(data stored in ACNUC9435 zone)

EMBL: AL512756

ID   AL512756; SV 1; linear; mRNA; HTC; HUM; 2174 BP.
XX
AC   AL512756;
XX
DT   12-JAN-2001 (Rel. 66, Created)
DT   15-OCT-2008 (Rel. 97, Last updated, Version 3)
XX
DE   Homo sapiens mRNA; cDNA DKFZp667L246 (from clone DKFZp667L246)
XX
KW   HTC.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-2174
RG   The German cDNA Consortium
RA   Bloecker H., Boecher M., Brandt P., Mewes H.W., Weil B., Amid C.,
RA   Osanger A., Fobo G., Han M., Wiemann S.;
RT   ;
RL   Submitted (22-SEP-2004) to the INSDC.
RL   MIPS, Ingolstaedter Landstr.1, D-85764 Neuherberg, GERMANY
XX
DR   MD5; 324e1900377176b442a599125cbcc255.
XX
CC   Clone from S. Wiemann, Molecular Genome Analysis, German Cancer Research
CC   Center (DKFZ); Email s.wiemann@dkfz-heidelberg.de;
CC   sequenced by GBF (National Research Centre for Biotechnology Ltd.,
CC   Braunschweig/Germany) within the cDNA sequencing consortium of the German
CC   Genome Project.
CC   This clone (DKFZp667L246) is available at the RZPD Deutsches
CC   Ressourcenzentrum fuer Genomforschung GmbH in Berlin, Germany.
CC   Please contact RZPD for ordering:
CC   http://www.rzpd.de/cgi-bin/products/cl.cgi?CloneID=DKFZp667L246
CC   Further information about the clone and the sequencing project is
CC   available at http://mips.gsf.de/projects/cdna/
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2174
FT                   /organism="Homo sapiens"
FT                   /mol_type="mRNA"
FT                   /dev_stage="adult"
FT                   /clone_lib="667 (synonym: hlno2). Vector pSport1; host
FT                   DH10B; sites NotI + SalI"
FT                   /clone="DKFZp667L246"
FT                   /tissue_type="lymph node"
FT                   /note="hypothetical protein, N-terminus truncated"
FT                   /db_xref="taxon:9606"
FT   CDS_pept        <3..719
FT                   /codon_start=1
FT                   /gene="DKFZp667L246"
FT                   /product="hypothetical protein"
FT                   /db_xref="GOA:Q9H032"
FT                   /db_xref="H-InvDB:HIT000026531.14"
FT                   /db_xref="InterPro:IPR004182"
FT                   /db_xref="InterPro:IPR030564"
FT                   /db_xref="InterPro:IPR030567"
FT                   /db_xref="UniProtKB/TrEMBL:Q9H032"
FT                   /protein_id="CAC21675.1"
FT                   /translation="EGALFLTTYRILFRGTPHDQLVGEQTVVRSFPIASITKEKKITMQ
FT                   NQLQQNMQEGLQITSASFQLIKVAFDEEVSPEVVEIFKKQLMKFRYPQSIFSTFAFAAG
FT                   QTTPQIILPKQKEKNTSFRTFSKTIVKGAKRAGKMTIGRQYLLKKKTGTIVEERVNRPG
FT                   WNEDDDVSVSDESELPTSTTLKASEKSTMEQLVEKACFRDYQRLGLGTISGSSSRSRPE
FT                   YFRITASNRMYSLCRR"
XX
SQ   Sequence 2174 BP; 723 A; 377 C; 424 G; 650 T; 0 other;
     cagaaggagc cttgttcctc accacataca gaattctctt cagaggaaca ccccatgatc        60
     agttagtggg tgagcagaca gttgtgcgga gctttcccat tgcctccatc accaaggaga       120
     agaagattac aatgcagaac cagctacagc agaacatgca agaaggactg cagatcacat       180
     cagcatcttt tcagttgatt aaggtagcat ttgatgaaga agtcagtcca gaagtagtag       240
     agatctttaa gaaacagctg atgaagttcc gttatcctca gtccattttc agtacctttg       300
     cttttgctgc tggacaaact accccacaaa taattttacc aaaacagaag gaaaagaaca       360
     cttcttttcg taccttctca aaaacaattg tgaaaggtgc caaaagggca gggaaaatga       420
     caattgggcg gcaatattta ctgaagaaga agacagggac aattgtggaa gaaagagtaa       480
     atcgtcctgg atggaatgaa gatgatgatg tatctgtttc agatgagagt gagctcccca       540
     caagtaccac cctgaaggcc tccgagaagt ctacaatgga acagttggtg gaaaaagctt       600
     gtttcagaga ctatcagcgt ttaggtttag gaaccataag tggcagctct tcccgttcaa       660
     gacccgagta ttttagaatt actgcctcca acaggatgta ttcactctgc cggaggtaag       720
     tgtgtcagtg ggctccaaaa agaggtcttc tttcctttct tcttatttga atctttaata       780
     ggccatttgc atccatagcc ctgagataga taaaaatgcc tgaaaataag aacaaggtct       840
     ccaggatacg agcaagcatc tcattggcat tctcggaaca attaccttac tgaaagtacc       900
     tctagtaggt gagaaggtga aaggtaaagt actcaccccc tatgaatttc tcttgtcttt       960
     ctcttcccag tttgcttctt ttctagcatg actaaagata acttgaagaa caggattttc      1020
     ccagcccaat agaggacatg aaagtctttt gtaggctggg gagccacaaa ctctttctat      1080
     aaagggtcag ttggtaaata ttttcagttt atgagccata gagtctcttg ttgcagctat      1140
     tcaactgtgc cgcaaaagca gccacagaca gtaaggaaat gagtaggcat ggccagtttt      1200
     ggcccacagg ctataatttg ctgacccagg tgtaggcaag gctttcttat gcggtctaat      1260
     tggaatgttt tcaagggaat attacttaaa ggatgtaaat aaagaggcat tttctttttt      1320
     cagttcttgt catctctcac tgtttttcaa atatgttgag tcttattcca tgctttacta      1380
     tatgtaaata tatattttct aaaattacat tttcaccatc cacaagttta gtcattttca      1440
     tctccaggta agatttttct ttgcatttat aaattcctgc ttaaacagct ctgaaatcac      1500
     tttgtaaatt gtaagctttg tacatatttt agaaagttat cttaatgtta ctttcaaccc      1560
     tgttgctctt gaagatagat atgtcatttt aaatggcaat ttaagtttac aaatattaat      1620
     atgaaacttc agaaacaagt tgggaatata gttttgagat tgtggccaaa taaacatttt      1680
     gcatgaagtt ctgaaaaatt ggcactctga gtatgcagta atttttctgg aattctccgt      1740
     cattctaact aaattttctc tgaagatgag tcatgttgtc ggggtgtgat gtcctgctgt      1800
     ttggaaagtt tgctatcaaa attatgccag ccattgagaa aacagactca tttatcattc      1860
     caatctgtca gaagtaaaat aaaattttaa tagatgactt attagaacac tggttataaa      1920
     gcatttatga tggtaaaaag taatatatat ccattaagtt attagcagga aggaaatgga      1980
     ataataaaaa ataatccaaa agaaggcaag aaaggaaaaa aaaggggaca tagaacaaat      2040
     ggaataaata acaagtagta agatggtaga tttaaattca aatatatcca taattgcatt      2100
     aattattaat tgactaaatg ttccaattca aagaaagaga tcagggtttg ctttaaaaaa      2160
     aaaaaaaaaa aaaa                                                        2174
//

If you have problems or comments...

PBIL Back to PBIL home page