(data stored in ACNUC21429 zone)

EMBL: AL442081

ID   AL442081; SV 1; linear; mRNA; STD; HUM; 2983 BP.
XX
AC   AL442081;
XX
DT   20-SEP-2000 (Rel. 65, Created)
DT   15-OCT-2008 (Rel. 97, Last updated, Version 2)
XX
DE   Homo sapiens mRNA; cDNA DKFZp761I1223 (from clone DKFZp761I1223)
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-2983
RA   Bloecker H., Boecher M., Brandt P., Mewes H.W., Weil B., Wiemann S.;
RT   ;
RL   Submitted (15-AUG-2000) to the INSDC.
RL   MIPS, Am Klopferspitz 18a, D-82152 Martinsried, GERMANY
XX
DR   MD5; 7c24227057795a7a5d61a250bc6c8fcd.
DR   Ensembl-Gn; ENSG00000188021; homo_sapiens.
DR   Ensembl-Tr; ENST00000338222; homo_sapiens.
XX
CC   Clone from S. Wiemann, Molecular Genome Analysis, German Cancer
CC   Research Center (DKFZ); Email s.wiemann@dkfz-heidelberg.de;
CC   sequenced by GBF (National Research Centre for Biotechnology
CC   Ltd., Braunschweig/Germany) within the cDNA sequencing
CC   consortium of the German Genome Project.
CC   This clone (DKFZp761I1223) is available at the RZPD in Berlin.
CC   Please contact the RZPD: Ressourcenzentrum, Heubnerweg 6,
CC   14059 Berlin-Charlottenburg, GERMANY; Email: clone@rzpd.de
CC   Further information about the clone and the sequencing project
CC   is available at http://www.mips.biochem.mpg.de/proj/cDNA/
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2983
FT                   /organism="Homo sapiens"
FT                   /mol_type="mRNA"
FT                   /dev_stage="adult"
FT                   /clone_lib="761 (synonym: hamy2). Vector pSport1; host
FT                   DH10B; sites NotI + SalI"
FT                   /clone="DKFZp761I1223"
FT                   /tissue_type="amygdala"
FT                   /db_xref="taxon:9606"
FT   CDS_pept        <1..1769
FT                   /codon_start=3
FT                   /gene="DKFZp761I1223"
FT                   /product="hypothetical protein"
FT                   /note="strong similarity to HRIHFB2157 (Homo sapiens)"
FT                   /db_xref="GOA:Q9UHD9"
FT                   /db_xref="H-InvDB:HIT000026442.16"
FT                   /db_xref="HGNC:HGNC:12509"
FT                   /db_xref="InterPro:IPR000626"
FT                   /db_xref="InterPro:IPR006636"
FT                   /db_xref="InterPro:IPR009060"
FT                   /db_xref="InterPro:IPR015496"
FT                   /db_xref="InterPro:IPR015940"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR028430"
FT                   /db_xref="InterPro:IPR029071"
FT                   /db_xref="InterPro:IPR041243"
FT                   /db_xref="PDB:1J8C"
FT                   /db_xref="PDB:2NBV"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9UHD9"
FT                   /protein_id="CAC09446.1"
FT                   /translation="VKTPKEKEEFAVPENSSVQQFKEAISKRFKSQTDQLVLIFAGKIL
FT                   KDQDTLIQHGIHDGLTVHLVIKSQNRPQGQSTQPSNAAGTNTTSASTPRSNSTPISTNS
FT                   NPFGLGSLGGLAGLSSLGLSSTNFSELQSQMQQQLMASPEMMIQIMENPFVQSMLSNPD
FT                   LMRQLIMANPQMQQLIQRNPEISHLLNNPDIMRQTLEIARNPAMMQEMMRNQDLALSNL
FT                   ESIPGGYNALRRMYTDIQEPMLNAAQEQFGGNPFASVGSSSSSGEGTQPSRTENRDPLP
FT                   NPWAPPPATQSSATTSTTTSTGSGSGNSSSNATGNTVAAANYVASIFSTPGMQSLLQQI
FT                   TENPQLIQNMLSAPYMRSMMQSLSQNPDLAAQMMLNSPLFTANPQLQEQMRPQLPAFLQ
FT                   QMQNPDTLSAMSNPRAMQALMQIQQGLQTLATEAPGLIPSFTPGVGVGVLGTAIGPVGP
FT                   VTPIGPIGPIVPFTPIGPIGPIGPTGPAAPPGSTGSGGPTGPTVSSAAPSETTSPTSES
FT                   GPNQQFIQQMVQALAGANAPQLPNPEVRFQQQLEQLNAMGFLNREANLQALIATGGDIN
FT                   AAIERLLGSQPS"
FT   regulatory      2947..2952
FT                   /regulatory_class="polyA_signal_sequence"
FT   polyA_site      2957
XX
SQ   Sequence 2983 BP; 847 A; 725 C; 617 G; 794 T; 0 other;
     cggtgaagac tcccaaagag aaagaggagt tcgcggtgcc cgagaacagc tcggttcagc        60
     agtttaagga agcgatttcg aaacgcttca aatcccaaac cgatcagcta gtgctgattt       120
     ttgccggaaa aatcttaaaa gatcaagata ccttgatcca gcatggcatc catgatgggc       180
     tgactgttca ccttgtcatc aaaagccaga accgacctca gggccagtcc acgcagccta       240
     gcaatgccgc gggaactaac actacctcgg cgtcgactcc caggagtaac tccacaccta       300
     tttccacaaa tagcaacccg tttgggttgg ggagcctggg aggacttgca ggccttagca       360
     gcctgggctt gagctcgacc aacttctctg agctccagag ccagatgcag cagcagctta       420
     tggccagccc tgagatgatg atccaaataa tggaaaatcc ctttgttcag agcatgcttt       480
     cgaatcccga tctgatgagg cagctcatta tggctaatcc acagatgcag caattgattc       540
     agagaaaccc agaaatcagt cacctgctca acaacccaga cataatgagg cagacactcg       600
     aaattgccag gaatccagcc atgatgcaag agatgatgag aaatcaagac ctggctctta       660
     gcaatctaga aagcatccca ggtggctata atgctttacg gcgcatgtac actgacattc       720
     aagagccgat gctgaatgcc gcacaagagc agtttggggg taatccattt gcctccgtgg       780
     ggagtagttc ctcctctggg gaaggtacgc agccttcccg cacagaaaat cgcgatccac       840
     tacccaatcc atgggcacca ccgccagcta cccagagttc tgcaactacc agcacgacca       900
     caagcactgg tagtgggtct ggcaatagtt ccagcaatgc tactgggaac accgttgctg       960
     ccgctaatta tgtcgccagc atctttagta ccccaggcat gcagagcctg ctgcaacaga      1020
     taactgaaaa cccccagctg attcagaata tgctgtcggc gccctacatg agaagcatga      1080
     tgcagtcgct gagccagaat ccagatttgg ctgcacagat gatgctgaat agcccgctgt      1140
     ttactgcaaa tcctcagctg caggagcaga tgcggccaca gctcccagcc ttcctgcagc      1200
     agatgcagaa tccagacaca ctatcagcca tgtcaaaccc aagagcaatg caggctttaa      1260
     tgcagatcca gcaggggcta cagacattag ccactgaagc acctggcctg attccgagct      1320
     tcactccagg tgtgggggtg ggggtgctgg gaaccgctat aggccctgta ggcccagtca      1380
     cccccatagg ccccataggc cctatagtcc cttttacccc cataggcccc attgggccca      1440
     taggacccac tggccctgca gccccccctg gctccaccgg ctctggtggc cccacggggc      1500
     ctactgtgtc cagcgctgca cctagtgaaa ccacgagtcc tacatcagaa tctggaccca      1560
     accagcagtt cattcagcaa atggtgcagg ccctggctgg agcaaatgct ccacagctgc      1620
     cgaatccaga agtcagattt cagcaacaac tggaacagct caacgcaatg gggttcttaa      1680
     accgtgaagc aaacttgcag gccctaatag caacaggagg cgacatcaat gcagccattg      1740
     aaaggctgct gggctcccag ccatcgtaat cacatttctg tacctggaaa aaaaatgtat      1800
     cttatttttg ataatggctc ttaaatcttt aaacacacac acaaaatcgt tctttacttt      1860
     cattttgatt cttttaaatc tgtctagttg taagtctaat atgatgcatt ttaagatgga      1920
     gtccctccct cctacttccc tcactccctt tctcctttgc ttatttttcc taccttccct      1980
     tcctcttgtc tccccactcc ctccctcttt gtttccttcc ttccttattt cctttagttt      2040
     ccttccttag ccgttttgag tggtgggaat caatgctgtt tcactcaaaa gtgttgcatg      2100
     caaacacttc tctttattct gcatttattg tgatttttgg aaacaggtat caaccttcac      2160
     agttgggtga acaagtgttg tcctacagat gtccaattta tttgcatttt taaacattag      2220
     cctatgatag taatttaatg tagaatgaag atattaaaaa cagaagcaaa ttatttgaag      2280
     ctctctaatt tgtggtacga tattgcttat tgtgactttg gcatgtattt ttgctagcaa      2340
     aatgctgtaa gatttatacc attgatcttt tttgctatat ttgtatacag tacagtaagc      2400
     acaattggca ctgtacatct aaaaatatta cagtagaatc tgagtgtaat atgtgtaacc      2460
     aaaatgagaa agaatacaag aaatgtttct ggagctagtt atgtctcaca attttgtaga      2520
     atcttacagc atctttgata aacttctcag tgaaaatgtt ggctaggcaa gttcagttaa      2580
     aatatagtag aaatgtttat cctggtatct ctaagtatac atttaattgt acagaaaatt      2640
     tacagtgtaa cattgtgtca acatttgcag attgactgta tatgacctta atctttgtgc      2700
     agcctgaagg atcagtgtag taatgccagg aaagtgcttt ttacctaaga cttccttctc      2760
     agcttctccc ataaagagac cctaatatgc attttgattt gtaattggaa atgtaacttt      2820
     cactgaaagt gtcatgtgat gtttgcatta cttttaactg ctatgtataa aggaaagtgt      2880
     gtcttttgac ttcatcagtt atttctcttg tgcacagaga aaaatgcatt aaaaatgact      2940
     aaaaaaaata aaaaattaaa aaatgaaaaa aaaaaaaaaa aaa                        2983
//

If you have problems or comments...

PBIL Back to PBIL home page