(data stored in ACNUC27125 zone)

EMBL: AL353950

ID   AL353950; SV 1; linear; mRNA; HTC; HUM; 4425 BP.
XX
AC   AL353950;
XX
DT   27-APR-2000 (Rel. 63, Created)
DT   15-OCT-2008 (Rel. 97, Last updated, Version 4)
XX
DE   Homo sapiens mRNA; cDNA DKFZp761L0516 (from clone DKFZp761L0516)
XX
KW   HTC.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-4425
RG   The German cDNA Consortium
RA   Ansorge W., Krieger S., Regiert T., Rittmueller C., Schwager B.,
RA   Mewes H.W., Weil B., Amid C., Osanger A., Fobo G., Han M., Wiemann S.;
RT   ;
RL   Submitted (20-JAN-2005) to the INSDC.
RL   MIPS, Ingolstaedter Landstr.1, D-85764 Neuherberg, GERMANY
XX
DR   MD5; 4b76d2499b16fd2f0e723560237bfb8b.
DR   Ensembl-Gn; ENSG00000138814; homo_sapiens.
DR   Ensembl-Tr; ENST00000323055; homo_sapiens.
DR   Ensembl-Tr; ENST00000394853; homo_sapiens.
DR   Ensembl-Tr; ENST00000394854; homo_sapiens.
DR   Ensembl-Tr; ENST00000512215; homo_sapiens.
XX
CC   Clone from S. Wiemann, Molecular Genome Analysis, German Cancer Research
CC   Center (DKFZ); Email s.wiemann@dkfz-heidelberg.de;
CC   sequenced by EMBL (European Molecular Biology Laboratories,
CC   Heidelberg/Germany) within the cDNA sequencing consortium of the German
CC   Genome Project.
CC   This clone (DKFZp761L0516) is available at the RZPD Deutsches
CC   Ressourcenzentrum fuer Genomforschung GmbH in Berlin, Germany.
CC   Please contact RZPD for ordering:
CC   http://www.rzpd.de/cgi-bin/products/cl.cgi?CloneID=DKFZp761L0516
CC   Further information about the clone and the sequencing project is
CC   available at http://mips.gsf.de/projects/cdna/
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..4425
FT                   /organism="Homo sapiens"
FT                   /mol_type="mRNA"
FT                   /dev_stage="adult"
FT                   /clone_lib="761 (synonym: hamy2). Vector pSport1; host
FT                   DH10B; sites NotI + SalI"
FT                   /clone="DKFZp761L0516"
FT                   /tissue_type="amygdala"
FT                   /note="protein phosphatase 3 (formerly 2B), catalytic
FT                   subunit, alpha isoform"
FT                   /db_xref="taxon:9606"
FT   CDS_pept        407..1972
FT                   /codon_start=1
FT                   /gene="DKFZp761L0516"
FT                   /product="hypothetical protein"
FT                   /db_xref="GOA:Q08209"
FT                   /db_xref="H-InvDB:HIT000026275.18"
FT                   /db_xref="HGNC:HGNC:9314"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR006186"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="InterPro:IPR041751"
FT                   /db_xref="PDB:1AUI"
FT                   /db_xref="PDB:1M63"
FT                   /db_xref="PDB:1MF8"
FT                   /db_xref="PDB:2JOG"
FT                   /db_xref="PDB:2JZI"
FT                   /db_xref="PDB:2P6B"
FT                   /db_xref="PDB:2R28"
FT                   /db_xref="PDB:2W73"
FT                   /db_xref="PDB:3LL8"
FT                   /db_xref="PDB:4F0Z"
FT                   /db_xref="PDB:4Q5U"
FT                   /db_xref="PDB:5C1V"
FT                   /db_xref="PDB:5SVE"
FT                   /db_xref="PDB:6NUC"
FT                   /db_xref="PDB:6NUF"
FT                   /db_xref="PDB:6NUU"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q08209"
FT                   /protein_id="CAB89253.1"
FT                   /translation="MSEPKAIDPKLSTTDRVVKAVPFPPSHRLTAKEVFDNDGKPRVDI
FT                   LKAHLMKEGRLEESVALRIITEGASILRQEKNLLDIDAPVTVCGDIHGQFFDLMKLFEV
FT                   GGSPANTRYLFLGDYVDRGYFSIECVLYLWALKILYPKTLFLLRGNHECRHLTEYFTFK
FT                   QECKIKYSERVYDACMDAFDCLPLAALMNQQFLCVHGGLSPEINTLDDIRKLDRFKEPP
FT                   AYGPMCDILWSDPLEDFGNEKTQEHFTHNTVRGCSYFYSYPAVCEFLQHNNLLSILRAH
FT                   EAQDAGYRMYRKSQTTGFPSLITIFSAPNYLDVYNNKAAVLKYENNVMNIRQFNCSPHP
FT                   YWLPNFMDVFTWSLPFVGEKVTEMLVNVLNICSDDELGSEEDGFDGATAAARKEVIRNK
FT                   IRAIGKMARVFSVLREESESVLTLKGLTPTGMLPSGVLSGGKQTLQSATVEAIEADEAI
FT                   KGFSPQHKITSFEEAKGLDRINERMPPRRDAMPSDANLNSINKALTSETNGTDSNGSNS
FT                   SNIQ"
XX
SQ   Sequence 4425 BP; 1341 A; 838 C; 952 G; 1294 T; 0 other;
     gcgcgcgtgg ggctccattc cgcggtgctg ggtctccgtg ccggggtggg tgctcgtgtg        60
     tgcgcttctc ctccccatcc cccttccccc aagaataaaa gaagaaccgg gaggcgtgct       120
     cagaaaataa ataaataacc accacacacg cgcagcccgg agcgagtcgg cggggctggc       180
     ggcagcggcg gaggaggagt gaaggcggcg gcggcggagg agggacgcgc ggaaaaggca       240
     gcaactttaa agccagctca gagcctagac ctccagccga gcggtttgca gcgcggcggc       300
     ggcggcggcg gcggcggcgg cggcgttgag tgtctggccc gccggtccgg tcggggtgtg       360
     cagtcggacg gacgagcagc gcgtcgctgt cctccggcag ctggagatgt ccgagcccaa       420
     ggcaattgat cccaagttgt cgacgaccga cagggtggtg aaagctgttc catttcctcc       480
     aagtcaccgg cttacagcaa aagaagtgtt tgataatgat ggaaaacctc gtgtggatat       540
     cttaaaggcg catcttatga aggagggaag gctggaagag agtgttgcat tgagaataat       600
     aacagagggt gcatcaattc ttcgacagga aaaaaatttg ctggatattg atgcgccagt       660
     cactgtttgt ggggacattc atggacaatt ctttgatttg atgaagctct ttgaagtcgg       720
     gggatctcct gccaacactc gctacctctt cttaggggac tatgttgaca gagggtactt       780
     cagtattgaa tgtgtgctgt atttgtgggc cttgaaaatt ctctacccca aaacactgtt       840
     tttacttcgt ggaaatcatg aatgtagaca tctaacagag tatttcacat ttaaacaaga       900
     atgtaaaata aagtattcag aacgcgtata tgatgcctgt atggatgcct ttgactgcct       960
     tcccctggct gccctgatga accaacagtt cctgtgtgtg catggtggtt tgtctccaga      1020
     gattaacact ttagatgata tcagaaaatt agaccgattc aaagaaccac ctgcatatgg      1080
     acctatgtgt gatatcctgt ggtcagaccc cctggaagat tttggaaatg agaagactca      1140
     ggaacatttc actcacaaca cagtcagggg gtgttcatac ttctacagtt acccggctgt      1200
     atgtgaattc ttacagcaca ataacttgtt atctatactc cgagcccacg aagcccaaga      1260
     tgcagggtac cgcatgtaca ggaaaagcca aacaacaggc ttcccttctc taattacaat      1320
     tttttcagca ccaaattact tagatgtata caataacaaa gctgcagtat tgaagtatga      1380
     gaacaatgtt atgaatatca ggcaattcaa ctgttctcct catccatact ggcttccaaa      1440
     tttcatggat gtttttactt ggtcccttcc atttgttggg gaaaaagtga ctgagatgct      1500
     ggtaaatgtc ctcaacatct gctcagatga tgaactaggg tcagaagaag atggatttga      1560
     tggtgcaaca gctgcagccc ggaaagaggt gataaggaac aagatccgag caataggcaa      1620
     aatggccaga gtgttctcag tgctcagaga agagagtgag agtgtgctga cgctgaaagg      1680
     cttgacccca actggcatgc tccccagcgg agtactttct ggagggaagc aaaccctgca      1740
     aagcgctact gttgaggcta ttgaggctga tgaagctatc aaaggatttt caccacaaca      1800
     taagatcact agcttcgagg aagccaaggg cttagaccga attaatgaga ggatgccgcc      1860
     tcgcagagat gccatgccct ctgacgccaa ccttaactcc atcaacaagg ctctcacctc      1920
     agagactaac ggcacggaca gcaatggcag taatagcagc aatattcagt gaccacttcc      1980
     tgttcacttt tttttttttt tttttttttt tttgagctgc ggggcatgat ggggattgct      2040
     gcatatcagc agttggatgt tcttgcctct gacagtagct tatttgctct gggggccagg      2100
     aattggattc agtttacact atcattaaaa aagagggaga gagataataa actatatttt      2160
     ggtggggatg gtgattaaac acctcttttg ggtatgcctt ttaaaaatgc ttatagagaa      2220
     aaaaatttta aaaagaaagc taatgctagt atatactgca atgttagggg aatgaacatg      2280
     ttttcctact gcattgggga cttctagata ggttaatgaa aggcctttta ttctgttact      2340
     ggacatgaaa actttgtcta atttcttact ctattgtacg tttacagtcg cagcactaaa      2400
     aatggatgac atcaaacatt tttaacaaaa tgatgtacaa actaaggact atttattgat      2460
     aatgttttgc tactcttgtc agacaatggc tataaactga attaggcagt cttaaaaaaa      2520
     aaaaaaaaac agaaaaagaa aaaaaagaac gttgcaaatt tgttaaaatg ccaaaaagga      2580
     cagtttaatt ttgtacagat tatgcttacc tcaggtttct ttagtgtgct tgaatgccct      2640
     tctttccata taacacttat cttcttctta attcggcaat ggaatatctt ttaagtttta      2700
     aaaaaactgg aataattata tctatctttt ttgccgttta tatttagggg tttttgttga      2760
     taaaatcaag tcttggttgt ggcttgctga attaaatatt tatgagtggt gcatttttaa      2820
     gtatagtgaa caagacacca tattaagtac agtgataaag catctatatt ctgtaaaaaa      2880
     aaaaaaaatc tgcctatgca tgttttttaa gaaaaaaaaa atggctgtat cggcctgtat      2940
     gggactgtaa tgcgcttagt ggtctgacat atactggaaa tgtatgtata ctggcgtact      3000
     ttatattctc taaaatgctt aatgcctttg aaattttgta atcaaaaaaa agctttgaaa      3060
     aaatctaaag gggagagtat tctttaaagt ttttaacata agcttgtcaa tgcacatgta      3120
     gatggttagc atgtttagca aaccttgtga aattataata agtttgtagt tacatgtgaa      3180
     actctaaatg catggcaact gttaatgtca taacagttta gttattttgt tctgttctgt      3240
     catgtgccac aaaatatgta cttttttcac ttttttccct ttgtatatca gttacgggtt      3300
     acaactggtt cattctgaaa acaacaacaa caaaagtcca ttcatatttt ttaacaattg      3360
     tataagtgcc caagtaattc actacagcct aaagccttgc ctttgtaatt tgacttctga      3420
     catgttggca atcaaagcat gcacttgtaa caatgaaaaa gaaaaagcat tttatattac      3480
     tactcaataa aatgtgcatg aacttacaga attctcatcc ttccactgag tccgctgaag      3540
     ggatttatgt gcacaaccac catgtgtctt ctaggtgctg gcccaccacc acacatcaca      3600
     ggctgatttc cacaggcttc ttcctagggg cctcgtgatc tgaggggtgg tgcctacttc      3660
     cactgtaaga aagaatcttg gtggatttgt gtctcaaatc agataagaga agcctgttta      3720
     aagagcagat gccatcttct ggcttcctca aggagccagt taaaaaacca gagcattcct      3780
     ttttattgaa aaataaaatt aatttgttat caggttgttt cagttgtatt ggatgcccta      3840
     tctatctgct aaagcaaaaa gtactaggct actaagtgca ttttcatcac agaaaagagt      3900
     tgcatttgta ttaacaagaa atttgtatac ccacgcttca gctactatct aatcatcacc      3960
     cgaagattta agatacacca aatttcagtt tgtttgtaac attgttcatc tttagtgcac      4020
     tttgttttat ataataaagt atgcctgtta tattaaataa taagaatatg gcaattagcg      4080
     atatagcata cccaaacaaa gatgttctcg atacagtctg gcaaagacta tcccaaggtt      4140
     attttaatga attcagacat tttttcctgt ggatatttct ccatcctaaa aaaagtggca      4200
     accaaggaaa atatttagat gcaacttact agagtgatga tgtgaaagaa atggtgattc      4260
     tggtatcatg gtgtttattt tctttcttat aactgcagag aaaatatcct gactaaaaaa      4320
     atttcatttt tttggattcc tttcttttac aaattgtgct gaggcaacta tggcatagaa      4380
     ataaacattt gacattaaaa taagtaaaaa aaaaaaaaaa aaaaa                      4425
//

If you have problems or comments...

PBIL Back to PBIL home page