48060
     acctaaccca tttaacaaaa tgagttgggt caacccataa ctcatttaac cctaaactca     48120
     tttgattatg agttgagttg agttgggtta cccattttaa cacccctaat taacatacac     48180
     taattgatga tatatatttt tcaaataaca atatcatcta aaatataatt tagattacat     48240
     cccttaaata tttatacctt ctcccaactt ataaacacac catagatgta cacatgcacg     48300
     tgtgtctatc taaactgcaa gaaaggaaga gactggcctt ttcgaagaaa ataattattt     48360
     acaaaaaatc actttccctt ttagaaaata atttactagt cgactacaaa aaaaagggta     48420
     gatctctata tgtacatctc ccagatctct caacattatt tatacaattt tttcttttat     48480
     tcctgcaaga gttttttttt gtttataaca acaaatcctc tttcaatata atctttatat     48540
     atacgtatac tttcgtgcct tgaaattttc ttcctcatct tctttggtct tttcttgtca     48600
     tttggcataa ccaaagagtc aagcacattc aaacattctc aagccctaaa acccaaaaaa     48660
     aacttatatg ctcttgttct tgttcttctt ctcccctcag catattaaac cctaattaac     48720
     tatctctttt gtttgtatac tgttataaac ctcctgatca tcttcttgtt ttcttgcaag     48780
     attttataaa aaaaaaacaa aacccagctg ttcttgttct tgttctttag ctccgatccg     48840
     ttttaaatta aaacacagat atgcagatga ttccaggaga tccattttct atttcatcct     48900
     ccatgggagg gtttgttcat caagaaacac accttcatca tcttcagcag cagatccctg     48960
     accttaaccc taattctaac cctaacccaa atgcgaaacc aaactcttca tcagccaaga     49020
     agaagagaaa tcaacctggc actccaggta taactcattc cacaccataa tatactcaca     49080
     tgtataccca aatctatgtg catgtgtgtg agtcatagat acttgtatgt ctatatttct     49140
     acatatacat aagacgtaga aagcagctcc atatatttgc agatctgttt tctgatgaaa     49200
     ataacatctc catatatatt atttgctgaa ataatcacaa actcagtatt cacatatgca     49260
     tatacatccc tctctatatt tcttatatgt atatttcctc cttttactgt atccggatgg     49320
     tcatgttaca tatttgttta tttataatct ctacaacata tttggagcca ttagatcaaa     49380
     atatgcgttg atatatcata tttaaacata aatatggaca gatccagatg ctgatgtcat     49440
     cgctctatcg ccaacaacac tcatggcaac aaacagattc gtgtgcgaga tctgcaacaa     49500
     agggtttcaa agggaccaga atttacaact acatcgccgt ggccacaacc ttccatggaa     49560
     gctaaagcaa cggtccaaac aagaagtgat aaagaagaaa gtatacatat gtcctatcaa     49620
     gacttgtgta caccatgatg cctccagggc ccttggagac ctcactggga tcaagaaaca     49680
     ctacagccgc aaacacggtg aaaagaagtg gaagtgtgaa aagtgttcta agaaatacgc     49740
     tgttcagtct gattggaagg cacatgcgaa aacttgtggt actcgtgagt ataaatgtga     49800
     ctgtggcacg ttgttctcca ggtaatattt actaacgaga ttaacagttg gtattggtta     49860
     atgtataagt tgagtttttt tctacatgaa gtattagaac tcggtattct attcatatat     49920
     agcaatatcg gatgaaagca atgcaaaaca attcatgtga cagtgttaga acctaaaaga     49980
     attgtgtaaa aaactcaaac agatataggt gtatatatca agtgtcggca tgcatgaatg     50040
     tgtgtgcaat gtcttgtgat ttgttatatc tgttgcgaaa gttggaatag agcagagcat     50100
     taattgaaga cattctgact tatgggagca atttctattt atttttgttt aagattttga     50160
     aataatagct gcatacttta tgagtatatg atattcgatg agattttgat ggcatgagca     50220
     tctattcatt ttgtgtggtt gtatgtgtac atgtctattt ggcttcattc ttttcttcta     50280
     ttcacaccat atggcaagaa actagatatc atgcatatat tttgtcaaca aacacataca     50340
     cacacatgca tatatattat atatatatat atatatataa gttctatgtt tttgtatata     50400
     gtaacaatta aggtttttgt gctttttttt tttctttttt tttctagttt tatgtttatt     50460
     tctgtcttca tgtcgcgagt ttgcatagga gaaataaatg cttactccgg ccaagaatgt     50520
     ttttgttttg caaatgattt caaattcaat gctctattga ataataatca atgcagttgt     50580
     ctcactctta aaataattat gtctttattt ttattattta ttatctaata aataatcgat     50640
     ctctgtttta taggaaagat agtttcatca cacatagagc gttctgcgac gcattaactg     50700
     aggaaggagc gaggatgagt tcacttagta acaacaatcc ggtgatctct acgacgaatc     50760
     tgaattttgg aaatgagtca aatgttatga ataatccaaa tcttcctcat ggatttgtac     50820
     accgaggagt tcatcatccc gacattaatg ctgctatctc tcaattcggt ctagggtttg     50880
     gacatgacct aagtgcaatg catgcgcaag gtacatcaca taccaatcct ctttctaaat     50940
     tagttattca tatatatgaa atattttttt tttttgatga atatgttata atactattat     51000
     caattcaatt gcgttaattt aggtctatcc gagatggttc aaatggcctc caccggcaac     51060
     caccacctct tcccgtcgtc atcatcatcc ctccctgatt tctccggcca ccaccaattc     51120
     caaattccaa tgacttccac aaaccctagt ctcaccttat catcatcctc aacatcacaa     51180
     caaacctcag cttcactaca acaccaaacc ctaaaagact catctttctc accactcttc     51240
     tcctcttcct ccgaaaacaa acaaaacaag cctctctctc caatgtctgc cacagctctc     51300
     ttacaaaaag ctgcacaaat gggctctact agaagcaatt cctccaccgc tccgtcattc     51360
     ttcgccggcc caacaatgac atcctcctcg gccaccgctt ctcctcctcc tagatcgtct     51420
     tctccaatga tgatccaaca acaactaaac aacttcaaca ccaatgtctt aagagagaat     51480
     cataatcgtg ctcctcctcc tcttagtggt gtctccacta gtagtgtgga taataatccc     51540
     tttcaatcga accgatcggg tctaaacccg gctcaacaga tgggtctaac ccgggatttt     51600
     cttggagtga gcaacgagca tcaccctcac caaacgggtc gtcgtccgtt tttgcctcaa     51660
     gaactcgcaa ggtttgctcc attgggttga ttatgtgttt aattaggtac tgtgtggggg     51720
     ggacaagatt ttgggtttaa ttaggattgg aagttccttt gaggagacaa gtctaattaa     51780
     gaaccgtacc cccttgtgaa gcggtcggaa tgtggggaca aaggttgaca agacatcatc     51840
     atatcaattt acattgaatg ttatgtactt ttttactatg tttatgatta tcgcaattca     51900
     cataatatat accaccatga catgcatgga tatgtatttc cgacattgtc gttttgtaaa     51960
     tgttgtttat tttttctcgt tcttgtaatg acattcaaaa aattggtaaa tcttcaggct     52020
     tttccaagtt tgttaacgaa gacattgctt aaatcgaata ttgtgatata tatgttcaat     52080
     tctctaaaat ccatggtttt ctgttttaga cacttctttg attctattgt gatgcgatca     52140
     ctacacttat acagttatat tctaaattta gatatgttga caataaccct acaaaacgtt     52200
     ccccaagaac agctcaaagc ctcaaagaaa gtcgcttcaa aagttttaaa acaaaagtaa     52260
     actcatttta taaccaacat tatgcgttca tatataactg ttttctttaa taaaatacaa     52320
     aattcttaca taaagtataa ttgaaactga accaccttgt tgaaacttcc tttcaagaga     52380
     actcaagttc tcgaggtgtg tgtcaatgta accttttgga ttctgcgtaa attaaaatat     52440
     ttttaactga tactcttttc agtagactga taggcttgtg cttgtcttta ttttgactta     52500
     tctctaaccc cacacataca atagtataac taaatagcta gtattatttt cctagaaaat     52560
     atgaaatctg tcgtcttgtg gatccatgcg ttattcgttt ttcattgtca aacactaaaa     52620
     gatttagtat gtatttatgt tatttgcttc cccccaccaa tggtaaatcc tattataagt     52680
     gccactaata ggattattta aatttaaatt ttgatgcatg tcaaaatcaa aatcacaaaa     52740
     cagagtaata tttattttac ataacatatt attctttcca aaatctgaag caaaaaaaaa     52800
     attagatgca agttttgtga tactgatccg gttaattaca cttccaacat tttgggccca     52860
     tcaagtattc tgttaggccc atatttatct ttcagttata aggttggcct ttaaggcttc     52920
     aattctaata ggcccaagaa tcgcagttat cttacgtggc agagtaagag ccagcgtgga     52980
     atagttagtc atacgtgttt aattatcatt ggttactatt tacgaaattg aaatttactt     53040
     aaaacaagtt ccacgtgggt cataacgatt ggatagaaca acgtgttgtt ataactagtt     53100
     acacttaaaa catgcaaatc aaaataaaaa aaaggcttcg aattcgatcg aagaacgata     53160
     attcgaaaca cacaaatttg cttgaatcaa agactcttct tcttcgttcg ttcgtttcag     53220
     tgattccaaa gattccaaat ttgtcggtgt aatcttcgtt gtattcagag gtgtatgtat     53280
     atgtattgaa atcgagaatg gatctgttcc gagtttggtc agggatggat ttcttagctt     53340
     ggagaggaat ggcttacaca cttcttcttc tcaacttcgt ctttgcttgc caacttcttc     53400
     ttctccaacc tctcgtttcc gctctaggta tattttattc tctttgattt tcctatcttc     53460
     gcttcgtttt cccctggtga gattgatgtt tgttgtttag ctgatttggg aatcttaggg     53520
     cttagaaatt tgctctaaat ggcgaattgc ttctgtactt ttcgaaagtt ttctcctttt     53580
     cgtgttgggc ttgtcgcaaa ttgaggttcc ctgtgatggt attgaaatcg aatttaggac     53640
     tctgtttttg ctgctccaca ttatgaattg atctaatttg gatactaggt tatgagagta     53700
     atgcatcttt gtatactcgt tgagtgttag cgttgctgtt tattttggta cagatggtca     53760
     atcggtagat gctgctgagt tattcgagag agcttcacaa agtatcaagg ttaagcgtta     53820
     tagtgatgcc ctcgatgatc tgaatgcagc cattgaagca gaccctgcgc tttcagaagc     53880
     ttattttaag cgtgcctctg tgcttcgtca tttttgcagg tataggaatg agctaaaggt     53940
     cctgtcggtt tgcattttta ttcttataag gcgttaagcc agaagttgat ttctcttcta     54000
     tttctctgtg ttatatagat acgaagactc tgagaatagt taccagaaat atctggaatt     54060
     caaatcagga gattcgaatg ctgagaaaga actctctcag cttcatcaag ctaagagtgc     54120
     tttggagact gcctcgactc tgtatgaatc aaaggatatt gcgaaagctc ttgaatttgt     54180
     tgataaagtt gttcttgtct tctctccagc ttgctctaag gttctcttct tgattgctat     54240
     ttgcagtata tctttggact ctctgatcat gcagtttctt attatttaca ttgttttttc     54300
     acttcaggca aagcttctca aagtgaagct ccttatggtg tctaaagact actcaggtgc     54360
     aatttctgag actggttata ttctcaagga agatgaaaat aacctcgagg cgttgctcct     54420
     tcgtggccgt gcctactact atttggcgga tcatgatatc gcccaaaggt ttggtctaac     54480
     ttcaacctta ttttcaatca gagagagttt ggggtccaaa acagatatac ttaagtaaac     54540
     tttctgtttc aggcattacc aaaaagggct tcgtcttgat ccggaacaca gtgaactgaa     54600
     gaaagcatac ttcggattga aaaaactgct caagaaaaca aaaagcgtga gttctgcaaa     54660
     cctctttgtc ttcttttaac actgagcttt agctgccaat ttcttgtgtt gaaaacatgt     54720
     gctctattgc aggcagaaga taatgcaaac aaaggaaagt tgcgagtttc agcagaggaa     54780
     tataaagaag ctattgctct ggaccctgaa cacacggcaa ataacgttca tctctatctt     54840
     ggactatgca aggtctcagt caggctcggc cgtggaaaag acggcttaaa tagctgtaat     54900
     gaagcactta acatcgatgc agaactgatt gaagctttac atcaggttca aatcatcaag     54960
     tgttaaatca taacattcat aactatttta accaacaggg ttctgattac tacttcatca     55020
     gagaggagaa gctaaactgt tgcttgaaga ttgggaagga gctgtggagg atttaaagca     55080
     agctgctcaa aactctcagg ttggtgaaag attagtgttc agtgtttctg atatctaaaa     55140
     tgtagcttag atcttgactc aactaaaaca cacatctaat tgtaggacat ggaaattcat     55200
     gaatcacttg gtaaagcaga gaaagcactg aagatgagca aacgaaaaga ttggtataag     55260
     attcttggaa tttccagaac cgcctctatc tcagaaatca aaaaagctta caagaagctt     55320
     gctcttcaat ggcatcccga taaaaacgta ggcaatagag aagaagctga gaacaaattc     55380
     cgagaaatcg ctgcagctta tgaggttcaa caaaattcca catcactctt tcatattcac     55440
     acacatggtc atggtctctc tcattctctt gacattttaa ccttttaatt ttaccagatt     55500
     cttggagatg acgataagcg ggcgagattt gacagaggag aggatcttga agatatgggt     55560
     ggaggcggcg gtggaggata taatccgttc catggtggtg gtggtggtgg acaacaatac     55620
     actttccatt tcgagggtgg ttttcctggt ggtggtggcg gttttggtgg tttcggtttc     55680
     taacttgaac aacatgatgg aatcatgtaa cttaagacta atcttttcaa attatactca     55740
     atatcacatt ttcctttctt tcatcaaaaa aagttgtgtg caatcttaat caaaacaatc     55800
     acacgtaata acacatctat aaaacaatct caaagtacaa caaaaactta aagctctcgt     55860
     tattcttaaa attccaaatg tggagactca agaaaagctc tctctcgagt tatatccaca     55920
     gagaagaaga agcagcaatg gctgcaacgg tagtgattct gatcccaaac ccgaatccag     55980
     tcctctctgc atcagatgaa tcagtagaat ctcctccatc atcgccaccg gaagctgagc     56040
     cttttgaaac agagccgcct ttctcagggg ccggagcagg agccacgctt gatccaaaca     56100
     tggctaatgg cagcaaaact tgatcaacct gataaacggc cagctgctta tcgctgtaga     56160
     cagagttagc cacggtggcg ctgacaactc cagtggtgat gttaacttgg ttaccggagc     56220
     tagtgatgtt aagagggaat ttaccgtttt ggccatctcc agcttgcgtg cgtaaagggt     56280
     tactaacggt ttgaaactga ggcatggtta tgagtgtagg taagacatgg aactgaacaa     56340
     gctgaacttt ttgttggtca gacaatgagt ttaaggttcc ggatttgagg ctgttgaagg     56400
     cgttatcagt cggggcaaac acggttaagc cattactcga ggaagaattg agctgagtgt     56460
     tgatttggtc tgaggcttga gtgcttttaa gaagtcttat gaacaatgtg aattgaccag     56520
     ccttttctag gattgcggtt atgttcgttg gacctgaagg gcctggagct ggagcctgac     56580
     cataagtagt ggctataacg aggaagaaga tgaagagatt agagaaaatg aatgttcttg     56640
     aagtagccat tgttgtagtt gttgtgtgtg tatgttgaga tgttttgggg tttgttatat     56700
     agagagagat gtagtttggt gaagagtagg attctcttac tagtgtgaag attattacta     56760
     ggtaactaaa tgagattcta tcaactaagt cattagagat tggaaatgtt tcttttaggt     56820
     ttaataaagt ttgtttgaat tgagaaagag agaggagaga cattgctttg aagggagagt     56880
     ttgggtgggt gaggattgaa aatgaaaaat gaactgaaaa aggtgttata gtgacctgtc     56940
     aaaaaagctg tgaagaagtg ttatccaaga aatatggatt gctaatcata ctactgttca     57000
     ttatgatttt atgtgtcatg tgtgtgccta tcatcattcc ttatatttta gttggcaaaa     57060
     aaaaaaagac ttggaagtat tgaaaaccaa atctgatctc aacctagaca agtcgattaa     57120
     agctaaaccg aaaaccgaat cccgaccggt taattgaaaa ccgatccaac cctttaggga     57180
     ctctagcttc actcaaaaga tctacgctgc tgtcaaacca cctgagtact tgctggctct     57240
     tctggcaggt gggaattgct tctcctccat ttcaaatact cgttaatagc tgttgtgccg     57300
     gtcatggtga gtccaaatcc gatcatagtg gctaagacaa tgcacattac cggctgcttc     57360
     acctacacac aagttaatga gagagagtgt gaggaatcaa aaactcttca acaaagtaag     57420
     gtttctctgt gacaacaaag taaggtttct ctgtgacatt acatcaaatc ttacaactct     57480
     gtagaaaagc tgagcgaaaa ggaccacaaa accgaactga acggtggcgt agatccatac     57540
     atagttcttc ttcactgcaa caaaccaaac cacttaagac tgatgatcaa tatagaatac     57600
     gaaaaaatat ataatttcga agtagcttct ttattaccca ttgttgttga tatcattgat     57660
     gcaagaagac cgataatgca agagaacggt aaagctattg caacggcgct agatttcata     57720
     tctataatca gaagctgttc aaggaaacag aagtatgcaa gcatgcttac aatgacaaga     57780
     attggaatat cttgccatac attattgaac cgtgaaatct cgatatccct ggctgctcta     57840
     gaacggtttt gagaatcctg cacacgtaga agggtaaccg ggagatttct cacctcttgc     57900
     ttacacacat cacatgttat gttcccttta attgtaaacc atttgatagt gcacgttttg     57960
     tgggcaagag ctagttcccc tttgcacata cattccatct taaaagcttc ttcatcttct     58020
     tccatttcaa ccatacagat tctacacaca gcttcttctt caggaacatc ttctccacca     58080
     tcatcatttt catctgaaca catatcacat agtttgttac atagagtcaa aatatggcat     58140
     cacaaagata tgtctgggaa ggtgatttgt aaccgtggag tttactcaat ttcgatgcct     58200
     gcgtcatctc tagtctcttc tcatccccac gagacggagt aggaatcacg cggaaaacac     58260
     ttgacggctt tacacttcca tctttgttga agaatgtggg gacagagcgt gtacgacgaa     58320
     taggcagtaa acgctcccct ttctagtaaa aagaacagta aaatcaagta aagcagaaga     58380
     taaacagctt ctctaaagct aagacaaatg gaaaatgaat caattcatca actgaaatac     58440
     tcaacaagat aatctccctt attaatggta taaccaagtt ttgtaagata gaatactgac     58500
     catggatgta accggatcaa cctcaacggc atacctcccg ttcatggact cagggtttga     58560
     gtgagttata aaagactctg tcttcttaga ttttctagga gctaagagat tagtgagaga     58620
     ccatgttctt ggaatataag acttatcact accatctcct aaaggggaca caacaccttc     58680
     ctcaatatct gcactgtggt tcctgttttt gaaattcttc tgattcgttc tgtttcttga     58740
     cgaggaagga ctcattgatc caacacgtct cccagttcta gggctggaca ttggagaaaa     58800
     cttgaacctt ttggaaacgg ggctatgaat taaggaacca tttgctctca agaaatcgcc     58860
     atgagcttct ctcgattgta tatctaacac aaggcctcgc catcgttgat gttggctcgg     58920
     tgatagcatt tctgttatct cagtagaatc tccaacctgg aaaactcaaa agaagacttt     58980
     tgtatcagtt cctcacaaag ttggatcctt gaaaactcat gttcctcaat gagcaattac     59040
     aatccctaga ttttcacaaa aatgtgtgcc ttaaacctgg aatctccgga aaacataatt     59100
     gaagcagttc catgatttac aagtgacaat tcaacaagta ctaatgatca aaacaatccc     59160
     ttaaaccctg atcttataac cctaaactct caagagctaa gctaaatcag aaagaaagaa     59220
     aaagaagatc aattttgaga tacccatgaa ctaaaaacca ctgaaattag cttaaagcat     59280
     gaatctttca ggaaaaattc aaaattttgg gaattgagtt aagacttaag agtgagaaaa     59340
     ctcaccatta gagctggaga agtaccttcg caagaccaat gttctactac ttcgcgatat     59400
     ttatctttat catccatcac catcaaatta caaaacccag aaacagtgaa gtaaaagaag     59460
     aatctcagga aaacaaagta tcaatctttg ggattaattt gcttaaaagg actaattttt     59520
     aggagaaatg ataatctgag aaagaagctt ttgatcaaga acactcatat aggttgcttc     59580
     aattttgtgt gcttactcag tgcctgcccc gtttctctca actaaagaag taaattggat     59640
     tcggcggttt ttatttttat tgttttgtct ctattactta cttaagtaat aacctctttt     59700
     ttttttctaa ttttggtata tatctttaac cagtggtgca tataattttg aatcaaaatt     59760
     tccagcttac atgtcaaata aaaattgtct tcaacattct tgtgaaagaa gaaaaagaaa     59820
     atcatgtttc tattcaaaaa tttgaatgca tcaaatgtgt aaagcaatag taagaaggta     59880
     atcaagtatg gcagcccact caaatgtatg tacagattac agatattcat aacattttaa     59940
     aaaatgattc aaaaatggtt tatggatatt atctgaactt ctgctgaatg ttttagaaca     60000
     tttcacaaat aggttatgtg tatttctgat catatttgga acaaaatctg attaaacaaa     60060
     aaaaagaaac aatgaatttt ttaaaaacaa aatctgaaca tatttataac agaaaaagag     60120
     attaggaaaa aaatattatg tatgaaaatt ttgttggaag aaaaatacag attgtcttta     60180
     cttatttaga tgtgcaatgc tgagtttatc ttatactgct tttgaaagat aaaacaacaa     60240
     aaaaaatact tttgtaattt atttattaat tgggaaaaag gagaaaaagt ataacatttc     60300
     gagagaaaga agtaaataac attgagagtg ataaaccttt ggacaacaat ttaaaattct     60360
     gtcgagataa gaacgactca taacgcaaaa tatggtagtt acgctgacac aaacaaagaa     60420
     ataatggata aggcaaaatg taacacgcat cacacctaag taggatcgat gtctcaacaa     60480
     acacatgtac aagtgtacat caaaccgact aaatgtatag attatgttta tgatatgaat     60540
     gactataaga tggttaacaa tgtgaatttt ttttcacgaa actatatcaa cgacgtgtcg     60600
     aaagagcatg taatcttaca aatctgatag catttttagt gctatactct gaaggctgaa     60660
     gcacatgaaa gatgaaatga aatcatgctt gacagaaaat gggacggtga cgatatcaaa     60720
     agcaaaaaaa taattgtgga aggcccaact cggcccaact tagccaaaac tgtgtggcca     60780
     ccactcgact cgtgttcgat ccaaaacata ataggtttac attttacaaa ttttcagagt     60840
     ttttttttgc taacttaaaa aaaaaaaaaa aagagagttt atctatgcta ggttggatga     60900
     ttaatatgat tagcgtacaa tattatttct tttttacaac cattcaaaaa aattagtttc     60960
     ctaaaaactt tttaagaaaa ttaaaacaga aactacttgg gatcaacacg tatgtgttca     61020
     ccacccacac ggatatggac actgtgtagg gacaacagcc aaattcaaca tcaaataatt     61080
     atttcgaagg cacagacaat aagtgggagc cactcgtttt tgtcaaaaat attgaataac     61140
     aaattagcga tataaacaat tctcacttat tctgtttaaa aaaacgatta ttggtagttt     61200
     ggtactacta ctcaataatc atagaagacc atgaaaacga aatccacgta gtatgtgtat     61260
     aatcacaaac ggtcaaacat ttaacattag cataaattct tgtcacgtgg caatattgtg     61320
     gcggtagaat tttaacattg tggttagctt caccattaaa tctgttaaaa gcgcttcctc     61380
     actcactctt cttccccaaa aaaaaaacaa gacagaggaa gagaatcacg aaaccatagt     61440
     cccaaaccct tcgaatctat aagcatttct caaacacaat caagaaactg tgtttagctt     61500
     ttagatttct acaagcatgt aagacgagat tttgtttctt ttttttctgc atggtggatc     61560
     gaacggtgag aatggggacg gaggtgaagt cgattagggt tccaagaagg gtctggtttg     61620
     gatcacaaat atctatagtt ctcctcgtgg gtggaaacca tacctcctcc aggttttgta     61680
     ctcgctagat tcttcgattt tctctttgcg attcttcttt gttcttaaga tctgtttagc     61740
     aaatcgtact agacattaat catattttaa gattccatcg gagctgaagt atttgaagaa     61800
     atcaatgggt ataaagatct tgaagcttaa tatcttccgt ggatctacga ataggcatgc     61860
     tctgtttcgt gctctcatca tcgcctctgc tctatctgtt gtccctttgt tggagttaac     61920
     cgctaaaaat cacgtctttg gtgatcatgg agcagtggat ttggtcgatc tcggccgatt     61980
     tgttattcca ggaccgaaat tgttcttcca taagctcgtt caaccattct ggggtaaaat     62040
     tgagacagag aagtatccac aagtggtaat tgctgatctc gttgatgagc tcatggggtt     62100
     aaagctattg cattatgatg ctaagattct ctgcattggt cagggatcgg attctgctgt     62160
     ttcagggttc aaagagatgg gtttctcagt tgttcaaggg gttcctaagc atccattgtt     62220
     ttcctttttc agtaggaagc atgtcaacga gcttgagctt agtggtgaca agtcttttga     62280
     tttcgtgctc tgtggggatg ttgatcatgt tgcttcccct gctcttcttg tgcttgagat     62340
     ggagcgggtt ctgaagcctg gtggaaccgg agcagtcctt gtgagtacta atgccaatcg     62400
     tcttgtcaaa tccgtgactt cggggcttaa gcagtctgag atagtgcgtg tgaacaactt     62460
     ggataagttc accgtcattg tattcaagag gaatgtaacg gagactgctt attgtattgg     62520
     aaagtctcag ctaccaagag attgcaaatc tgttgacacc aatagacctt acacagagtt     62580
     catggaacct ctactggagc aaaagcctgc tgatttccca aaatcagtag cttacttacc     62640
     taaattcctt gatctctctc tgaaaaagag ccttgtctac attgacattg gagcagccga     62700
     gcacatggat gctaatttaa ctccaaactg gttctttccg ttatacccac tcgacagcaa     62760
     agcattcaat gtctactttg tcgaccacaa cacttcagta atgctatcct atgtcaagaa     62820
     acccggcgtc acctttgttt accatccgga tttggctgag aacaactcga cagggaaaaa     62880
     gataactccg cttgaacagc tagaaccatt tccagaagat gagagattcg atttccttgc     62940
     ttggtttgag gaaactgcga aatacgcaga ctttgtagtc cttaagatga acacaaacca     63000
     agtggaaatg aagttcctaa ctgttttact ggaaacagga gtcatatgct acgtggatga     63060
     gcttttcctc cgctgttcca accacaagtc agactgcatc aacatgcttc aaactctgag     63120
     agccagaggt gtgtttgttc atcaatggtg ggaagactaa accaatgtaa aactcaatct     63180
     cgcttcgcct tagtcttatc tacgtcgatt cgtgtctgtc tttgtctcag ttgtaatgcc     63240
     atcaccttct gtgtttgcca tagttggtcc tcggccacca cagctcctgg ccaagcacct     63300
     ataactaaat aagaagctgc ctatctgttt atcattgcta tttaagaact cagtttccac     63360
     ttataatata ttgaaccata acgttttacg tcttaattaa gcatggcata tattacacaa     63420
     gtcgattgct taactaaatt tgttcattct ccatctccat ttcatccgtt cttgttaatc     63480
     tccaaaagca tctcaacagg ttgtctgcaa actgggcaca gatttgtctg aaaccttaac     63540
     gcctttgcgc acccgctaca catacactgc caaacagaaa tacacaaacc atttcaaaag     63600
     aagttcaatt ttttttttat atgagctaat tttaagtatg atgaacacta taccatgtgt     63660
     ctgcaaggaa gaacagttgt atcgcgtggt tcagacaagc atacaacaca ttcctttccc     63720
     tcatcggaac catcaaccgt gttctcaatc ccataaatct caagcagctc atacctcctc     63780
     ttattcaccc atagtatctg cttcaccact tctattttaa tctctccttt ctccttggta     63840
     tacaccactt gagtaatctg cacattggtg gaaccagact ttccttcttc cgctggagtt     63900
     gcctccgcct taaccgccaa cgggaagaca tctgtatcca cctccttgaa tagctcggaa     63960
     tctttaaacg ccgtcaagtc tatacccgtt ccagatgatt gtatgaactt ctgaccaagt     64020
     ccttctccga aatcaaaagt gattggaggc aaagtatctt cctttgtagc tctaagatta     64080
     cattctgcat cttctgtagc aaagaaaaca actgtgatcc tgttctcgcc aaccaaaaca     64140
     acaaaagcta agtcatttat attactccat tgattgattc aaacaagatt caaactttta     64200
     actaaatttg atcatttcat agtttgaaag taaaaccttc cgggcatgga tgcatcaaat     64260
     gtgaaggaga caagaagtcg attcggattc tccgggtcgg gtatgagcgt taaagtcttc     64320
     ttcttcagat taacatcgtt acgaatcgtg acggctttct ggtggacgta cgtaggaggc     64380
     ggcagtatag ggtatctacc gccgtgaaac aaaggatgag gtagttggta actgttggga     64440
     ggatagtgat gcaaatggtt gaaattgtac ggtagcatcg gcggctcagt tactggcgga     64500
     ggaaggcagt tacctggata ctggtcaacg tagttagggt tagggttcag atatggtggc     64560
     acggcggcga atacaaatct gttcggtggg agttcaagag gagccgtttc catcgccgga     64620
     ggaatattgc tcctctgcct tctcccgcag cagaagatca aactgatcag attccccatg     64680
     atcggaaaaa gaaaaaaggt gaggtttttc ggtgattcag ttgataagga gtagaatcga     64740
     agtaggtttt atgatcattg agaaagggga gtaatgagat tggagatagc gacgtcgacg     64800
     aagaaacacc aaaacgttta tttgtatata ttataaatta gtattaaact tgattaatta     64860
     ccatgggaaa ttgattatta cttttaatca cataaaacaa agaaatcatt atcagtagca     64920
     ctaggcaggc aataggccca aggcctcaca acaatatcac ggttacaaaa taagaagaaa     64980
     cgaaatgaca aaaccggaga cacgagattg gttttggagg ttgatcggaa aacaaagaaa     65040
     cacatccatt aataccggcg attacaagaa gcactgctcg tcattaagaa acatcttgca     65100
     ctgatcgtca ttaagaaaca tcttctctta tgtctgatta tataggagat cataataacg     65160
     tcgataaaaa agagtttaaa gtggaaatca accaagaaat agaaagcact atcaagatat     65220
     atttcaaaat gaatatttca ttaaaatgga ttaaaaaata attaaacact cgagttttga     65280
     tcttgtcttg ttaaaatttt actcatcgtg ttcctcataa attgtcccca gcgaaggcga     65340
     agctgaaacc ctcatcggat aaacaagaat cgccggtaca gtttcgaatg gtccgatcat     65400
     cctagccatg atttgtaaat atactctttc ttcgatttag acttcggcag ctttcgactg     65460
     tgttgagaag atctatgtgg aaattattgt tattgctgat atttatagag atagagagga     65520
     atagtagtag tgtaattaac taatcatcaa gtgatcttta tatatttgta tactttttta     65580
     taggacgcag cttaatactt atcgcacgtg atatttatgt ttcatattta ggtgatgctc     65640
     gaaagttgaa acataagtat gcgtacactg ctttagtttg cagataaatc atacatgtct     65700
     ttattaaaaa ttaatgtaaa ttagattctt ttggttgaga aaatgatcgc accaaacaga     65760
     aatagcggtg agactggttt caggtttaag tttggtttga tatttgaaga tactgatttt     65820
     ttgtcgtgga ccggttatcg tcccggttcg gttagaaagt atattaagat ttgtctttaa     65880
     ttaccaactc gtgagcatat aacaacagat caccgagcgt acaagatgtg aaagttgaat     65940
     gaaaatttca caaagaactg agatttgatt gtacaaaaga tacaatacaa aatctcatct     66000
     tatacagtta tagaaaaaac aacaacaaca acaagagtct atcttaaacc caagaccgag     66060
     taacaaaatg atcattacaa tttacacgtc ctcgttttct tgttcttgat tgtcttcttc     66120
     ggtctctccg ccttctaaaa tcgtctcaag aatcggagaa accgatggct tcgccggaga     66180
     aatgatttgt ggaggaacag cctccatcca ccacgccaca tccaccacca ccgtcagatt     66240
     ctgatcgcac cgattatcaa agaaacacat attcgcttca ctagatatta ttttagattt     66300
     gcggaagtaa ttcaaattgt tactttttga gttgaattga tacgtgttca tttgttcgta     66360
     tttatagaga gattgacgcg tggagatatg tggaacaatg atgggtttga cgtaagagtc     66420
     ggacaagtgg acgatccaca atgtttaagt tagtttgttg acttggtctt atttgctaat     66480
     aataatgaaa ccaacacgaa tattctagaa cctcttgttg tcgtcattat caacaagtct     66540
     cgaatgtgca acacgtgtga gctcttgtct cacacgtcta tatctccgct aagatttttt     66600
     tttgttgttg tcaatgttag gatatttctt tatgcgtcgt atattgcaaa atactagaca     66660
     cacacttagg gtttgaagtt tctcagcaat tgtgtgggta cgctttggac aaatacacta     66720
     ctctacaaat tagtttagac cgcgtttgac tcggtaacgt tagaagcaga ttagacacta     66780
     attaggccca agttaaacta tcatgggctc attcgtaaac ttagttctaa tgggctctca     66840
     acatcagatc ttaatattta tagagagcat gaggtcaaat gcgtagttcc gtatatgaga     66900
     attatgaaac tgaacccata agcattttaa tcacgctgag gaaagtagcc acttctcgtt     66960
     taactaatac ggtaatacct cattctgcct gttttattga tttgtttgga tattttggtg     67020
     caattcgatt aaaaatgtac ctagaaaaca aaattaaaat tgagaaaata aaaaacgtac     67080
     caattgatag aaaaaaagat tattgtacgc tgaaaaagta gaaagaacta gataattttt     67140
     agtgatgaca aaaacgaaaa tcttctttgt gaacttaaat cgctggaaaa catgccatat     67200
     gcagagttaa tcaaaacatt attagcaatc aattgatata tgtatatata aatataagat     67260
     gccttagctt tttcttatat atataattag gttaattaga aaataagtca atggcctgaa     67320
     aaggattgga taagataagg atatttgaaa ggttgctttc attcttcttg caatttcccc     67380
     cttattttag ttttcttagc ttatagaatt catccctcat tttccgtcat ttgatattat     67440
     aacataagat gcatgaggac gacaaaaata gaaataataa gtgaataggt aggtatacca     67500
     tgtacttgtc actagacgat tcgatatttt acatagagat taatctattt ctagggaatt     67560
     attggcacct tatgatcgaa catgtcacct aaaaaaagtg agcttatcac atcgcataag     67620
     ttttgcaaaa atattcttaa actaattttt taatgtatgt cagaataatg tttcatcaat     67680
     cgagaatatg gattagagat ataattcact agcaaaattt tacaaacgga ttcttttttc     67740
     tttttttttt gataaccgaa attgatatat gcttgtatag ggtggtcgaa gctaaggtct     67800
     accatagtta attgctaatt taattattat tagttgtaaa acacacaaga tgacatcatt     67860
     atttgatcta acacaataaa aatagaatta ggcaaatgaa aatcggttta gtaaacgaca     67920
     aatcaacaat gtcatgtgtt ttgttttctg attttggttc aatttaatta tttcaaaata     67980
     attttcttga tatccaaaga tccattttta attcttttat gagagaggtt agagctttta     68040
     ccctcaaagg cctcgaagct attttttatt tttatttttt tttgtaatgt gtcattttta     68100
     ggagtccatt tttcgaacat aacataagca tagatacaat acggagctga tcatttgaca     68160
     taatatgaaa ttttccaaca gttatttgtt cggtgataaa acaataattg aaatcccaac     68220
     aagtagaaga tatgcaacta acaagaaaga ttacgatcat acggctgaac aatgagaatt     68280
     tgatgtttct taatcacgta ggattctatg cataattaga atatatagga atattattaa     68340
     agacaagaga agatttaaga agctcgatta ttatcttact acatgcatta ttattatttg     68400
     ttttttttct tggtacttgt gttttgttat gtatctcaaa gctccaatta tgtagaggtc     68460
     atcgaccaat aattaatcaa ttgaccacac tactctatat tttaaatagt aattggttca     68520
     acaggcaaag acgctctttt atttgacgat tattttctag tataataaaa tctcacaaac     68580
     gtcataattt agttgtaagg aaagcaatag tataaaagaa gtataggtag tgtgagtgcg     68640
     acaaaggaaa taaaacacat acaagacttg aaactattta tgaattatga cttctttgtt     68700
     ttagtaagct aaagtgatac ataaatataa catattatat gtggatatgt acaacaacaa     68760
     atctacaatg aatgtctacg tgcatggtgg atacacatct tctatacatg cacgcggcat     68820
     atatgataat tcatgcaaaa ttaaaataaa gtatcgttat aggagttatt aggccatctc     68880
     cattggtaag atactttaaa agtttctaaa aaaaaaaaat ataataatat tttattatga     68940
     tttagtttct gtccaattat aaacacacat atacacatag tctctcaatc attactcgaa     69000
     agtttttctg cagagaaact attctcaatc tctcttctat ctctctccta ctctattatt     69060
     attttatatt ttttagttaa taagaaacta tgtgacagac tactaatgga gatgctctta     69120
     ttatctagtt gtgaattttg tagaattgac atatgtatta tacacaacta gttatgaatc     69180
     tagatttttt aaaagatttt ataaggatta aatccaccta ttttcattgc tatatattaa     69240
     cctacaatta tatctataat gcataatgca ttggttattt atgtttattg tttacaataa     69300
     tggcaatgaa cgtctataca aaattacaaa gaatatatct aaacaaaaag tgaatgtcct     69360
     tttatatatg accctagcta taaaatttat tcgagtcccc cacatgtttt gttatgttca     69420
     gattattgtc caacagattt accaattata atatgtttcc tgtttctaca ataatatcat     69480
     ctacttgtaa tttgttggct attgcatttt cattttgtcc atcatgcatt tggtaaaata     69540
     ttagtagtat ttcgcaagat gtaccaagcg tcgttaatat ctggtctctt ttgtccattt     69600
     tcgtctttca gcatcaagag aatgaaaaaa ttggagagct gagtgacgtg tcgcgatact     69660
     gacgcctgaa atatccgtaa ttttcaaatt gagatgaggt ccagtgggcc aacttatgtt     69720
     gacaagtgat atctcaccta ttattggccc acgtaatcct tttattatca ggtgtatttt     69780
     aaattatatg taattatttt gtattattat aatttaaaga aagtcatatc aaacagctga     69840
     acactaaata aataaattat aattcttttt taaacactat gtttttgttt tatcttgata     69900
     tatggttgac aaaaatacaa gattgataaa gaaaatgagt cattgtggaa acaaaaaatg     69960
     attccacaat ttgctattta ttttgataga aactatttaa gtaagtgaac aaggcatgtc     70020
     cctatttagt ccacgtgaag taatcggacg tgtcaatttt gtttactgaa tagaggtgta     70080
     ataatccgac gtgtcattca tctttggact atccaataat gtgtgcacag agttgggcca     70140
     tgttcctctg tggacaatcc cactagtaat cctcatacac aatagagtca tattattgaa     70200
     attaactgca atgagttttt agattggata aaactaaaag aaatgaaact ggctaattgc     70260
     aattggataa actgaacatt tatttttaat ttgtatttct atgagtttct aaaacatcgg     70320
     ttcaggtgtc aatcaactgc ttaaatcaaa ttctttattc gagatattga cagatccatt     70380
     cacatcaaat gtatgttcga tatatcatag ttccgtttcg gttgtatcac cggtttattc     70440
     tttctctttt ccttcaaaag aaaacccggt taattatggt ctaattaata caatcctcat     70500
     actattcagt cttagttgat tgtcaaatta actttgtttt agtgttaaca aattataata     70560
     agcttcgaag gtcaataaca ataacagaca gattattaat tgctaattta cacacacaaa     70620
     aaaagactct attgaccatc taaagtgagg taagcatcct ttagaagtcg ctgtgcttct     70680
     tctcttcttc tgcgcacaac caaaaacatc aaacggaccc ataagaacta ccaacaaagt     70740
     ttctgaaaaa tctttgaaca gatgatggat tgatataagc acaccattaa gtacagtata     70800
     caaacaaaat atgcacacct tttaatgtct tccacagctt gtttcctctg ttgaatttga     70860
     agttccataa tgtgaataag cgttgctctc gcctggacat aagagaagat gatcaaaaca     70920
     gtgaaaacaa aaactgatga aatcatgttg tagttaagcg aagatgagat cttctttact     70980
     tggtgaggcc tcaaggaatt gagaaggtga tgcaaattct tgaagataga agaaatttca     71040
     ccaatcctct tcgcatattg agaaggtctg tcaacaagaa catcagcaag ctccaatata     71100
     tgtaactgta gttctctatt cagtgacctg agttcattct tgtaatctac acacaaagat     71160
     atttgaaact ttcttcaacg aaacaaagag gcaaatgaac tcatgtaata agtttgattc     71220
     caattaaggg aagaaccaaa aaccgtactc tagaaagcaa ataacaattg ggttttgagt     71280
     ttgattcaca aagctaaaac aatgacatac caagattaga atctttggga taaagttgag     71340
     gcactccttg ttcttctaag cttggaagaa catcttcagt ctacgaacca aaaaaaatga     71400
     aaactactaa aacacataaa gatgaagatt ttaaagaggg ggaaatgtgg aggagactca     71460
     cagtatagtt gcctccaaaa cagacgtagg tgccttcaat cggaggagga ggttcaggag     71520
     cagaattagg gttttctgag taatccttgt agagtctgta atatggtgga ggaggcggat     71580
     acgtagctgt agccattatt ccctacagat ccaaataaaa aactaagcaa aatcagtaac     71640
     agattcctaa aattaaggtt tctaatcgat gcaacaaacg attcaatcca aaatctaaga     71700
     ctttactcca acgattctgg ataaaatttg caaccatggt acaaagagaa attagggtta     71760
     acaaaaacac gaacctattg ggaatgcaga atcggaaatt ataaccagac gagaataaga     71820
     tcgaagaagc ttttgatttt gctttggaga agacggcgta gagcaagagg tcaataatga     71880
     cgaaacgagt tttgattttc tcgtaaattt tcggttacgt gttcggacgg ttcgtataag     71940
     tctggtttct tttggtttag tttcggttta attaaaacaa tggcttttca gtttaattcg     72000
     atttctgctg tttggatgtg attaatcacc ccactaatga tgttattctt acgtttttac     72060
     atttaaaaaa tagtaaatat ttttacttta taataaataa atatattttt tgtgtattct     72120
     agattttttt gtcaatttaa atagaaatta acaaatattt taataacaaa aaaaaattaa     72180
     aacagctaaa aaaatcatat ctaacaacat taaatcttaa gataacttaa attaaatcaa     72240
     agacgaagat aaaaattcca ttaacatcat cattttgatc ataaactcat aaagttttta     72300
     ctatttaaga aaaagaaaaa caaaggacga gtgaaacaaa aaaagagagc tcacgataag     72360
     aacgtgagac ttgccacacc ttataaactt ttttttttat cttcttttgt acttttgtcg     72420
     tttactgtgt aagtcataaa ctcacataag tttaacccaa tgagagagct tatctcttta     72480
     ctacatttct ctataaaaat gatcatctca acacatttct ccttcaatct caaatttcac     72540
     aaaaaccctc tcagattttt tctacaagct gatcaaaacc cagaatccag ttttcataaa     72600
     aacatcatct ttcttttatt cttctttaca cgctctgttt ttcatcaatg gcgtcaagga     72660
     agcttttttt tgtcaaacct aaatatatct atccagaacc aaaaccagag atgtccgatg     72720
     agaatgtctt tgaattcgac gaatctgata ttcataactt aggcgatcat caattgccga     72780
     attcattcga cgcgaaaaga tcgatatcaa tctctcggtt acggagaaaa ccgacgaaaa     72840
     ccggagattc aggtaaccgg gagattacaa agaccggttc gcttccggtt aatatccccg     72900
     attggtctaa gatcttgaag agtgagtata gaggtcatgc gatacctgac gatgacagtg     72960
     acgacgatga cgaggatgat gacgatagca acgacggtgg gagacggatg attccgccgc     73020
     acgagtattt ggcaagacgg agaggatcgt cgttcacggt gcacgaagga atcggtggga     73080
     cggcgaaagg aagagatcta aggcgattga ggaacgcgat ttgggagaag attgggtttc     73140
     aggattagta atataataag tatgtaatta attataactc tctataggta aacttttaat     73200
     tacttagaga tcttaagtaa ggacttggtg tttttttatt ggaggggttt agaggatcgt     73260
     tatagtttcg gtccgaagga gaatttttcc gatttccttt tggcgttatt tttgtttttt     73320
     ggagtttttg atcatcgtct atttttcttt ttcttttttg gatatgatca ataatatttt     73380
     atatttttgt gtgtttcaaa tatgttgaat tttggttgtt gtgtggttac ttcaattttt     73440
     acagaaatct acagagaaat aggcagtggc ggaactagaa cttgcagctc taggggtcaa     73500
     aatgtataaa ggaatgatca taggggtcaa tttatgtatt tcattggtgt taatttaaaa     73560
     actgtagcaa aaaaataact aaatttcata attccatggg ggtcatatga agaagataaa     73620
     cgaatgctaa gatctattga actcggtaga actaaggaaa tttgaatata acaaagctgg     73680
     attgagttta atttcaaata tgttaatttt ggatcaataa taatccaaaa accaaccaac     73740
     taacgaaaac cggactagtc actacaacag ttcaaactaa attcttcaca aaacatctct     73800
     tcaaagtttg aaaaccttaa tagtcacgtc ttttgaaagt cgtaaattga accatatatt     73860
     tatatagttt ggctctaaac gataggttac aaaagtcttc agcttagaaa tgatgtgttt     73920
     tctacacttt tctcttcttt tttttctttt catctcacat gaatcaaaaa gagaaagctt     73980
     aattacatta aaggttgatg tgatatttac tttctaaata tttgctagaa gaaattataa     74040
     tgataacatt aaattaagtt atagtcattt ctatttcggt tgtctcccac tttctgctat     74100
     gcttttacaa caacagttca agatttggaa tcgttttctt tctccaccaa tcgtagtaat     74160
     acttcttttt gtgtttgttg aaattttgca agattctctc ttcctctggt taatacacat     74220
     aacttacttg gtaagcttgg ctgcattttc ttttcaagct tttaatcaaa gactcactag     74280
     aaattgcaaa ggcaaacata aaattatgtg atcaaactcc tactgtgagt ttttggttac     74340
     aaacaaaagt taaaaacaaa agcttgatat ttaaaagata aactcaacac atatgcattt     74400
     gactggcgca cagaagacaa ttcaagactt gggaaaacag tgagccatca aaatcgtcag     74460
     ataattcagg gaatatattg aatgtggaga tgtggtaatc acactattgc acacaaagag     74520
     tggcaaacaa gcggcgccct tggtttggta tagtaagaga caattgtttt ggactgtttg     74580
     tgttgccata ttcacaaaaa tactattgag ctatgtatgt taaacattat ggtcaatgag     74640
     tagtagtgaa cattcaagtt tttttttttt tccacttcaa gtttttcatc ttattattat     74700
     ttttcgttgt gatgcagtag tacggcccat cttcaccagt agtatatcaa agccgaaaca     74760
     gatgacaaat tgtttaacat gcacttggat tattattgag agttgaaata caaaggcccg     74820
     ttacaagccc aaacgaaggt acataaaaga aaagcagaaa atgaaaacga aatcgatagg     74880
     gataagtttt tccaactgac ggaaacacaa actacaccag gtgaaataga tcacctccca     74940
     agtgcatgag acacgaacca accacttatc atcagatcac aaaaagctta gaagcttcca     75000
     ccacgaagac gaagaaccaa gtgaagagtc gactccttct ggatgttgta atctgcaagt     75060
     gtgcgaccat cctcaagctg ttttccagcg aagatgagtc tctgttggtc tggtgggatc     75120
     ccttccttgt cctgaatctt agccttgaca ttatcgatgg tgtctgagct ttcaacctcc     75180
     agagtaatgg tctttccggt aagggtcttc acaaagatct gcataccacc acggagacga     75240
     agcacaagat gaagtgtcga ctccttttgg atgttgtaat ctgcaagggt gcgtccatct     75300
     tcgagctgct taccggcaaa gataagcctc tgctgatccg gaggaattcc ctctttatct     75360
     tggatcttag ctttgacatt gtcaatggtg tctgaactct caacctcaag ggtgattgtt     75420
     ttaccagtga gggtcttgac aaagatttgc ataccacctc tgagacgaag caccaaatga     75480
     agggtcgact ccttttgaat gttgtagtca gcaagagttc ttccgtcttc aagctgctta     75540
     ccggcaaaga taagtctctg ctgatccgga gggattcctt ccttgtcctg gatctttgct     75600
     ttgacgttgt caatagtgtc agagctctca acctccaaag taatggtctt gccagtcaga     75660
     gtcttgacaa agatttgcat accacctctt aaacggagaa ccaaatgaag ggttgattct     75720
     ttctgaatgt tgtaatcggc caaggtacgg ccatcttcta gctgtttacc ggcgaatatt     75780
     aatctttgct gatccggagg aatgccttcc ttgtcctgaa tctttgcctt aacattgtcg     75840
     atggtgtcag agctctcaac ctcgagagtg atagtcttgc cagtgagtgt tttcacgaag     75900
     atttgcatct gaaataaaac aatagaacaa gtagaaacca atcagcgaac atataccaaa     75960
     tcaaaagccg taagagaaat caaaacaaca ccaaagagaa acggatctaa acataagaaa     76020
     cctaaaacag agagaatcga acaaagaaaa cacaaaaatt gaatagatcg tccttgaaaa     76080
     tcctaatttc acaatcaagc aagaaattac acagatgtaa acactacgaa tcgatatctt     76140
     agtaatcagg acaaaattta gaagctggat tgacgaaacg aacaatattg tcaaaagcaa     76200
     tttatacaaa agattcaata atccacataa caaaaattgg agatcagata cgaatcaaaa     76260
     acaaaaagaa tcagaaaata taccttgaaa gagagagtcg cgagagattt gcagagatcg     76320
     ctttaggctt tgggagagat tgaagagtca gaaaaagacg aaaggatgaa ttattatctt     76380
     ccacacgaag gtcttcttta tatcgcaaac caaaagccca aaaccgtctt ttctattaat     76440
     gagaataaaa tatctttagc caaaacaaaa aaaggaagat atcagttgag gattattatc     76500
     acgaaactaa aggaaggaat catatgatac gtgtcatatt ttccaccgtg cgtttttaaa     76560
     agaccgactc aagtagaaac atcctatggt ggtggttgga ttaggtcatc cattacatct     76620
     gcttcactga catttttcta tttttctttt tgtatatact tttcctcaaa taatttcttt     76680
     cttttctata gaagaattta atcaataagg aaaaagttca aaaaagattc tttccattaa     76740
     gactatgtct tggttaaccc aacccattaa gaataagcaa tcataatata tatagagaat     76800
     actaatacta tatatgagat ttttctttta atttcatgtt gattatgata gtttatcttc     76860
     ttgatttaat ttatcaatac ttggcataaa agattctaat ctactctaat aaagaaaaga     76920
     aaaaaaagta tctaccattg actaattaaa ataaggaaac ttatctacca aatttgagta     76980
     ttttttagaa caatcttttt ggtttaattc caaaactcta aacctaattg ttgggaaaaa     77040
     ggacctaatt tttaagaaaa gttaataatt agaagatctg tatgtttttt tttttgatcc     77100
     aagtttttat ttcttttctc tttttttcat gataaaatct atgttttttt agtctacaat     77160
     taaagtaatt gttattattt tctttatctt tttttgttgt tgttgttaat tccctttttt     77220
     tttttttaac agcaacttct taaaaaaaaa aacagttggg ccttgaattt atttcaggcc     77280
     tgcgttatta agcccagata ataactcaaa acaaaaaaaa tgttgaaccg gaataaaccc     77340
     gcgagattaa atgccggttt tcaggtaaca tagaagaaga atatatgagg attgaagaag     77400
     tattcaagag gcggaacaat tcacaagtcc aagagcttaa atttctcctc actcttctgc     77460
     tacagactcg gaactctttc tctttgctaa aataagatgt tcaggatttt tgttgcccga     77520
     caattcatgt atctcacact ctctctcttc tctgttctta ctactctgtt acattaccac     77580
     caactcaaga ctttcttcca caatggcgtt tatgagactt ggctccaaat ccgaagcttt     77640
     ccatcgtgaa ggccaaacct ggtattcttt cttctgcatt gaattagact aatcgactta     77700
     taagtctttg tttccggttt cgagatcgaa ttctcttcaa tgtcgttaat ttctcttgat     77760
     tttatatgta atcaagctct catctttttg ttgaaatcga aatgggctct tcctagaatc     77820
     gttagttatt gatgcaagtt tcaaagatca tatttttttt ggaatttagc tctgattgat     77880
     ttgtgacatc aataatcaat tttgtacgga caagtatatt ctgttttggg tggtggttta     77940
     tgtctctctc ttgtcttaca ggctttgcac tacaggactc gtgagtgatg ttaccattga     78000
     agttggagac atgaagtttc atctccacaa ggttaaattt tctctatctt ctctgtttat     78060
     ttagtcctag ttttgatgta attgcataaa tgtgaaagct tgatgatcta actgtgtaat     78120
     gtgtgttctt gatttgtgtg tagtttccgt tactatctag aagtgggctt cttgagaggt     78180
     taatcgaaga gtcttcaact gatgatggat caggctgtgt gttgagctta gatgagatac     78240
     cgggaggcgg caaaacgttt gagcttgtta ccaaattctg ctacggtgtg aaaattgagc     78300
     ttactgcttt caatgttgtt agccttagat gtgcagctga gtaccttgag atgactgata     78360
     actatggaga agggaatctt gttggtatga ctgagacttt cctcaacgag gtgtttggga     78420
     actggactga ctcgatcaaa gctcttcaga catgtgagga agtgattgat tacgctgaag     78480
     atcttcacat tatctccagg tgtgttgatt cgttagctgt caaagcgtgc gctgatccaa     78540
     gccttttcaa ttggcccgtg ggaggaggaa agaacgcaac gagcgggcag aacactgaag     78600
     atgaatcgca tttgtggaat ggaatctctg cctctggaaa gatgctgcaa catactggtg     78660
     aagattggtg gtttgatgac gcttcttttc ttagcttgcc tctctttaaa agactcatta     78720
     ccgctattga agcacgtggc atgaagctcg agaatatagc gatggcggtt atgtactata     78780
     caaggaaaca tgttcctctg atgaatagac aagtaaacat ggatgagcaa gtgattgaga     78840
     caccaaatcc ttctgaagaa gaccaaaaaa cttgtcttga agagattgtc gggttgcttc     78900
     caagcaagaa aggtgtaaac ccgaccaagt ttcttctcag gctgcttcaa actgcaatgg     78960
     tgcttcacgc aagccaatcc tcgagggaga atctggagag acgaattgga aatcagttag     79020
     accaagctgc tctagttgat cttcttatac caaacatggg atactctgaa acgctttacg     79080
     atgttgaatg cgtcttgaga atgatcgaac agtttgtttc gtcaacggaa caagcaggca     79140
     ttgtcccttc tccttgcatc atcgaagaag gacatttggt gaaggatgga gctgatttgc     79200
     taactccaac aacgttagtg gcaactcttg ttgacggtta tcttgctgag gtggcacccg     79260
     atgtgaacct gaagctggcg aagttcgaag ccattgctgc tgcaatccct gactatgcaa     79320
     ggccactaga tgatggagtt tatcacgcaa ttgacgtgta cctgaaggta ataaagatac     79380
     tgtttctaat tttaaccagt ccatgtatta agattttgat gctggattgc aaattttgca     79440
     ggcgcatccg tggattactg attcagagag agagcacata tgcagactca tgaattgcca     79500
     gaagctctca ttggaagcta gcacgcacgc ggctcagaac gagaggctgc ctcttagggt     79560
     gattgttcag gttctcttct tcgaacagct taggctcagg acatctgtat caggctggtt     79620
     ctttgtctct gagaatctag ataaccccga taaccaacat ggcgctaatg gcggtttact     79680
     taaacccaga ggtgagaacg taagagaacg ggtttctgag ctggaaaagg agtgtatgaa     79740
     catgaaacaa gagctgcata agctggtgag gacgaagaga agctggaaga atttcaccag     79800
     gaagcttaac ttcaagaaga aatcagaatg ctgcaagcca aaggatcaag caacaccagc     79860
     aatttgagca aaatcctctg ttttaaggca gagctactag tattatcttc ccgcttagat     79920
     tagctttgtt tttctggttc ttgatgctac tttgttttca aaagttttca tctttctctt     79980
     agtatctcgc taagagtttt gatgctttta agataaaaac aagagctctt ttcagagaaa     80040
     attaatttca tttcttatgc aatttcgggg tgtattatgt tatgcagccc cataggaaac     80100
     aatctcagac acaaatcaac agaagggaaa tacaatcaac aaagaatatc atcagcgaaa     80160
     cttaacaaat aaagacgaag aatcagagta gtgttcccat ctcagattct taacaggacg     80220
     gatagtcttt aggcggtggt agaacggaaa gctcaggtgt ttccccgttc tcgacgacga     80280
     aagccatctt caaaccccac attgtatgga cttccaagtg acagtgcata aaccaaacac     80340
     ctgcaacaac acatgcattg atcagttgat ctacttatca tatatggtca tcatcataat     80400
     catatatgtg cattgagaga ttgatttata cctggattat cagccctgaa tctgatggca     80460
     gcccaaccac cggtaggtac tccaacggtg tttctctcag gcgggtcaac gagattgaac     80520
     ttagcaggat ctttcttggg atcaaagttt ccaacaccgg ttccaacgac aaagaagttg     80580
     tagccatgaa gatggaaagg gtgtgactca acggttagga gattggtgtc ttgcaagacg     80640
     agctcaattg tagtattgaa cttaactcgg ctaagtcttg tccccgttga tgttccaagg     80700
     ttagccgtga gcggcacacc ggtgtagtta aacgctttgg gtggtcggtc tgggaaatca     80760
     gtcctgaaaa cacctgagat gttggagtaa tgtgctttca agagtgcagt tttgggcata     80820
     atgaatgtga tattgtttat agaagctgcg agatttgtcc cgttaacaca agtcgggcac     80880
     gcgttaatgc ctagcccgat cgtgtagaac aatcgcctgt cgacttttaa aggaacaaga     80940
     gccggaaaat tcggtgtgtt gaggctcttg agctttccgt tatagtccaa agcaaatgat     81000
     gtgtcgttag gcaaaggaag ctttggtagg attggtaaga ccgtgtttgg tacgcctttg     81060
     tattgaagaa tagcggttac tgttttgttg tctacggata caggagcgtc cataaacgga     81120
     ctagctgcca tgaagtagcg gtttggtgac cggtcggttt tgactaaaac attagtggtt     81180
     tgacctggtc cgagtaaaat ggctttggtt gtgaatggtt tagtgtagac cgcatcgatt     81240
     tccaccacgg tcatgttgtg tcccgcaatc ccgaagaata gctcgtcgtt taaagctgcg     81300
     ttgataatcc ttagaagata tgttttaccc gcttcggcct ctatgacgaa cgtgtctgaa     81360
     aatatgcatg tacgaaaaag atttaatgat atctgagatc cggtccgatc cgataactta     81420
     cggtttaaaa aggtttagaa cttttacgtt tctcggaaca tggaaatagc ggtccaggtt     81480
     ttccgttaat ggtatgagca tccgacatcg gaggcggtgc acccaattgg ttggcttggt     81540
     taaccgcagt ctcaacgtct ttgttccacc attctcctac agtcaaataa aaaaccaagg     81600
     caatgagaaa aagaaaaatt taaggatggg actaaaccga ccggttttgt tttattttca     81660
     ctaaccgagg attatgttag attcttggta tggctgtggg aacggatacg gttttcccgg     81720
     tgcaggcaag ataacaatag ctccgtagac ggtggctcgt agccagagga tgtgtgcgtg     81780
     ccaccagagg gtcccgcgtt gtccggtcac attgaaatca taaaggtaac tctgtcctgt     81840
     ttggatcgga cactgagtta tgtatgctgg accatctgcc caaccgttcc ggtactgttt     81900
     aagcccatgc ctgttaaaca aaccgttata ttttggttca gaaagaatga ttaaactggt     81960
     tgcgccggtt tgagacttag gaaagagatg ttttaccaat ggatggacat gttgtattgt     82020
     acatggttgg ttacgttgat gatgactcga tcaccttctc ttgcgtaaac cgtcggtcca     82080
     gggaacattc cattaaccgt gacaatcggt ttagcattgc atatccggct tatgttcttc     82140
     acttgaacct gttccaaatt tcaaacgtta atacaacaaa cctacatatc ttgggtttac     82200
     aataaaccgg tttagttaaa ccagtataat ttgtattccg aattatcgaa cacctacatc     82260
     gaattggtac ttcttcaccg ccgcatccac cggagaatag ccaagaaacg caagaagata     82320
     acagaataga aagagaaaac ccatcttcat ctccggttca attttccggt ttgatgcaat     82380
     gatgagattt tatttgtact taatcttcta ctgcttttgg ttatacaaaa tgttgtgaag     82440
     aaatagtcgc tggttacaaa tgcttatata gagccatcat gaaaagaaaa ggttggtgaa     82500
     tcactctgga tatgaaaata ataatgtgaa aacacacata aaataacatt attaagaaaa     82560
     gcttagagaa atatagaatc gaagaagaag gcttgtaagc aactttctga aagacgttgg     82620
     cgaatcagcg taacgtttgt taatattatg gagtaccttc gaagttgata tctcagcttt     82680
     ctatttatgt ttttgacttt tcgttaacaa tgaaaaataa taatttcggt gtatagttat     82740
     gttatcatca caaaagccct ataaatcaaa gatgaaacta ttcttataat atttcttttt     82800
     ataccaaaga cccccaagtt cgaatgaatc aatctatttt catatttttt ttctttcata     82860
     taaccgatcg aattatgtat ttcgagaact caattagtat cagttaatat ttctatttta     82920
     ttttttattt ctgaaaactt gctttgcagt aacatgttgc ttagccattc gtttagtctg     82980
     taaatttatt ttctttttga gattatttgg ttccaattat atagtgatgt tttggcgtaa     83040
     cggaaaatga ctgctctttt tgaccatttt gtttttgttt tcggccaacg agatcatatg     83100
     tataattttc taaattaaat tctcaacaaa tgtattttaa tttacaggta cgaaaagttt     83160
     ggtcaaatta tttaaaattt acgctgttga ttagtcaaaa tcataaacgt tggatcatag     83220
     gatcaaacac tttgagtcca aaagcccata acgaaaagcc catattgtat catttacaat     83280
     gttttgtcgc gtataatcat attataattt ttataatatt ttactttgta agatcatcgc     83340
     atttgttgtg aatgagtggt ttagaatcta ctagaaagag aaatgtcaaa aaaaaaaaaa     83400
     aaaaaaaata ccacaagttt ttggaacttt tgattgtttg ttattgggtg atactattct     83460
     atgtttcatc ttggtttcaa tagctaattt agatatgaat taggggagac aacacattgc     83520
     tttggccaaa gcgaaacgcg tcgtattaac gtgtcttagg acataagtaa tatagtcagg     83580
     tccaccaatg acatagtgac aaattttctc acgctttaat tctgccacgt tataaattac     83640
     catccgctat tatgctgaaa tatgatatac tattgtgcta atgctacaaa ttaaccataa     83700
     tttcgctttg tcgtataatc tgaaacataa tatatctcca cgttgtatca ttaaaatttg     83760
     agtttttatt gcaaggagaa aatcaacact aaagcatttt ttgtcgacac ccaacatata     83820
     tacaccaata catttgctac cctaatcata tcattgattg gcacccaaac caaagaaaaa     83880
     aaacaaaaaa ttcatagctt taaacaatca cgagaaataa aatccaatca aatcatacgt     83940
     atcttattct ttagcgtcga acatatatga aatcatttta tgctggccta tccagaacag     84000
     gaactcctat tatcatcatg aacagaaaca atgtagattc aagaaagaca agattttcac     84060
     agtataatat caactttcct ttccgtggcc atgcatataa taataacttc ttaaattatt     84120
     gcggatatag acaaatatgc aactttttat atctctaggg gatagattgt gaggactagt     84180
     ctctaaactt tgacctaaaa ggattttcag ttattaaaga aactaacttt taagtaccaa     84240
     aatttaaata tttgaaattc gaaaatatta gctagcggaa atgcggaaat ttagtataaa     84300
     tagttttata acaatatgca attggtgttt ggatgaccga ttcatcaaat agacaattca     84360
     gcgattcata gaccccaaca aagtttggaa gattgcaaat atgaagtata tgagaaaaaa     84420
     atatatcaaa ataaaaaaat agaaagaaaa aaatagagaa tgagtaaaaa taattcaccg     84480
     attactagac ccccacaaaa tttggaagat tgtaaataat atatatgaaa tatgaggaaa     84540
     aagagcgtgt gagcaccact tgcatgcgat tgtgctactt aaccgatgag ttagaatact     84600
     gttgatagaa agagctagcc agagagtgga acactcgtgt gaccacgttt ctcacgtgcc     84660
     tagcagactt gagaaagaca atccacacta taaaacataa caaagggtta gagaagaaga     84720
     gagttaatta aaacacacaa aaaaagagag agagagagag agttaactaa taatagactt     84780
     gtcttgtgta aaaaaaatta ttcatttgtt tttccataag aactagaaac aaacaaacgt     84840
     agagaaaaaa aagttgcgac tttgacaagt tagccgaaac aatggagaat gaagagggaa     84900
     aaagagagat gacgaagaaa caaagttcaa ggtttaagag catttgcgtc ttttgtggga     84960
     gtagcaatgg gaacaaagct agttatcaag atgcagccat tgatttggcc aaggaactgg     85020
     tatgcatata tacaacttgc aagttcttta taaaaattct taggtcttct ttaacaatga     85080
     taaaacgttc tgtttttgca ataacatcat gcatgaggat tcttaagaaa ccttgtattt     85140
     attaatacag tctctaatta ataaagagtt tatatgtcaa tttttatttg ttttctttga     85200
     cacaaaccga agacaggata attaccaaat tcggttttca aaatttgatg aacaggtgat     85260
     gaggaagatt gatcttgttt atggtggagg aagcataggt ttaatgggtt tggtgtctca     85320
     agctgttcat gatggtggtc gtcatgttat tgggtactta ctctatgttt attctatagt     85380
     acttactgca ttaaaattct catcattttt tgttgagagt tatgaaaata aaggtagata     85440
     ggtatggttt ttaattctta ttatgatgca gagtcatccc caagctcctc atgttgcaag     85500
     aggtattaat tgagttttca ttagaaatca atgttcagtg gatctgaata aagaataata     85560
     acaataatgg taatgatgat gctctttttt gtcactctgt caatgtctcg caaacaaact     85620
     caaagttaac tggagaaaca gtaggagaag tgaaggaagt tgcagacatg catcagagaa     85680
     aagctgtgat ggctaagcat tctgatgctt tcattacttt gcctggtaat ttttactctc     85740
     tatctctctc tccatcttct atcttcatta caaataataa agataaactt atgaaaaatt     85800
     aaattattga tattcacttg tgaaaacttt gccactacat ttagagttcc ccaatgtata     85860
     tgatgctgaa atattataaa gctagatgca tatatgtatg gtgatgtttt agtgtttgtt     85920
     ttttccccta cataatgtaa tgttagtgct tttttataaa aaccttttta ttagtcatta     85980
     tagagagctt taaagagtgc gtttaataag taataacatg tggttaatat gatatgtggg     86040
     agattccagg agtcaaagaa tttaaaagaa tcacgacaaa tagttttgaa ataattaaag     86100
     tgaataatca gaaaaagtcc ttgatccatc aacatccaaa agcagtgaaa atagatgtcg     86160
     acaaaggaca tctgtttctt atccaattta agaaaaaatt tatgttcgca atttatatct     86220
     gtaagattta tatttctgag cagacattaa aagatcgtaa tatgagttgc aaaatgttgt     86280
     ttttcttttt tgggtagtgc tggtatatta taaagttgaa tattctgaga gaaacataat     86340
     ggtaactatt gtgatgagtg cactaacctt tgacctttga cttaaaaagt accaaagaga     86400
     agagaaggac tacttttcat aaatcagatg ttgacttttc ttaagaggtc aaaaatgaaa     86460
     gtgaaaaaaa aaaaaaatct tcttgagttt tactatacgt gccacttgac taagtcaacg     86520
     agtcctcact gtcgaagtgt caatcctcag gtggctatgg tacactagag gagctacttg     86580
     aagtgataac ttgggcacaa cttggtatcc atgataaacc ggtatgtaaa ccggtttggt     86640
     ctggtataag ataataaccg acattttgat agagttagct attgttttct ttttcttgca     86700
     ggtcggttta ttaaacgttg atggatatta cgatgcattg ctgttattca tcgacaaagc     86760
     cgtcgaagag ggatttattc ttccaaccgc tcgacatatt atcgtatctg caccaaccgc     86820
     aagagagttg tttataaaat tggaggtata tcgatagatg atacggattt aaccctaaac     86880
     cgaaccatac agtatatcca agtcatgatc ccgttatgat ttattatttt ctagttgaat     86940
     atggtatcac tagatcgaat atctaaacat gcattatctt tgtttcaagt tatgtctaaa     87000
     gctggttaga ctagaccgag tttttgttta ataatcatga aatttttgat tggtgtgtat     87060
     tgcaggaata tgtgcctcaa cacaagtaat aatatgcatc aaaactgagc tccaagacga     87120
     ttcataccaa aaaattgtga atcgggatga gtaaatattt gattatttct tagtcaatct     87180
     aaaagtcgga tttgattagg gagtacaaaa tgtaaatttg ttttgtgatt ttataatata     87240
     tcaactagtg catttcattt acattttaag ttaagttcat atacgtttac gttagatact     87300
     gtaaattttt ggtccgatgg ttttggatat aaggggctgt tttgacattt ccgattatag     87360
     aatagatcat ttgccttcaa tttttctaaa aatgttacgt agacccaagc taaatttatt     87420
     atttgttggg ccaacctaaa cactaatatc gattgcaaca cttggttgtt gaaagaccta     87480
     gctaccactt atattactaa tcaatttttc ttggtttgaa tgtgtagatc aaatcgattc     87540
     aatttactac caaaaacatt tgtctgagct acaactttcg atctaaagtc ctgagccaag     87600
     caatctttaa ttatagaaaa tcattacata atctcgaatt gtttaagtta cttaaaattc     87660
     atatgtctcc tcctaaaaca tccccgattc gatcttattc ttctggtctc cacgtaataa     87720
     ctcacataca ttaaaaaaag aacaaaaata aagaaaaccc acttgattaa acgaaaacat     87780
     ttgttgaatc gaaccaatta attgaacaat aaacgagttc tgatttgtaa ctgacgtctc     87840
     atgtttcgag gttaattact aaaattttca aatctccaat tcttatgaac ccacccacca     87900
     tgtgttttaa gcccaagaga gattcagtga accaagaagg aaaataattt aaattgtccc     87960
     ttacactaat gaaaggttat gttaacaaaa atccatttta ttaatagatt gatagtacta     88020
     ataaataaat atttggacac aaagcccaaa agatcacaat ctagttaaaa aaagatcgac     88080
     aagaaagatt ctttaagctg atgaatgatc tgtaccatgt agctttgttc cctttttggt     88140
     taactgccca aacaacatca acgagacttt ataaaaaaaa aacttcctta tgaccaaact     88200
     aaataactga aattgattta ttagtcaaaa catattaaag aacttatttg tatgatatca     88260
     ttatacattc catatgtaac tgaaatatga ctatcttgac tctttgaaga attctgactt     88320
     tttttattca gtcaaacttt taaattgtgt tggttactca tcggtacgga taaaaaaatt     88380
     cgtatgtgtt atttcaaaag tacttgaaga atattgtttc tatatatatt tatagtgtta     88440
     taaaaaaaca agtgtggtct ctatgttatg gttcattgaa catatacatc aacataggac     88500
     tgagaggagc ccatgttcct ttcattgatg caaaatttta gtttcttgtg ttttaatttg     88560
     cttcctatcc aatgtacatg tatatatact ttcacaagag aatatggata atgttgagta     88620
     tgttaaatat atagtgacaa gttacataaa aaaagcctaa agaaatcaaa ttggaaaaaa     88680
     tagtaaggta caatgtatgg ttatcgaaag cccaagctgt acttccattg atgtaggaga     88740
     tgattaggaa cacgtggatt atatttgacc aaaaatagta gaaattctat ttatatttgt     88800
     tttcttcttt tggttttggg tttgattttg tgatttggat agttcggtta aggatggttt     88860
     gatcaatcaa tataaccata ctaaaatatg attcagttaa ctaactatag taactgtttc     88920
     ttcgttagta aaatgataca tttattggaa tctattgaca aatcttaatg acttattata     88980
     actggtgata acaaaatcta gctattattt tgtatccaac tacatatttt gtataaaatg     89040
     gaaattcgta tatgatattt gtttagttta aaagtagagt gtatttgttt tttcaatgat     89100
     gatttaatga aatcaagctc ttagttgaga tcaaaagaca aataaaacaa aatgtttttt     89160
     tttgttttgt ttcttttcta tttgagggaa ggccatgaat tcttattttt gacaaatagt     89220
     tgttctatgc aattaatatt gatgtctaat acatatacag cagaataaat aaaaacttgc     89280
     tatataaaga cgtattattt atagcattct gtggagtata atgtcgaatc ctgttctcat     89340
     ttccgatttt acatatttat ggtactaacg ccttcattta tttttccatt ttcgttagtc     89400
     aacaacttca gcttttgata acgcctaatt gtatcatcaa ctttagttag ttttctcaaa     89460
     taacgtcatt ttcaaataaa gtttttgatt tctcttttat tatatttatg caaaaggaaa     89520
     attataattt cagtattttg cagaacgctg aaatgtataa tagaacctat tcatgtattt     89580
     ttgtaaaatt ttaaagattg ttttaatact aaaataagta aatcattaaa aaaattccta     89640
     gacattggtc tctaatataa gataaataga tctaaattat gtttggattt taattctaat     89700
     aaaaaggtag ccaaaagtta tatatacaat atttaaacaa ttttatttgt ttaagatttg     89760
     aattttatag tatgcgagaa tcgcgtaaac ttttctcgaa tgtaacaaaa aatttcaaat     89820
     cttctcgaca catgtaatct tttgcgagtt agaagatttg attccttatt ttttgttcgt     89880
     attcttaaag ttagtcacgt ttatattatt tttcgctttg taaccgtccc tttaaatttt     89940
     taataaaaat taaaaaaatt gctagaaaac aacatttttg tattactcaa atcaaaagta     90000
     caaaaataaa tttagctagc gtttcacaaa atcaagtaaa ataatctcca tttgaaactc     90060
     cataatcaag ctgtttgatg tattattatt acatgtaatg aggagaaaga ggggtcgaga     90120
     aatttaaagt aataataatt ctcttcttcg tccatggaat aaactacgat tagtttaaaa     90180
     agattaataa agatggatta aagaaactat atgttaaacc tggaaaattt atttaaaaag     90240
     acgttttttt agctataaga aaaaaaagaa taataccttt atttttacat gttatttaca     90300
     agtaataatt ttttttttct ctctctctct ttgaaggtgg cacgagcacc cataaccttc     90360
     agacctatag atacaaatat gtatgtatac gttttttata tataaatatt ttatataatt     90420
     gatttttcga tcttctttta tctctctctt tcgatggaac tgagctcttt ctctctttcc     90480
     tcttcttttc tctctctatc tctatctctc gtagcttgat aagagtttct ctcttttgaa     90540
     gatccgtttc tctctctctc actgagacta ttgttgttag gtcaacttgc gatcatggcg     90600
     atttcgaagg tgacttcttt caaaaaccct aatcctctgt tttttttttt attttgctgg     90660
     ggggctttgt acggactttc atgggttttt gtagcttttc cctcggcttt tgcgcaaatg     90720
     agactttctg ggtttttttt ccagcttttt ataatttcat caggtggatc gaattcgtag     90780
     tttcagctta gatctctctc cctcttcatt atctggactt tccagacttg gagttcttcg     90840
     ggattgtttt cggtttctgg gttttgtttt aattgcgaga tttaagcttt tttctttttt     90900
     actactgtac ttggtttgtg gttgaccttt tttttccttg aagatctgaa tgcgtagatc     90960
     atacgggatc tttgcatttt tgttgctttt cgtcagcgtt acgattcttt tagcttcagt     91020
     ttagttgaaa tttgtatttt ttttgagctt atcttctttt tgttgctgct tcatactaag     91080
     atcaattatt gatttgtaat actactgtat ctgaagattt tcaccataaa aaaaaaattc     91140
     aggtctgaag ctgatttcga atggtttgga gatatccgta gtggttaagc atatggaagt     91200
     ctatgttctg ctcttggttg ctctgttagg gcttcctcca tttggaccaa cttagctgaa     91260
     tgttgtatga tctctctcct tgaagcagca aataagaaga aggtctggtc cttaacttaa     91320
     catctggtta ctagaggaaa cttcagctat tattaggtaa agaaagactg tacagagttg     91380
     tataacaagt aagcgttaga gtggctttgt ttgcctcggt gatagaagaa ccgactgatt     91440
     cgttgttgtg tgttagcttt ggagggaatc agatttcgcg agggaaggtg ttttagatca     91500
     aatctgtgaa ttttactcaa ctgaggcttt tagtgaacca cgactgtaga gttgaccttg     91560
     aatcctactc tgagtaatta tattatcaga tagatttagg atggaagctg aaattgtgaa     91620
     tgtgagacct cagctagggt ttatccagag aatggttcct gctctacttc ctgtcctttt     91680
     ggtttctgtc ggatatattg atcccgggaa atgggttgca aatatcgaag gaggtgctcg     91740
     tttcgggtat gacttggtgg caattactct gcttttcaat tttgccgcca tcttatgcca     91800
     atatgttgca gctcgcataa gcgttgtgac tggtaaacac ttggctcagg taaacatttt     91860
     tctgatctct aaagaacaaa ctttttaaaa taacaaactg ggctctgtgg ttgtcttgtc     91920
     actttctcaa agtggaattc tactaaccac cttctctatt tttctaacat tttaatgttc     91980
     tttactggga cagatctgca atgaagaata tgacaagtgg acgtgcatgt tcttgggcat     92040
     tcaggcggag ttctcagcaa ttctgctcga ccttaccatg gtagttactt acaatctttg     92100
     ctgttcttaa tttttttatt atgtgataaa attttgattc ctctgacttg agcttctcta     92160
     ttataaacag gttgtgggag ttgcgcatgc acttaacctt ttgtttgggg tggagttatc     92220
     cactggagtg tttttggccg ccatggatgc gtttttattt cctgttttcg cctctttcct     92280
     tgtatgactg gtcttcctgt cttgtttttt ttctccacgt tcttgaaata gcattattgg     92340
     aaattagctg acatgcatac aatttctgac aggaaaatgg tatggcaaat acagtatcca     92400
     tttactctgc aggcctggta ttacttctct atgtatctgg cgtcttgctg agtcagtctg     92460
     agatcccact ctctatgaat ggagtgttaa ctcggttaaa tggagagagc gcattcgcac     92520
     tgatgggtct tcttggcgca agcatcgtcc ctcacaattt ttatatccat tcttattttg     92580
     ctggggtacc ttttttctct ttatatgtat ctctcttttc tgttaagaag caataattat     92640
     actaagcagt gaacgctcta ttacaggaaa gtacatcttc gtctgatgtc gacaagagca     92700
     gcttgtgtca agaccatttg ttcgccatct ttggtgtctt cagcggactg tcacttgtaa     92760
     attatgtatt gatgaatgca gcagctaatg tgtttcacag tactggcctt gtggtactga     92820
     cttttcacga tgccttgtca ctaatggagc aggtttgttc tgacggtttt atgttcgtat     92880
     tagtctataa ttcattttta gggaaaatgt tcagaaatct ctcgtgatta ttaattatct     92940
     tgttcttgat tgttgatcac aggtatttat gagtccgctc attccagtgg tctttttgat     93000
     gctcttgttc ttctctagtc aaattaccgc actagcttgg gctttcggtg gagaggtcgt     93060
     cctgcatgac ttcctgaaga tagaaatacc cgcttggctt catcgtgcta caatcagaat     93120
     tcttgcagtt gctcctgcgc tttattgtgt atggacatct ggtgcagacg gaatatacca     93180
     gttacttata ttcacccagg tcttggtggc aatgatgctt ccttgctcgg taataccgct     93240
     tttccgcatt gcttcgtcga gacaaatcat gggtgtccat aaaatccctc aggttggcga     93300
     gttcctcgca cttacaacgt ttttgggatt tctggggttg aatgttgttt ttgttgttga     93360
     gatggtattt gggagcagtg actgggctgg tggtttgaga tggaataccg tgatgggcac     93420
     ctcgattcag tacaccactc tgcttgtatc gtcatgtgca tccttatgcc tgatactctg     93480
     gctggcagcc acgccgctga aatctgcgag taacagagcg gaagctcaaa tatggaacat     93540
     ggatgctcaa aatgctttat cttatccatc tgttcaagaa gaggaaattg aaagaacaga     93600
     aacaaggagg aacgaagacg aatcaatagt gcggttggaa agcagggtaa aggatcagtt     93660
     ggatactacg tctgttacta gctcggtcta tgatttgcca gagaacattc taatgacgga     93720
     tcaagaaatc cgttcgagcc ctccagagga aagagagttg gatgtaaagt actctacctc     93780
     tcaagttagt agtcttaagg aagactctga tgtaaaggaa cagtctgtat tgcagtcaac     93840
     agtggttaat gaggtcagtg ataaggatct gattgttgaa acaaagatgg cgaaaattga     93900
     accaatgagt cctgtggaga agattgttag catggagaat aacagcaagt ttattgaaaa     93960
     ggatgttgaa ggggtttcat gggaaacaga agaagctacc aaagctgctc ctacaagcaa     94020
     ctttactgtc ggatctgatg gtcctccttc attccgcagc ttaagtgggg aagggggaag     94080
     tgggactgga agcctttcac ggttgcaagg tttgggacgt gctgcccgga gacacttatc     94140
     tgcgatcctt gatgaatttt ggggacattt atatgatttt catgggcaat tggttgctga     94200
     agccagggca aagaaactag atcagctgtt tggcactgat caaaagtcag cctcttctat     94260
     gaaagcagat tcgtttggaa aagacattag cagtggatat tgcatgtcac caactgcgaa     94320
     gggaatggat tcacagatga cttcaagttt atatgattca ctgaagcagc agaggacacc     94380
     gggaagtatc gattcgttgt atggattaca aagaggttcg tcaccgtcac cgttggtcaa     94440
     ccgtatgcag atgttgggtg catatggtaa caccactaat aataataatg cttacgaatt     94500
     gagtgagaga agatactcta gcctgcgtgc tccatcatct tcagagggtt gggaacacca     94560
     acaaccagct acagttcacg gataccagat gaagtcatat gtagacaatt tggcaaaaga     94620
     aaggcttgaa gccttacaat cccgtggaga gatcccgaca tcgagatcta tggcgcttgg     94680
     tacattgagc tatacacagc aacttgcttt agccttgaaa cagaagtccc agaatggtct     94740
     aacccctgga ccagctcctg ggtttgagaa ttttgctggg tctagaagca tatcgcgaca     94800
     atctgaaaga tcttattacg gtgttccatc ttctggcaat actgatactg ttggcgcagc     94860
     agtagccaat gagaaaaaat atagtagcat gccagatatc tcaggattgt ctatgtccgc     94920
     aaggaacatg catttaccaa acaacaagag tggatactgg gatccgtcaa gtggaggagg     94980
     agggtatggt gcgtcttatg gtcggttaag caatgaatca tcgttatatt ctaatttggg     95040
     gtcacgggtg ggagtaccct cgacttatga tgacatttct caatcaagag gaggctacag     95100
     agatgcctac agtttgccac agagtgcaac aacagggacc ggatcgcttt ggtccagaca     95160
     gccctttgag cagtttggtg tagcggagag gaatggtgct gttggtgagg agctcaggaa     95220
     tagatcgaat ccgatcaata tagacaacaa cgcttcttct aatgttgatg cagaggctaa     95280
     gcttcttcag tcgttcaggc actgtattct aaagcttatt aaacttgaag gatccgagtg     95340
     gttgtttgga caaagcgatg gagttgatga agaactgatt gaccgggtag ctgcacgaga     95400
     gaagtttatc tatgaagctg aagctcgaga aataaaccag gtgggtcaca tgggggagcc     95460
     actaatttca tcggttccta actgtggaga tggttgcgtt tggagagctg atttgattgt     95520
     gagctttgga gtttggtgca ttcaccgtgt ccttgacttg tctctcatgg agagtcggcc     95580
     tgagctttgg ggaaagtaca cttacgttct caaccgccta caggtaacaa aaaccgcagt     95640
     agttcattga aaatcacagt tttgcagttt gaaaatattg acatgtatgg atttaaacag     95700
     ggagtgattg atccggcgtt ctcaaagctg cggacaccaa tgacaccgtg cttttgcctt     95760
     cagattccag cgagccacca gagagcgagt ccgacttcag ctaacggaat gttacctccg     95820
     gctgcaaaac cggctaaagg caaatgcaca accgcagtca cacttcttga tctaatcaaa     95880
     gacgttgaaa tggcaatctc ttgtagaaaa ggccgaaccg gtacagctgc aggtgatgtg     95940
     gctttcccaa aggggaaaga gaatttggct tcggttttga agcggtataa acgtcggtta     96000
     tcgaataaac cagtaggtat gaatcaggat ggacccggtt caagaaaaaa cgtgactgcg     96060
     tacggatcat tgggttgaag aagaagaaca ttgtgagaaa tctcatgatc aaagtgacgt     96120
     cgagagggaa gccgaagaat caaaactctc gcttttgatt gctcctctgc ttcgttaatt     96180
     gtgtattaag aaaagaagaa aaaaaatgga tttttgttgc ttcagaattt ttcgctcttt     96240
     ttttcttaat ttggttgtaa tgttatgttt atatacatat atcatcatca taggaccata     96300
     gctacaaacc gaatccggtt tgtgtaattc tatgcggaat cataaagaaa tcgtcggttt     96360
     gaaatgttaa atctcctaaa ccggatctct gcacgtagct gacacatcga cgctagatta     96420
     ctgacacgtg tccttatcaa tatttcttct cgaaacgtct tactgtttca taaagtcctt     96480
     caaatttctg gggaactaag aaaatccagc agagtaacta atccaatggg ttatgtaatc     96540
     tacatatcgt tcccggcgat tcttctcctt ctgatcgtcg ctatcgcctt ttatctcatc     96600
     ggacgaaaaa tcggccggag agaagggatt caatcaacgt cgcagttaca ctacggaccg     96660
     ccgttggcta attttccggc acctgcacca ccgcataaag ctatggagaa gccaccggag     96720
     ccggtttagt gtatgtatga tgacgtaata atacttacgt attacgtaaa cgttctatat     96780
     atgtagtttg tgtgttaaat aagatgtaat tgggccgatg ctgaaaccaa ttttaaaaca     96840
     actctttatt gggcctgggg tttaaggaaa cacttcgtgc cgtttaaatt ccgtactcac     96900
     ctaatgcaac ctagaaacta cgcagcgttt tgacggaaga agaaatattc gcttcttctt     96960
     ttacaacttt tgtcccacaa cgcagaaaag tcctctcttt ctctctctcg aataataatt     97020
     tttcatttgc tgcgtccttt tggtgcttga agcgatgacc atggcagcaa atctagcgcg     97080
     acggctgatc ggaaaccgat cgactcagat ccttggagcc gtgaactcta gctcaggtgc     97140
     ggctagttct gtcgctaggg ctttctgctc ctccaccact ccgatcaccg caactctctt     97200
     ccctggcgat gggatcggtc ccgagatcgc cgaatctgtc aaaaaggtcc ctcatcctaa     97260
     tctcttttct gcgcagaatt tcgagttctg gaagtcatag ttacgagata attgtttgat     97320
     tgaattttgt acgataattt gtgggaattc ggcaattttg ttgatagttt ttgcgttttg     97380
     tactgatcca ggtgtttaca acagctggtg taccaattga gtgggaagaa cactatgttg     97440
     ggactgagat agatccgaga acacagagtt tcttgacatg ggaaagtctc gaatctgtgc     97500
     gtagaaacaa agttggtttg aaaggtccaa tggctactcc aattgggaaa ggtcaccgtt     97560
     ctttgaacct gactcttagg aaagagctta atctatatgc caatgttaga ccttgttaca     97620
     gtcttcctgg ttacaaaact cgttacgatg atgttgatct cattaccatc agagaaaaca     97680
     cggaaggaga atacagtggc cttgaacatc aggtttagtt tgttttaagt ctattgatcg     97740
     aatatttcag gttagttctt ctaataaatg attctaatga tggttttgtt ttctcctgac     97800
     gcatataata ggttgttaga ggtgtggtgg aaagtcttaa aatcattacc cgtcaggcga     97860
     gtttgagagt tgcagagtat gcttttctct atgccaagac tcatggaaga gagagagttt     97920
     ctgctatcca caaagccaac attatgcaga aaactgacgg tctctttctc aaggtctgcc     97980
     cgttttataa ctccaagcat ttcttatacg gagggatcaa agcaatgatt gttatttctg     98040
     ctagtttttt tttttttaca ttttgttctg agaccatttt tattttgctt ccgtttttca     98100
     gtgttgtcgt gaggttgctg agaagtatcc tgagatcact tacgaggagg tcgttattga     98160
     caactgctgt atgatggtaa gctatgacac cgaatctact attttttcgt taattaagtt     98220
     agtggtcggg actcgggatc accttgtaga tttagaagtt tggtttctta gcaacttgta     98280
     tttgagttct gcttttccac tgtttttaca tgtggaatat gcgactgata atcttgagat     98340
     acctgcagct tgtgaaaaac ccagcacttt ttgatgtctt ggtgatgcca aacctgtacg     98400
     gtgacattat tagcgatctg tgtgccggat tggttggagg actaggattg actccaaggt     98460
     aaaaacactt gttccttcat cttgtgtaat agtgatcttt agtatgatta tgagctacat     98520
     catcttaagg ccttattatc tttgacgcag ttgtaatatt ggagaagatg gtgtagccct     98580
     tgctgaagca gttcacggtt ctgcacctga tatcgctgga aaggttggtc cttcaaacaa     98640
     tatatcattc caatttcatc atttacgggc taaagagtat catttatgca tccaatgttg     98700
     aaagattaat atgtgtgatt tttaaatttg ttgttgtctt tctgttttgg gtgatgtaga     98760
     acttggcgaa cccaaccgcg ttgcttctga gtggagtgat gatgttgcgt cacctgaagt     98820
     tcaacgaaca agcagaacaa atccacagtg caatcatcaa caccatagca gagggcaaat     98880
     acagaaccgc ggatcttgga ggtagttcga ccaccacgga attcacaaag gcaatctgtg     98940
     atcatctctg aacatcgtaa aatccaattc tttatcgaat cttcttttgg gagccttttt     99000
     tatagcct                                                              99008
//

If you have problems or comments...

PBIL Back to PBIL home page