(data stored in ACNUC8465 zone)

EMBL: AL590842

ID   AL590842; SV 1; circular; genomic DNA; STD; PRO; 4653728 BP.
XX
AC   AL590842; AJ414141-AJ414160;
XX
PR   Project:PRJNA34;
XX
DT   17-JUL-2006 (Rel. 88, Created)
DT   06-FEB-2015 (Rel. 123, Last updated, Version 11)
XX
DE   Yersinia pestis CO92 complete genome
XX
KW   complete genome.
XX
OS   Yersinia pestis CO92
OC   Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales;
OC   Yersiniaceae; Yersinia.
XX
RN   [1]
RP   1-4653728
RX   DOI; 10.1038/35097083.
RX   PUBMED; 11586360.
RA   Parkhill J., Wren B.W., Thomson N.R., Titball R.W., Holden M.T.G.,
RA   Prentice M.B., Sebaihia M., James K.D., Churcher C., Mungall K.L.,
RA   Baker S., Basham D., Bentley S.D., Brooks K., Cerdeno-Tarraga A.M.,
RA   Chillingworth T., Cronin A., Davies R.M., Davis P., Dougan G., Feltwell T.,
RA   Hamlin N., Holroyd S., Jagels K., Leather S., Karlyshev A.V., Moule S.,
RA   Oyston P.C.F., Quail M., Rutherford K., Simmonds M., Skelton J.,
RA   Stevens K., Whitehead S., Barrell B.G.;
RT   "Genome sequence of Yersinia pestis, the causative agent of plague";
RL   Nature 413(6855):523-527(2001).
XX
RN   [2]
RP   1-4653728
RA   Parkhill J.;
RT   ;
RL   Submitted (04-OCT-2001) to the INSDC.
RL   Submitted on behalf of the Yersinia sequencing team, Sanger Centre,
RL   Wellcome Trust Genome Campus, Hinxton, Cambridge CB10 1SA E-mail:
RL   parkhill@sanger.ac.uk
XX
RN   [3]
RX   DOI; 10.1186/1471-2180-3-13.
RX   PUBMED; 12834539.
RA   Delihas N.;
RT   "Annotation and evolutionary relationships of a small regulatory RNA gene
RT   micF and its target ompF in Yersinia species";
RL   BMC Microbiol. 3:13-13(2003).
XX
DR   MD5; fe564075b430d251015e956abe015b27.
DR   BioSample; SAMEA1705942.
DR   EuropePMC; PMC1182639; 16051850.
DR   EuropePMC; PMC1794563; 17076878.
DR   EuropePMC; PMC2289816; 18307761.
DR   EuropePMC; PMC2530875; 18647395.
DR   EuropePMC; PMC2655450; 19114512.
DR   EuropePMC; PMC2694983; 19543392.
DR   EuropePMC; PMC2798625; 19880651.
DR   EuropePMC; PMC2806259; 20017936.
DR   EuropePMC; PMC2900309; 20628578.
DR   EuropePMC; PMC2935791; 19968874.
DR   EuropePMC; PMC2951374; 20949072.
DR   EuropePMC; PMC3017858; 20964857.
DR   EuropePMC; PMC3028722; 21131531.
DR   EuropePMC; PMC3116847; 21698192.
DR   EuropePMC; PMC3172189; 21931876.
DR   EuropePMC; PMC3469391; 22963272.
DR   EuropePMC; PMC3572037; 23418519.
DR   EuropePMC; PMC3573667; 23404402.
DR   EuropePMC; PMC3587954; 23469360.
DR   EuropePMC; PMC387811; 15090505.
DR   EuropePMC; PMC403674; 12952873.
DR   EuropePMC; PMC4354914; 25834736.
DR   EuropePMC; PMC4539999; 26301055.
DR   EuropePMC; PMC4875751; 27206730.
DR   EuropePMC; PMC515171; 15342600.
DR   EuropePMC; PMC518763; 15358858.
DR   EuropePMC; PMC5778671; 29357812.
DR   EuropePMC; PMC6034908; 29939993.
DR   EuropePMC; PMC6092852; 30107826.
DR   GOA; P0DM79.
DR   GOA; P59324.
DR   GOA; P61475.
DR   GOA; Q74PY8.
DR   GOA; Q74R94.
DR   GOA; Q8CKC6.
DR   GOA; Q8CZS4.
DR   GOA; Q8D079.
DR   GOA; Q8D1L4.
DR   GOA; Q9ZFR5.
DR   InterPro; IPR000053; Thymidine/pyrmidine_PPase.
DR   InterPro; IPR002669; UreD.
DR   InterPro; IPR002696; Membr_insert_effic_factor.
DR   InterPro; IPR003695; Ppx_GppA.
DR   InterPro; IPR005814; Aminotrans_3.
DR   InterPro; IPR006638; Elp3/MiaB/NifB.
DR   InterPro; IPR011720; Thr_lead_pept.
DR   InterPro; IPR012565; His_leader.
DR   InterPro; IPR012567; IlvGEDA_leader.
DR   InterPro; IPR013102; PYNP_C.
DR   InterPro; IPR013465; Thymidine_Pase.
DR   InterPro; IPR013704; UPF0313_N.
DR   InterPro; IPR017652; Ac/SucOrn_transaminase_bac.
DR   InterPro; IPR017872; Pyrmidine_PPase_CS.
DR   InterPro; IPR018090; Pyrmidine_PPas_bac/euk.
DR   InterPro; IPR020907; MgrB.
DR   InterPro; IPR022946; UPF0313.
DR   InterPro; IPR023709; Guo-5TP_3DP_PyrP.
DR   InterPro; IPR024560; UPF0313_C.
DR   InterPro; IPR036320; Glycosyl_Trfase_fam3_N_dom)sf.
DR   InterPro; IPR036566; PYNP-like_C_sf.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00013; 6S.
DR   RFAM; RF00018; CsrB.
DR   RFAM; RF00021; Spot_42.
DR   RFAM; RF00022; GcvB.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00033; MicF.
DR   RFAM; RF00034; RprA.
DR   RFAM; RF00040; rne5.
DR   RFAM; RF00050; FMN.
DR   RFAM; RF00057; RyhB.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00078; MicA.
DR   RFAM; RF00079; OmrA-B.
DR   RFAM; RF00081; ArcZ.
DR   RFAM; RF00082; SraG.
DR   RFAM; RF00083; GlmZ_SraJ.
DR   RFAM; RF00101; SraC_RyeA.
DR   RFAM; RF00110; RybB.
DR   RFAM; RF00111; RyeB.
DR   RFAM; RF00112; CyaR_RyeE.
DR   RFAM; RF00114; S15.
DR   RFAM; RF00127; t44.
DR   RFAM; RF00128; GlmY_tke1.
DR   RFAM; RF00140; Alpha_RBS.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00368; sroB.
DR   RFAM; RF00369; sroC.
DR   RFAM; RF00382; DnaX.
DR   RFAM; RF00383; IS1222_FSE.
DR   RFAM; RF00391; RtT.
DR   RFAM; RF00506; Thr_leader.
DR   RFAM; RF00512; Leu_leader.
DR   RFAM; RF00513; Trp_leader.
DR   RFAM; RF00514; His_leader.
DR   RFAM; RF00552; rncO.
DR   RFAM; RF00630; P26.
DR   RFAM; RF01055; MOCO_RNA_motif.
DR   RFAM; RF01068; mini-ykkC.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01317; CRISPR-DR4.
DR   RFAM; RF01393; isrJ.
DR   RFAM; RF01394; isrK.
DR   RFAM; RF01396; isrN.
DR   RFAM; RF01405; STnc490k.
DR   RFAM; RF01695; C4.
DR   RFAM; RF01707; JUMPstart.
DR   RFAM; RF01728; STAXI.
DR   RFAM; RF01734; crcB.
DR   RFAM; RF01748; nuoG.
DR   RFAM; RF01766; cspA.
DR   RFAM; RF01769; greA.
DR   RFAM; RF01770; rimP.
DR   RFAM; RF01796; frnS.
DR   RFAM; RF01830; StyR-44.
DR   RFAM; RF01852; tRNA-Sec.
DR   RFAM; RF01859; Phe_leader.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   RFAM; RF01989; SECIS_3.
DR   RFAM; RF02029; sraA.
DR   RFAM; RF02030; tp2.
DR   RFAM; RF02031; tpke11.
DR   RFAM; RF02074; STnc240.
DR   SILVA-LSU; AL590842.
DR   SILVA-SSU; AL590842.
DR   UniProtKB/Swiss-Prot; P0DM79; MGRB_YERPE.
DR   UniProtKB/Swiss-Prot; P59324; ARGD_YERPE.
DR   UniProtKB/Swiss-Prot; P61475; YIDD_YERPE.
DR   UniProtKB/Swiss-Prot; Q74PY8; TYPH_YERPE.
DR   UniProtKB/Swiss-Prot; Q74R94; GPPA_YERPE.
DR   UniProtKB/Swiss-Prot; Q8CKC6; LPT_YERPE.
DR   UniProtKB/Swiss-Prot; Q8CZS4; Y674_YERPE.
DR   UniProtKB/Swiss-Prot; Q8D079; LPHI_YERPE.
DR   UniProtKB/Swiss-Prot; Q8D1L4; LPID_YERPE.
DR   UniProtKB/Swiss-Prot; Q9ZFR5; URED_YERPE.
XX
CC   Notes:
CC   Details of Y. pestis sequencing at the Sanger Centre
CC   are available on the World Wide Web.
CC   (URL, http://www.sanger.ac.uk/Projects/Y_pestis/)
CC
CC   Original CON assembly
CC   join(AJ414141.1:1..288050,AJ414142.1:51..214050,AJ414143.1:51..201050,
CC   AJ414144.1:51..208050,AJ414145.1:51..208050,AJ414146.1:51..210050,
CC   AJ414147.1:51..199050,AJ414148.1:51..210050,AJ414149.1:51..193050,
CC   AJ414150.1:51..335050,AJ414151.1:51..334050,AJ414152.1:51..313050,
CC   AJ414153.1:51..258050,AJ414154.1:51..204050,AJ414155.1:51..205050,
CC   AJ414156.1:51..220050,AJ414157.1:51..216040,AJ414158.1:41..235050,
CC   AJ414159.1:51..199050,AJ414160.1:51..203728)
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..4653728
FT                   /organism="Yersinia pestis CO92"
FT                   /strain="CO92"
FT                   /mol_type="genomic DNA"
FT                   /note="biovar:Orientalis"
FT                   /db_xref="taxon:214092"
FT   CDS_pept        complement(271..711)
FT                   /transl_table=11
FT                   /locus_tag="YPO0001"
FT                   /product="putative flavoprotein"
FT                   /note="Similar to the FMN-binding domain of many
FT                   flavoproteins e.g. Salmonella typhimurium sulfite reductase
FT                   [NADPH] flavoprotein alpha-component CysJ SW:CYSJ_SALTY
FT                   (P38039) (598 aa) fasta scores: E(): 3.8e-06, 32.0% id in
FT                   128 aa. Also highly similar over entire range to
FT                   Escherichia coli MioC protein, the fuction of which in a
FT                   chromosomal context, is unknown SW:MIOC_ECOLI (P03817) (146
FT                   aa) fasta scores: E(): 0, 66.9% id in 145 aa"
FT                   /db_xref="GOA:A0A384KI32"
FT                   /db_xref="InterPro:IPR001094"
FT                   /db_xref="InterPro:IPR008254"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384KI32"
FT                   /protein_id="CAL18691.1"
FT                   /translation="MADITLISGSTLGSAEYVAEHLADKLEEAGFSTEILHGPELDELT
FT                   LNGLWLIVTSTHGAGDLPDNLQPLLEQIEQQKPDLSQVRFGAVGLGSSEYDTFCGAIIK
FT                   LDQQLIAQGAQRLGEILEIDVIQHEIPEDPAEIWVKDWINLL"
FT   CDS_pept        complement(804..1265)
FT                   /transl_table=11
FT                   /gene="asnC"
FT                   /locus_tag="YPO0002"
FT                   /product="regulatory protein"
FT                   /note="Similar to the Escherichia coli regulator of AnsA:
FT                   AsnC SW:ASNC_ECOLI (P03809) (152 aa) fasta scores: E():
FT                   0,84.8% id in 151 aa"
FT                   /db_xref="GOA:A0A384LEP9"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR019885"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384LEP9"
FT                   /protein_id="CAL18692.1"
FT                   /translation="MSEIYQIDNLDRSILKALMENARTPYAELAKNLAVSPGTIHVRVE
FT                   KMRQAGIITAACVHVNPKQLGYDVCCFIGIILKSAKDYPSALKKLESLEEVVEAYYTTG
FT                   HYSIFIKVMCKSIDALQQVLINKIQTIDEIQSTETLISLQNPIMRTIVP"
FT   misc_feature    complement(870..1175)
FT                   /note="Pfam match to entry PF01037 ASNC_trans_reg, AsnC
FT                   family, score 63.50, E-value 4.4e-15"
FT                   /inference="protein motif:PFAM:PF01037"
FT   misc_feature    complement(1113..1193)
FT                   /note="PS00519 Bacterial regulatory proteins, asnC family
FT                   signature."
FT                   /inference="protein motif:ProSite:PS00519"
FT   misc_feature    complement(1131..1196)
FT                   /note="Predicted helix-turn-helix motif with score 1363
FT                   (+3.83 SD) at aa 6-27, sequence TPYAELAKNLAVSPGTIHVRVE"
FT   CDS_pept        1435..2427
FT                   /transl_table=11
FT                   /gene="asnA"
FT                   /locus_tag="YPO0003"
FT                   /product="aspartate-ammonia ligase"
FT                   /EC_number="6.3.1.1"
FT                   /note="Similar to Escherichia coli aspartate-ammonia ligase
FT                   AsnA SW:ASNA_ECOLI (P00963) (330 aa) fasta scores: E():
FT                   0,78.5% id in 330 aa"
FT                   /db_xref="GOA:Q8ZJT3"
FT                   /db_xref="InterPro:IPR004618"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZJT3"
FT                   /protein_id="CAL18693.1"
FT                   /translation="MKKQFIQKQQQISFVKSFFSRQLEQQLGLIEVQAPILSRVGDGTQ
FT                   DNLSGSEKAVQVKVKSLPDSTFEVVHSLAKWKRKTLGRFDFGADQGVYTHMKALRPDED
FT                   RLSAIHSVYVDQWDWERVMGDGERNLAYLKSTVNKIYAAIKETEAAISAEFGVKPFLPD
FT                   HIQFIHSESLRARFPDLDAKGRERAIAKELGAVFLIGIGGKLADGQSHDVRAPDYDDWT
FT                   SPSAEGFSGLNGDIIVWNPILEDAFEISSMGIRVDAEALKRQLALTGDEDRLELEWHQS
FT                   LLRGEMPQTIGGGIGQSRLVMLLLQKQHIGQVQCGVWGPEISEKVDGLL"
FT   CDS_pept        complement(2526..3992)
FT                   /transl_table=11
FT                   /locus_tag="YPO0004"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Vibrio cholerae hypothetical protein
FT                   VCA0762 TR:Q9KLI2 (EMBL:AE004404) (481 aa) fasta scores:
FT                   E(): 0, 34.1% id in 496 aa"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR008912"
FT                   /db_xref="InterPro:IPR023481"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZJT2"
FT                   /inference="similar to sequence:INSDC:AE004404"
FT                   /protein_id="CAL18694.1"
FT                   /translation="MLSLATLDMLLSISEGELIEEMVVGLLAAPQLAIFFEKFPRIKRA
FT                   LMKDIPGWKQNLQQRIREASVPPGLANEFSLYQQSLLEDSPQFYAHLPDIVAQLQDLHS
FT                   PFATQAKTLVQTADLAKNPPGGDSLQTLFLQRWRVSLILQTITIHHQLLEQEREQLLAE
FT                   LQRRLALSGALEPILTTNDNAAGRLWDMSQGHLQRGDYQLLLQYGDFLQQQPELIRLAE
FT                   QLGRSRSAKAQPAPDARYEPYTVMVRQPDSVPEEVSGIHQSNDILRLLPTELVMLGMSE
FT                   LEFEFYRRLLERRLLTYRLQGDNWQEKTQQRPVSLKQNDEQPRGPFIVCVDTSGSMGGF
FT                   NEQCAKAFCLALLRIALADNRRCYIMLFATEIIHYELSADNGIEQAIRFLNQHFRGGTD
FT                   LAACLANTLNKMEDREWYDADAVIISDFIAQRLPEELVRKIKIQQQAHQHRFHAVAMSA
FT                   YGKPGIMRIFDHIWRFDTSLKSRLIRRWKR"
FT   CDS_pept        complement(3996..5549)
FT                   /transl_table=11
FT                   /locus_tag="YPO0005"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Escherichia coli hypothetical protein
FT                   YieN SW:YIEN_ECOLI (P31473) (498 aa) fasta scores: E():
FT                   0,67.8% id in 497 aa"
FT                   /db_xref="GOA:Q8ZJT1"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011704"
FT                   /db_xref="InterPro:IPR022547"
FT                   /db_xref="InterPro:IPR023671"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041538"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZJT1"
FT                   /protein_id="CAL18695.1"
FT                   /translation="MAQSSQLAERISRLSHALESGLYERQEAIRLCLLAALSGESVFLL
FT                   GPPGIAKSLIARRLKFAFRHARAFEYLMTRFSTPEEVFGPLSIQALKEEGRYQRMTGGY
FT                   LPEAEIVFLDEIWKAGPAILNTLLTAINERRFRNGDREDSIPMRLLVTASNELPDADSS
FT                   LEALYDRMLIRLWLDRVQEKQNFRSLLISRQNENHNPVAENLSITDEEFHQWQPLIDKI
FT                   TLPDHCFELIFQLRQRLSALEHAPYVSDRRWKKALRLLQASAFFSGRDEITPIDLILLK
FT                   DCLWHDLNSFKLLQQQLEQLLTEQGYQQQSLLMKLQDINSKWLQHQQQQSDHQALTVVK
FT                   QSGMFSRKAQYALPDNLTDSTLTLLLQKPLNLHDIQVNHLQVDKEALAQWLNKGGALRA
FT                   KLNGVGYAQSIDAEIDDQLHIIILDVSRQPSTLSLPGATTTSVPPELLLALTKLESTLA
FT                   EQRRLFSQHQPCLFTPSSWLAKIEASLLQVVEQLQFQQIQFQQIQFQQRKFQQQKHSGH
FT                   "
FT   CDS_pept        5823..7691
FT                   /transl_table=11
FT                   /gene="kup"
FT                   /gene_synonym="trkD"
FT                   /locus_tag="YPO0006"
FT                   /product="potassium transport protein"
FT                   /note="Similar to Escherichia coli low affinity potassium
FT                   uptake system protein Kup SW:KUP_ECOLI (P30016) (622 aa)
FT                   fasta scores: E(): 0, 84.2% id in 622 aa"
FT                   /db_xref="GOA:Q8ZJT0"
FT                   /db_xref="InterPro:IPR003855"
FT                   /db_xref="InterPro:IPR023051"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZJT0"
FT                   /inference="protein motif:TMHMM:2.0"
FT                   /protein_id="CAL18696.1"
FT                   /translation="MSTEHKQYLSAVTLAAIGVVYGDIGTSPLYTLRECFSGHYGFDVR
FT                   PDVVFGFLSLIFWMLILVVSVKYLTYVMRADNAGEGGILTLMSLAGRNTSSRATSILVV
FT                   LGLIGGSFFYGEVVITPAISVMSAIEGLEIAAPALDPYIVPCSIAVLTLLFVIQKHGTG
FT                   SVGKLFAPVMLVWFLTLALLGLRSIIANPEVLAALNPKWAISFFVEYKSVSFFALGAVV
FT                   LAITGVEALYADMGHFGKFPIRLAWFTVVLPSLVLNYFGQGALLLKNPEAIKNPFFLLA
FT                   PDWALIPLLILATLATVIASQAVISGVFSLTRQAVRLGYLPPMRIIHTSEMESGQIYIP
FT                   VINWTLYLAVVLVIIGFERSSNLAAAYGIAVTGTMVITSILFCTVAWKNWHWNRFLVVF
FT                   LLMVLLIIDIPMFSANVLKLFSGGWLPLSLGLVMFIIMTTWKSERFSLLRRMHEHSNSL
FT                   EAMIASLEKSPPVRVPGTAVYMSRAMNVIPFALLHNLKHNKVLHERVVLLTMRTDDVPY
FT                   VHNVERVTIEQLSPTFWRVVARYGWRETPNVAEIFHRCGLEGLSCQMMETSFFMSHESL
FT                   ILTKRPWHLFLRGKLFIALSRNALRAPDQFEIPPNRVIELGTQVEI"
FT   misc_feature    5841..5909
FT                   /gene="kup"
FT                   /gene_synonym="trkD"
FT                   /locus_tag="YPO0006"
FT                   /note="one of 12 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    5952..6020
FT                   /gene="kup"
FT                   /gene_synonym="trkD"
FT                   /locus_tag="YPO0006"
FT                   /note="one of 12 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    6126..6194
FT                   /gene="kup"
FT                   /gene_synonym="trkD"
FT                   /locus_tag="YPO0006"
FT                   /note="one of 12 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    6222..6290
FT                   /gene="kup"
FT                   /gene_synonym="trkD"
FT                   /locus_tag="YPO0006"
FT                   /note="one of 12 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    6324..6392
FT                   /gene="kup"
FT                   /gene_synonym="trkD"
FT                   /locus_tag="YPO0006"
FT                   /note="one of 12 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    6450..6518
FT                   /gene="kup"
FT                   /gene_synonym="trkD"
FT                   /locus_tag="YPO0006"
FT                   /note="one of 12 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    6555..6623
FT                   /gene="kup"
FT                   /gene_synonym="trkD"
FT                   /locus_tag="YPO0006"
FT                   /note="one of 12 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    6681..6749
FT                   /gene="kup"
FT                   /gene_synonym="trkD"
FT                   /locus_tag="YPO0006"
FT                   /note="one of 12 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    6825..6893
FT                   /gene="kup"
FT                   /gene_synonym="trkD"
FT                   /locus_tag="YPO0006"
FT                   /note="one of 12 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    6909..6977
FT                   /gene="kup"
FT                   /gene_synonym="trkD"
FT                   /locus_tag="YPO0006"
FT                   /note="one of 12 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    6996..7064
FT                   /gene="kup"
FT                   /gene_synonym="trkD"
FT                   /locus_tag="YPO0006"
FT                   /note="one of 12 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    7077..7145
FT                   /gene="kup"
FT                   /gene_synonym="trkD"
FT                   /locus_tag="YPO0006"
FT                   /note="one of 12 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        7896..8315
FT                   /transl_table=11
FT                   /locus_tag="YPO0007"
FT                   /product="ribose permease"
FT                   /note="Similar to Lactobacillus sake ribose permease RbsD
FT                   TR:Q9X4M4 (EMBL:AF115391) (131 aa) fasta scores: E():
FT                   5.7e-18, 39.6% id in 139 aa, and to Escherichia coli high
FT                   affinity ribose transport protein RbsD SW:RBSD_ECOLI
FT                   (P04982) (151 aa) fasta scores: E(): 0, 68.3% id in 139 aa.
FT                   Although lacks the first 12 amino acids of the E. coli
FT                   protein"
FT                   /db_xref="GOA:Q7CLE5"
FT                   /db_xref="InterPro:IPR007721"
FT                   /db_xref="InterPro:IPR023064"
FT                   /db_xref="InterPro:IPR023750"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7CLE5"
FT                   /inference="similar to sequence:INSDC:AF115391"
FT                   /protein_id="CAL18697.1"
FT                   /translation="MKKGVLLNADISAVISRLGHTDQIVIGDAGLPIPATTTRIDLALT
FT                   RGVPGFLQVVDVVTQEMQVENAYLAEEIVKNNPQLHEALLVLLTQLEQRQENQIALRYI
FT                   SHEAFKEQTKQSRAVIRSGECSPFANIILGSGVTF"
FT   CDS_pept        8366..9292
FT                   /transl_table=11
FT                   /gene="rbsK"
FT                   /locus_tag="YPO0008"
FT                   /product="ribokinase"
FT                   /EC_number="2.7.1.15"
FT                   /note="Similar to Escherichia coli ribokinase RbsK
FT                   SW:RBSK_ECOLI (P05054) (309 aa) fasta scores: E(): 0, 71.4%
FT                   id in 304 aa"
FT                   /db_xref="GOA:A0A384KYV1"
FT                   /db_xref="InterPro:IPR002139"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR011877"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384KYV1"
FT                   /protein_id="CAL18698.1"
FT                   /translation="METGKLVVLGSINADHILNIEQFPRPGETVIGQQYNVAFGGKGAN
FT                   QAVAAGRSGADIAFIACVGDDDIGERVRQQLTADKIDTQPIEAIKGATTGVALIFVNSD
FT                   GENVIGINAGANSAVTPEYLRRYQQQVIDADALLMQLESPLDTVIAAAKLAKQHQTQVI
FT                   LNPAPARKLPDELLTLVDMITPNETEAERLTGIHIEQDDDAAKAAQILHDKGIATVIIT
FT                   LGSRGVWLSEQGKGKLVAGFKVNAVDTIAAGDTFNGALLTALLEGQSMDVAVRFAHAAA
FT                   AIAVTRPGAQPSIPWRAEIDSFLQERV"
FT   misc_feature    8483..9142
FT                   /note="Pfam match to entry PF00294 pfkB, pfkB family
FT                   carbohydrate kinase, score 228.70, E-value 8.3e-65"
FT                   /inference="protein motif:PF00294"
FT   misc_feature    8483..8557
FT                   /note="PS00583 pfkB family of carbohydrate kinases
FT                   signature 1."
FT                   /inference="protein motif:ProSite:PS00583"
FT   misc_feature    9107..9148
FT                   /note="PS00584 pfkB family of carbohydrate kinases
FT                   signature 2."
FT                   /inference="protein motif:ProSite:PS00584"
FT   CDS_pept        complement(9512..10936)
FT                   /transl_table=11
FT                   /locus_tag="YPO0009"
FT                   /product="putative membrane transport protein"
FT                   /note="Similar to many proteins belonging to the major
FT                   facilitator family of drug resistance translocases e.g.
FT                   Neisseria gonorrhoeae efflux transporter membrane protein
FT                   AgrA TR:BAB13740 (EMBL:AB032563) (468 aa) fasta scores:
FT                   E(): 0, 45.4% id in 460 aa Also highly similar to
FT                   Escherichia coli hypothetical 51.5 kDa protein in rbsr-rrsc
FT                   intergenic region yieO SW:YIEO_ECOLI (P31474) (475 aa)
FT                   fasta scores: E(): 0, 74.2% id in 457 aa"
FT                   /db_xref="GOA:Q0WKT3"
FT                   /db_xref="InterPro:IPR001411"
FT                   /db_xref="InterPro:IPR004638"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q0WKT3"
FT                   /inference="similar to sequence:INSDC:AB032563"
FT                   /protein_id="CAL18699.1"
FT                   /translation="MIKSARSMAGLPWIAAMAFFMQALDATILNTALPSIAESLNRSPL
FT                   TMQSAIISYTLTVAMLIPVSGWLADRFGTRRIFILAVSLFTFGSLLCALSGSLAFLVAS
FT                   RVIQGIGGAMMMPVARLALIRAYPRSELLPVLNFVTIPGLVGPVMGPLLGGLLVTYTTW
FT                   HWIFILNIPIGLLGIFYARKYMPNFTMPKRTFDFVGFLLFGISLVMISTSLEIMGRPEI
FT                   ADYLPAATLLGGLLMLIFYIFHAKGHPNPLIGLPLFKTRTFSVGIAGNVASRLGTGCVP
FT                   FLMPLMLQVGFGYSALIAGCMMAPTAIGSIMAKSAVTQVLRSLGYRKVLVGITLIIGVL
FT                   IASFALQSPGMSAWMMILPLFILGIAMSTQFTAMNTITLADLTDNNASSGNSVLAVTQQ
FT                   LSISFGIAISATVLRFYDGLSLGGNVDHFHYTFITMGIVTLLSSLVFLLLKPRDGDNLI
FT                   QGRNVKKVAPQVKNNV"
FT   misc_feature    complement(9590..9655)
FT                   /note="one of 14 probable transmembrane helices predicted
FT                   forYPO0009 by TMHMM2.0"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    complement(9701..9766)
FT                   /note="one of 14 probable transmembrane helices predicted
FT                   forYPO0009 by TMHMM2.0"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    complement(9803..9868)
FT                   /note="one of 14 probable transmembrane helices predicted
FT                   forYPO0009 by TMHMM2.0"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    complement(9899..9964)
FT                   /note="one of 14 probable transmembrane helices predicted
FT                   forYPO0009 by TMHMM2.0"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    complement(10001..10066)
FT                   /note="one of 14 probable transmembrane helices predicted
FT                   forYPO0009 by TMHMM2.0"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    complement(10082..10147)
FT                   /note="one of 14 probable transmembrane helices predicted
FT                   forYPO0009 by TMHMM2.0"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    complement(10208..10258)
FT                   /note="one of 14 probable transmembrane helices predicted
FT                   forYPO0009 by TMHMM2.0"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    complement(10289..10354)
FT                   /note="one of 14 probable transmembrane helices predicted
FT                   forYPO0009 by TMHMM2.0"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    complement(10394..10450)
FT                   /note="one of 14 probable transmembrane helices predicted
FT                   forYPO0009 by TMHMM2.0"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    complement(10463..10528)
FT                   /note="one of 14 probable transmembrane helices predicted
FT                   forYPO0009 by TMHMM2.0"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    complement(10565..10618)
FT                   /note="one of 14 probable transmembrane helices predicted
FT                   forYPO0009 by TMHMM2.0"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    complement(10634..10699)
FT                   /note="one of 14 probable transmembrane helices predicted
FT                   forYPO0009 by TMHMM2.0"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    complement(10739..10804)
FT                   /note="one of 14 probable transmembrane helices predicted
FT                   forYPO0009 by TMHMM2.0"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    complement(10850..10915)
FT                   /note="one of 14 probable transmembrane helices predicted
FT                   forYPO0009 by TMHMM2.0"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        complement(11016..11705)
FT                   /transl_table=11
FT                   /locus_tag="YPO0010"
FT                   /product="putative GntR-famly transcriptional regulator"
FT                   /note="Similar to several including: Streptomyces
FT                   coelicolor putative GntR-famly transcriptional regulator
FT                   scf37.08 TR:Q9RJZ3 (EMBL:AL133210) (246 aa) fasta scores:
FT                   E(): 6.5e-18, 32.6% id in 215 aa and Escherichia coli
FT                   hypothetical protein YieP SW:YIEP_ECOLI (P31475) (181 aa)
FT                   fasta scores: E(): 0, 64.1% id in 181 aa"
FT                   /db_xref="GOA:A0A384L367"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384L367"
FT                   /inference="protein motif:TMHMM:2.0"
FT                   /inference="similar to sequence:INSDC:AL133210"
FT                   /protein_id="CAL18700.1"
FT                   /translation="MQLNTQQQAAQRNLSYLLAEKIGQRILAGEYEAGSILPGEIELGE
FT                   QFGVSRTAVREAVKMLAAKGMLLPRPRIGTRVMPQTNWNYLDQELLTWWMTKENFDQVM
FT                   QHFLILRTSLEPQACYLAATHANEKQRELLASLVAEMRALHSNFNREQWIQVDTQFHKL
FT                   IYEASGNPFLISFANLFSSVYYSYFRAITGDEVIKLQHHQNIVDTILAGDNQGALFACQ
FT                   VLLKTVD"
FT   misc_feature    complement(11475..11654)
FT                   /note="Pfam match to entry PF00392 gntR, Bacterial
FT                   regulatory proteins, gntR family, score 77.00, E-value
FT                   3.1e-22"
FT                   /inference="protein motif:PF00392"
FT   misc_feature    complement(11523..11597)
FT                   /note="PS00043 Bacterial regulatory proteins, gntR family
FT                   signature."
FT                   /inference="protein motif:ProSite:PS00043"
FT   misc_feature    complement(11529..11594)
FT                   /note="Predicted helix-turn-helix motif with score 1101
FT                   (+2.94 SD) at aa 38-59, sequence PGEIELGEQFGVSRTAVREAVK"
FT   rRNA            12292..13763
FT                   /gene="16S_rRNA"
FT                   /note="match to 16S_rRNA 1..1472 (EMBL:YPE16SA)"
FT   tRNA            13944..14019
FT                   /note="tRNA Glu anticodon TTC, Cove score 56.95"
FT   rRNA            14272..17178
FT                   /gene="23S_rRNA"
FT                   /note="match to 23S_rRNA 1..2906 ~96 % ID U77925 (Y.
FT                   enterocolitica 23S)"
FT   rRNA            17178..17411
FT                   /gene="5S_rRNA"
FT                   /note="match to 5SrRNA 1..234 blast score 1149 percent
FT                   identity 99 (incl. 23S-5S spacer)"
FT   repeat_region   17835..19149
FT                   /note="insertion sequence:IS285"
FT   repeat_region   17835..17863
FT                   /rpt_type=INVERTED
FT                   /note="IS285 inverted repeat"
FT   CDS_pept        17906..19114
FT                   /transl_table=11
FT                   /gene="y1062"
FT                   /gene_synonym="ypmt1.80C"
FT                   /locus_tag="YPO0011"
FT                   /product="transposase for the IS285 insertion element"
FT                   /note="Previously sequenced Yersinia pestis transposase
FT                   Y1062 or Ypmt1.80C TR:O68779 (EMBL:AF053947) (402 aa) fasta
FT                   scores: E(): 0, 100.0% id in 402 aa."
FT                   /db_xref="GOA:O68779"
FT                   /db_xref="InterPro:IPR001207"
FT                   /db_xref="UniProtKB/TrEMBL:O68779"
FT                   /inference="similar to sequence:INSDC:AF053947"
FT                   /protein_id="CAL18701.1"
FT                   /translation="MDEKKLKALAAELAKGLKTEADLNAFSRMLTKLTVETALNAELTE
FT                   HLGHEKNTPKSGSNTRNGYSSKTLLCDDGEIELNTPRDRENTFEPQLIKKNQTRITQMD
FT                   SQILSLYAKGMTTREIVATFKEMYDADVSPTLISKVTDAVKEQVAEWQNRQLDALYPIV
FT                   YMDCIVVKVRQNGSVINKAVFLALGINTEGQKELLGMWLAENEGAKFWLSVLTELKNRG
FT                   LQDILIACVDGLKGFPDAINSVYPQTHIQLCIIHMVRNSLKYVSWKDYKAVTSGLKMVY
FT                   QAPTEEAALMALDKFAEAWDDKYPQISKSWRTHWENLNTFFGYPPDIRKAIYTTNAIES
FT                   VNSVIRAAIKKRKVFPTDDSVRKVVYLAIKDASKKWSMPIQNWRLAMSRFIIEFGDRLS
FT                   DHL"
FT   misc_feature    17906..19042
FT                   /note="Pfam match to entry PF00872
FT                   Transpo_mutator,Transposase, Mutator family, score 430.40,
FT                   E-value 1.6e-125"
FT                   /inference="protein motif:PF00872"
FT   misc_feature    18599..18673
FT                   /note="PS01007 Transposases, Mutator family, signature."
FT                   /inference="protein motif:ProSite:PS01007"
FT   repeat_region   complement(19121..19149)
FT                   /rpt_type=INVERTED
FT                   /note="IS285 inverted repeat"
FT   CDS_pept        complement(19172..19702)
FT                   /transl_table=11
FT                   /gene="mobB"
FT                   /locus_tag="YPO0012"
FT                   /product="probable molybdopterin-guanine dinucleotide
FT                   biosynthesis protein B"
FT                   /note="Similar to Escherichia coli molybdopterin-guanine
FT                   dinucleotide biosynthesis protein B, MobB SW:MOBB_ECOLI
FT                   (P32125) (174 aa) fasta scores: E(): 0, 62.2% id in 164 aa"
FT                   /db_xref="GOA:A0A384K9K1"
FT                   /db_xref="InterPro:IPR004435"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384K9K1"
FT                   /protein_id="CAL18702.1"
FT                   /translation="MNYKSPPLLGIAAYSGTGKTTLLKSLIPLLQQRQVRVGLIKHTHH
FT                   NMEIDTPGKDSYELRKAGALQTLVASDCRWALMTETPEQQPLNLHYLASRLDASTIDLI
FT                   LVEGFKHEPINKIALYRESIGKPFSGLIDKHVIALASDKPIETTVKQLDINQPEQITEF
FT                   ICTWLENISFEVR"
FT   misc_feature    complement(19643..19666)
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:ProSite:PS00017"
FT   CDS_pept        complement(19702..20343)
FT                   /transl_table=11
FT                   /gene="chlB"
FT                   /gene_synonym="mob"
FT                   /gene_synonym="mobA"
FT                   /gene_synonym="nar"
FT                   /locus_tag="YPO0013"
FT                   /product="molybdopterin-guanine dinucleotide biosynthesis
FT                   protein A"
FT                   /note="Similar to Escherichia coli molybdopterin-guanine
FT                   dinucleotide biosynthesis protein A, MobA SW:MOBA_ECOLI
FT                   (P32173) (194 aa) fasta scores: E(): 3.1e-31, 43.8% id in
FT                   194 aa, and to Vibrio cholerae molybdopterin-guanine
FT                   dinucleotide biosynthesis protein A vc1526 TR:Q9KRV8
FT                   (EMBL:AE004231) (203 aa) fasta scores: E(): 6.2e-30, 46.6%
FT                   id in 204 aa"
FT                   /db_xref="GOA:Q8ZJS4"
FT                   /db_xref="InterPro:IPR013482"
FT                   /db_xref="InterPro:IPR025877"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZJS4"
FT                   /inference="similar to sequence:INSDC:AE004231"
FT                   /protein_id="CAL18703.1"
FT                   /translation="MLFTDTIPVSIGCSGAIEMQPNITGVILAGGRSSRMGGNDKGLIP
FT                   LNGKPLFQYVIDRFKPQVSDLVINANRNQGLYKESGIPVIDDIITGFVGPLAGMHAGLS
FT                   YASTEWVVFAPCDVPALPSDLVSQLWQGKKQALAAYANDDERAHPTFALMHISLKTQLA
FT                   DYLIRGDRKLMLFLDSINAQRVKFSGKADLFSNLNTPADCDLWEQKRRGQ"
FT   CDS_pept        20443..20712
FT                   /transl_table=11
FT                   /locus_tag="YPO0013a"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Pectobacterium carotovorum subsp.
FT                   cartovorum hypothetical protein YihD TR:Q9RB12
FT                   (EMBL:AF146615) (89 aa) fasta scores: E(): 6.2e-31, 83.1%
FT                   id in 89 aa and to Escherichia coli hypothetical protein
FT                   YihD SW:YIHD_ECOLI (P32126) (89 aa) fasta scores: E():
FT                   1.7e-28, 76.4% id in 89 aa"
FT                   /db_xref="InterPro:IPR009383"
FT                   /db_xref="InterPro:IPR038134"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384K9U0"
FT                   /inference="similar to sequence:INSDC:AF146615"
FT                   /protein_id="CAL18704.1"
FT                   /translation="MKCHRVNELIELLHPAWQQEPDLNLVQFLQKLAAEAGFKGDFSDL
FT                   TDDVLIYHLKMRGAASTEVIPGLKKDYEEDFKTALLRARGIIKD"
FT   CDS_pept        20792..21778
FT                   /transl_table=11
FT                   /locus_tag="YPO0014"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Pectobacterium carotovorum subsp.
FT                   cartovorum hypothetical protein YihE TR:Q9RB11
FT                   (EMBL:AF146615) (328 aa) fasta scores: E(): 0, 74.1% id in
FT                   328 aa and to Escherichia coli hypothetical YihE
FT                   SW:YIHE_ECOLI (P32127) (328 aa) fasta scores: E(): 0, 66.2%
FT                   id in 328 aa"
FT                   /db_xref="GOA:A0A384LLQ4"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR032882"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384LLQ4"
FT                   /inference="similar to sequence:INSDC:AF146615"
FT                   /protein_id="CAL18705.1"
FT                   /translation="MNNSAFNFQTLSPDLIMDALEGAGLRVDSGLTALNSYENRVYQFM
FT                   DEESKRYVVKFYRPERWSSEQITEEHQFSLDLAESEIPVIAPLRLNGKTLHTHCGFFFA
FT                   VFPSVGGRQYEIDNLDQLEWVGRFLGRIHQAARNSLFVARPTMGIEEYLTEPRQLLANC
FT                   DLVPVKQRDKFLAAADLLITTIKQYWHTEWQPLRLHGDCHPGNILWRDGPMFVDLDDAR
FT                   NGPAIQDLWMLLHGDRRDQSMQLDILLEAYSEFADFDQRELALIEPLRAMRMVYYLAWV
FT                   ARRWQDPAFPKSFPWMAESDFWLQQTASFTEQVKLLQEPPLQLMPMY"
FT   CDS_pept        21806..22429
FT                   /transl_table=11
FT                   /gene="dsbA"
FT                   /locus_tag="YPO0015"
FT                   /product="secreted thiol:disulfide interchange protein
FT                   DsbA"
FT                   /note="Previously sequenced Yersinia pestis thiol:disulfide
FT                   interchange protein DsbA SW:DSBA_YERPE (Q9XBV2) (207 aa)
FT                   fasta scores: E(): 0, 100.0% id in 207 aa. Also highly
FT                   similar to Erwinia carotovora thiol:disulfide interchange
FT                   protein DsbA precursor SW:DSBA_ERWCA (Q9RB10) (207 aa)
FT                   fasta scores: E(): 0, 81.6% id in 207 aa"
FT                   /db_xref="GOA:Q9XBV2"
FT                   /db_xref="InterPro:IPR001853"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR023205"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9XBV2"
FT                   /protein_id="CAL18706.1"
FT                   /translation="MKNVWLALVGIVMAFSVTAAQFTDGKQYLTLDKPVTGEPQVLEFF
FT                   SFYCPHCYQFEEVYQVPKAVKKALPEGTKMTRYHVEFLGPLGKQLTQAWAVAMALGVEE
FT                   KITPLMFEGVQKTQTVQTPGDIRNVFIKAGISGEDYDAALNSFVVKSLVAQQQKAAEDL
FT                   QLRGVPAMFVNGKYMIKNDGMDTSSMDNYVKQYADVVTFLLTQK"
FT   misc_feature    21806..22426
FT                   /note="Pfam match to entry PF01323 DSBA, DSBA
FT                   oxidoreductase, score 469.50, E-value 2.7e-137"
FT                   /inference="protein motif:PF01323"
FT   misc_feature    21818..21871
FT                   /note="1 probable transmembrane helix predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    21926..21982
FT                   /note="PS00194 Thioredoxin family active site."
FT                   /inference="protein motif:ProSite:PS00194"
FT   CDS_pept        22921..25719
FT                   /transl_table=11
FT                   /gene="polA"
FT                   /gene_synonym="resA"
FT                   /locus_tag="YPO0017"
FT                   /product="DNA polymerase I"
FT                   /EC_number="2.7.7.7"
FT                   /note="Highly similar to Escherichia coli DNA polymerase I
FT                   SW:DPO1_ECOLI (P00582) (928 aa) fasta scores: E(): 0, 77.7%
FT                   id in 933 aa"
FT                   /db_xref="GOA:Q7CG26"
FT                   /db_xref="InterPro:IPR001098"
FT                   /db_xref="InterPro:IPR002298"
FT                   /db_xref="InterPro:IPR002421"
FT                   /db_xref="InterPro:IPR002562"
FT                   /db_xref="InterPro:IPR008918"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR018320"
FT                   /db_xref="InterPro:IPR019760"
FT                   /db_xref="InterPro:IPR020045"
FT                   /db_xref="InterPro:IPR020046"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="InterPro:IPR036279"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:Q7CG26"
FT                   /protein_id="CAL18707.1"
FT                   /translation="MAQIAENPLLLVDGSSYLYRAYHAFPPLTNGSGEPTGAMYGVLNM
FT                   LRSLLLQYRPSHVAVVFDAKGKTFRDELFAEYKSHRPPMPDDLRVQIEPLHQMVKAMGL
FT                   PLLVVSGVEADDVIGTLAREAEKAGHSVLISTGDKDMAQLVTPNITLINTMNNTILGPQ
FT                   DVCDKYGVPPELIIDFLALMGDSSDNIPGVPGVGEKTAQALLQGLGGLDTLFSNLDKIS
FT                   TLTFRGAKTMSAKLEQNKDVAYLSYKLATIKTDVELDVTCDELTVSPPDDKQLHQLFSR
FT                   YEFKRWLADVEAGKWLDSKKDRPTGQTSSQSFVAADTAPTAEVTAVLSQENYQTILDEK
FT                   ALADWIERLKAAEVFAFDTETDGLDTLSCNLIGMSFAVAPGEAAYLPLAHDYLDAPPQL
FT                   DRDWVLATLKPLLEDDKALKVGQNLKFDKSMLARYGIDLKGIAFDTMLESYVLDSVAGR
FT                   HDMDSLAERYLNHKTITFEEIAGKGKNQLTFNQIALEQAGPYAAEDADVTLQLHLVLWP
FT                   KLQQSEGLKRVFQEIEMPLLPILSRIERTGVLIDQNILAAHSKELTIRLDELEKQAHEL
FT                   AEEPFNLASPKQLQAILYEKQKLPILKKTPGGAASTNEEVLAELALDYPLPKVILEYRG
FT                   LAKLKSTYTDKLPLMINPVSGRVHTSYHQAVTATGRLSSRDPNLQNIPVRNEEGRRIRQ
FT                   AFIAPKGYCIMAADYSQIELRIMAHLSQDNGLLAAFAAGQDIHRATAAEVFGSPLEKVT
FT                   TEQRRSAKAINFGLIYGMSAFGLARQLGIPRGEAQRYMDLYFERYPGVLEYMERTRKQA
FT                   AEQGYVTTLDGRRLYLPDIHSRNANRRKAAEREAINAPMQGTAADIIKRAMIAVDGWLQ
FT                   QEPEPLVRVIMQVHDELVFEVHESVLQSAEQKIRELMEQSMQLAVPLKVDVGVGANWDQ
FT                   AH"
FT   misc_feature    22939..23793
FT                   /note="Pfam match to entry PF01367 5_3_exonuclease, 5'-3'
FT                   exonuclease, score 539.20, E-value 2.9e-158"
FT                   /inference="protein motif:PF01367"
FT   misc_feature    23971..24483
FT                   /note="Pfam match to entry PF01612 3_5_exonuclease, 3'-5'
FT                   exonuclease, score 181.90, E-value 1e-50"
FT                   /inference="protein motif:PF01612"
FT   misc_feature    24985..25608
FT                   /note="Pfam match to entry PF00476 DNA_pol_A, DNA
FT                   polymerase family A, score 387.80, E-value 1.1e-112"
FT                   /inference="protein motif:PF00476"
FT   misc_feature    25189..25248
FT                   /note="PS00447 DNA polymerase family A signature."
FT                   /inference="protein motif:ProSite:PS00447"
FT   misc_RNA        25879..25982
FT                   /gene="spf"
FT                   /note="RNA feature: spf Spot 42 RNA. Due to transposon
FT                   insertion this feature is a single base shorter than the E.
FT                   coli spf gene."
FT   repeat_region   25983..26694
FT                   /note="Contains a 'G' at nucleotide position 315"
FT                   /note="IS200-like insertion sequence:IS1541"
FT   CDS_pept        26128..26586
FT                   /transl_table=11
FT                   /gene="tnp"
FT                   /locus_tag="YPO0018"
FT                   /product="transposase for the IS1541 insertion element"
FT                   /note="Similar to Salmonella typhimurium, and Salmonella
FT                   typhi transposase for insertion sequence IS200 TnpA
FT                   SW:T200_SALTY (Q57334) (152 aa) fasta scores: E(): 0, 94.1%
FT                   id in 152 aa. Also identical to the Yersinia
FT                   pseudotuberculosis IS1541 element transposase Tnp TR:Q9X9F5
FT                   (EMBL:AJ238014) (152 aa) fasta scores: E(): 0, 100.0% id in
FT                   152 aa"
FT                   /db_xref="GOA:Q74YM6"
FT                   /db_xref="InterPro:IPR002686"
FT                   /db_xref="InterPro:IPR036515"
FT                   /db_xref="UniProtKB/TrEMBL:Q74YM6"
FT                   /inference="similar to sequence:INSDC:AJ238014"
FT                   /protein_id="CAL18708.1"
FT                   /translation="MRDEKSLAHTRWNCKYHIVFAPKYRRQVFYREKRRAIGSILRKLC
FT                   EWKNVNILEAECCVDHIHMLLEIPPKMSVSGFMGYLKGKSSLMLYEQFGDLKFKYRNRE
FT                   FWCRGYYVDTVGKNTARIQEYIKHQLEEDKMGEQLSIPYPGSPFTGRK"
FT   misc_feature    26182..26493
FT                   /note="Pfam match to entry PF01797
FT                   Transposase_17,Transposase IS200 like, score 236.10,
FT                   E-value 5.1e-67"
FT                   /inference="protein motif:PF01797"
FT   CDS_pept        complement(26838..27488)
FT                   /transl_table=11
FT                   /locus_tag="YPO0019"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Escherichia coli hypothetical GTP-binding
FT                   protein YihA SW:YIHA_ECOLI (P24253) (210 aa) fasta scores:
FT                   E(): 0, 81.1% id in 212 aa"
FT                   /db_xref="GOA:Q8ZJS0"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR019987"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030393"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZJS0"
FT                   /protein_id="CAL18709.1"
FT                   /translation="MTIRNYNYHMTHFVISAPDIRHLPRDEGIEVAFAGRSNAGKSSAL
FT                   NTLTNQKGLARTSKTPGRTQLINLFEVVDGVRLVDLPGYGYAEVPEEMKLKWQRALGEY
FT                   LQKRNCLKGLVVLMDIRHPLKDLDQQMITWAVAVGTPVLLLLTKADKLASGARKAQLNL
FT                   VREAIIPFMGDIQVEAFSSLKKIGVDKLREKLDTWFSEIPPEVMAEEFDGEGE"
FT   misc_feature    complement(27363..27386)
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:ProSite:PS00017"
FT   CDS_pept        28233..28799
FT                   /transl_table=11
FT                   /locus_tag="YPO0020"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Salmonella typhimurium hypothetical
FT                   protein YihI SW:YIHI_SALTY (P37130) (171 aa) fasta scores:
FT                   E(): 3.7e-26, 51.9% id in 183 aa"
FT                   /db_xref="GOA:Q8ZJR9"
FT                   /db_xref="InterPro:IPR007336"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZJR9"
FT                   /protein_id="CAL18710.1"
FT                   /translation="MKQPNKAPRANIAAPKGTATPKRRRKTRDELDAEARDRKRQKKHS
FT                   GNRSGARTNVEGSNKKGHSQTQEKDPRVGSKVPVPLVIESQVKAKSMPKPVEKNVVKPR
FT                   LTPEEELAKLENDERLDALLDRLDNDEVLNKEDQAYVDLTLDRIDALMEQLGIELGDDE
FT                   DDVEREEKQEDILQLLKRGNPKDTF"
FT   CDS_pept        28982..30355
FT                   /transl_table=11
FT                   /gene="hemN"
FT                   /locus_tag="YPO0021"
FT                   /product="oxygen-independent coproporphyrinogen III
FT                   oxidase"
FT                   /note="Highly similar to Escherichia coli
FT                   oxygen-independent coproporphyrinogen III oxidase HemN
FT                   SW:HEMN_ECOLI (P32131) (457 aa) fasta scores: E(): 0, 78.6%
FT                   id in 457 aa"
FT                   /db_xref="GOA:A0A384LH38"
FT                   /db_xref="InterPro:IPR004558"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR010723"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR034505"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384LH38"
FT                   /protein_id="CAL18711.1"
FT                   /translation="MSEHAIVWDLSLIQKYNYSGPRYTSYPTALEFSEDYNESAFQQAV
FT                   KRYPQRPLSLYVHIPFCHKLCYFCGCNKLVTRQQHKADEYLVVLEKEIRQRAALFTGRQ
FT                   VSQMHWGGGTPTYLNKTQISHLMTVLREHFDFLPDAEQSIEVDPREIELDVLDHLRAEG
FT                   FNRLSMGVQDFNKEVQRLVNREQDEDFIFALIARAKALGFNSTNIDLIYGLPKQTPESF
FT                   AFTLKRVAELNPDRLSVFNYAHLPSLFAAQRKIKDADLPTAEQRLDILQHTIRFLTESG
FT                   YQFIGMDHFARPDDELAIAQQEGTLHRNFQGYTTQGESDLLGLGVSAISMLGDSYAQNE
FT                   KDLETYYACVEQRGNALWRGLTMTEDDCLRRDVIKTLICHFQLSYQPIEQRYGIRFADY
FT                   FAEDFELLAPFEQDGLVERNETGLRVTPRGRLLIRNICMCFDIYLRKQARKQQFSRVI"
FT   misc_feature    29276..30037
FT                   /note="Pfam match to entry PF02473 Coprogen_an_ox, , score
FT                   551.60, E-value 5.2e-162"
FT                   /inference="protein motif:PF02473"
FT   CDS_pept        complement(30409..31821)
FT                   /transl_table=11
FT                   /gene="glnG"
FT                   /gene_synonym="glnT"
FT                   /gene_synonym="ntrC"
FT                   /locus_tag="YPO0022"
FT                   /product="nitrogen regulation protein"
FT                   /note="Highly similar to Escherichia coli nitrogen
FT                   regulation protein NtrC SW:NTRC_ECOLI (P06713) (469 aa)
FT                   fasta scores: E(): 0, 90.2% id in 470 aa"
FT                   /db_xref="GOA:A0A384KHI4"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR010114"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384KHI4"
FT                   /protein_id="CAL18712.1"
FT                   /translation="MQRGIVWIVDDDSSIRWVLERALTGAGLNCVAFDSGNQVLDALAT
FT                   RTPDVLLSDIRMPGMDGLALLKQIKQRHPMLPVIIMTAHSDLDAAVSAYQQGAFDYLPK
FT                   PFDIDEAVALVERAISHYQEQQQPARSQPVSGPTADIIGEAPAMQDVFRIIGRLSRSSI
FT                   SVLINGESGTGKELVAHALHRHSPRAKALFIALNMAAIPKDLIESELFGHEKGAFTGAN
FT                   QVRQGRFEQADTGTLFLDEIGDMPLDVQTRLLRVLADGQFYRVGGYAPVKVDVRIIAAT
FT                   HQNLELRVQEGKFREDLFHRLNVIRVHLPPLRERSEDIPRLARYFLHVAAKELGVESKN
FT                   LHPETEAALTRLPWPGNVRQLENTCRWLTVMAAGQEVLVQDLPSELFETHMPDASGQRA
FT                   PDSWSTLLAQWADRALRSGHQDLLSEAQPEMERTLLTTALRHTQGHKQEAARLLGWGRN
FT                   TLTRKLKELGME"
FT   misc_feature    complement(30427..30492)
FT                   /note="Predicted helix-turn-helix motif with score 1763
FT                   (+5.19 SD) at aa 444-465, sequence GHKQEAARLLGWGRNTLTRKLK"
FT   misc_feature    complement(30706..31401)
FT                   /note="Pfam match to entry PF00158 sigma54, Sigma-54
FT                   transcription factors, score 491.30, E-value 7.6e-144"
FT                   /inference="protein motif:PF00158"
FT   misc_feature    complement(30733..30762)
FT                   /note="PS00688 Sigma-54 interaction domain C-terminal part
FT                   signature."
FT                   /inference="protein motif:ProSite:PS00688"
FT   misc_feature    complement(31288..31329)
FT                   /note="PS00675 Sigma-54 interaction domain ATP-binding
FT                   region A signature."
FT                   /inference="protein motif:ProSite:PS00675"
FT   misc_feature    complement(31477..31812)
FT                   /note="Pfam match to entry PF00072 response_reg, Response
FT                   regulator receiver domain, score 148.80, E-value 9.3e-41"
FT                   /inference="protein motif:PF00072"
FT   CDS_pept        complement(31829..32878)
FT                   /transl_table=11
FT                   /gene="glnR"
FT                   /gene_synonym="glnl"
FT                   /gene_synonym="ntrB"
FT                   /locus_tag="YPO0023"
FT                   /product="Two component regulatory protein involved in
FT                   nitrogen assimilation"
FT                   /EC_number="2.7.3.-"
FT                   /note="Similar to Escherichia coli nitrogen regulation
FT                   protein NtrB SW:NTRB_ECOLI (P06712) (349 aa) fasta scores:
FT                   E(): 0, 86.5% id in 349 aa"
FT                   /db_xref="GOA:A0A384LH46"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384LH46"
FT                   /protein_id="CAL18713.1"
FT                   /translation="MATGTLPDAGQILNTLINSILLLDDDLAIHYANPAAQQLLAQSSR
FT                   KLFGTPLPDLLGYFSLNIVLMRESLQAGQGFTDNEVTLVVDGRAHILSLTAQSLAEGFI
FT                   LLELAPMDNQRRLSQEQLQHAQQVAARDLVRGLAHEIKNPLGGLRGAAQLLAKALPDPA
FT                   LLEYTQVIIEQADRLRNLVDRLLGPQRPGQHITQSIHQVAERVCQLVSLEKPDNVTLIR
FT                   DYDPSLPELAHDPDQIEQVLLNITRNALQALGETGGTITLRTRTAFQVTLHGMRYRLAA
FT                   RIDIEDDGPGVPTQLQDTVFYPMVSGREGGTGLGLSIARNLIDQHSGKIEFNSWPGHTE
FT                   FSVYLPIRQ"
FT   misc_feature    complement(31841..32464)
FT                   /note="Pfam match to entry PF00512 signal, Histidine
FT                   kinase, score 236.30, E-value 4.3e-67"
FT                   /inference="protein motif:PF00512"
FT   CDS_pept        complement(33131..34540)
FT                   /transl_table=11
FT                   /gene="glnA"
FT                   /locus_tag="YPO0024"
FT                   /product="glutamine synthetase"
FT                   /EC_number="6.3.1.2"
FT                   /note="Highly similar to Escherichia coli glutamine
FT                   synthetase GlnA SW:GLNA_ECOLI (P06711) (468 aa) fasta
FT                   scores: E(): 0, 91.5% id in 468 aa"
FT                   /db_xref="GOA:A0A384KGD1"
FT                   /db_xref="InterPro:IPR001637"
FT                   /db_xref="InterPro:IPR004809"
FT                   /db_xref="InterPro:IPR008146"
FT                   /db_xref="InterPro:IPR008147"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR027302"
FT                   /db_xref="InterPro:IPR027303"
FT                   /db_xref="InterPro:IPR036651"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384KGD1"
FT                   /protein_id="CAL18714.1"
FT                   /translation="MSAEHVLTMLNEHEVKFVDLRFTDTKGKEQHITIPAHQVNADFFE
FT                   EGKMFDGSSIGGWKGINESDMVLMPDASTAVMDPFFADSTLIIRCDILEPGTMQGYDRD
FT                   PRSISKRAEDFLKSSGIADTVLFGPEPEFFLFDDIRFGSSINGSHVSIDDVEGAWNSST
FT                   KYEGGNKGHRPAVKGGYFPVPPVDSAQDLRSAMCLTMEEMGLVVEAHHHEVATAGQNEV
FT                   ATRFNTMTKKADEIQIYKYVVHNVAHAFGKTATFMPKPMFGDNGSGMHCHMSLSKNGNN
FT                   LFAGDKYGGLSEIALFYIGGIIKHAKAINALANPTTNSYKRLVPGYEAPVMLAYSARNR
FT                   SASIRIPVVASPKARRIEARFPDPAANPYLCFAALLMAGLDGIINKIHPGDAMDKNLYD
FT                   LPPEEEAEIPKVAGSLDEAMAALNEDREFLTRGGVFTDDAIDAYIELRREEMDRVRMTP
FT                   HPVEFELYYSV"
FT   misc_feature    complement(33347..33385)
FT                   /note="PS00182 Glutamine synthetase class-I adenylation
FT                   site."
FT                   /inference="protein motif:ProSite:PS00182"
FT   misc_feature    complement(33425..34495)
FT                   /note="Pfam match to entry PF00120 gln-synt, Glutamine
FT                   synthetase, score 829.70, E-value 1.1e-263"
FT                   /inference="protein motif:PF00120"
FT   misc_feature    complement(33719..33766)
FT                   /note="PS00181 Glutamine synthetase putative ATP-binding
FT                   region signature."
FT                   /inference="protein motif:ProSite:PS00181"
FT   misc_feature    complement(34337..34393)
FT                   /note="PS00180 Glutamine synthetase signature 1."
FT                   /inference="protein motif:ProSite:PS00180"
FT   CDS_pept        complement(34726..34884)
FT                   /transl_table=11
FT                   /locus_tag="YPO0025"
FT                   /product="possible membrane protein"
FT                   /note="Doubtful CDS, No significant database hits"
FT                   /db_xref="GOA:Q74YC2"
FT                   /db_xref="UniProtKB/TrEMBL:Q74YC2"
FT                   /protein_id="CAL18715.1"
FT                   /translation="MHTDYQQTPMIWHKWGVWKVGIDFATYFIMNSFITNRFSMDRSLE
FT                   SLAWILR"
FT   misc_feature    complement(34783..34839)
FT                   /note="1 probable transmembrane helix predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        35102..36925
FT                   /transl_table=11
FT                   /gene="bipA"
FT                   /gene_synonym="typA"
FT                   /locus_tag="YPO0026"
FT                   /product="putative GTPase"
FT                   /note="Similar to Salmonella typhimurium GTPase BipA
FT                   TR:CAC14270 (EMBL:AJ276889) (607 aa) fasta scores: E():
FT                   0,89.1% id in 606 aa and to Escherichia coli GTP-binding
FT                   protein BipA which has shown to be important for virulence
FT                   of EPEC strains. SW:TYPA_ECOLI (P32132) (591 aa) fasta
FT                   scores: E(): 0, 89.3% id in 591 aa"
FT                   /db_xref="GOA:Q0WKR6"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006298"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035651"
FT                   /db_xref="InterPro:IPR042116"
FT                   /db_xref="UniProtKB/TrEMBL:Q0WKR6"
FT                   /inference="similar to sequence:INSDC:AJ276889"
FT                   /protein_id="CAL18716.1"
FT                   /translation="MIENLRNIAIIAHVDHGKTTLVDKLLQQSGTFGERTEATERVMDS
FT                   NDLEKERGITILAKNTAINWKDYRINIVDTPGHADFGGEVERVMSMVDSVLLVVDAMDG
FT                   PMPQTRFVTKKAFAHGLKPIVVINKVDRPGARPDWVVDQVFDLFVNLDATDEQLDFPII
FT                   YASALMGIAGEDHNDMAEDMTPLYQAIIDHVPAPDVDSSGPLQMQISQLDYNNYVGVIG
FT                   IGRIKRGIVKPNQQVTVIDSEGKTRNGKVGKVLGHMGLERIETTQAEAGDIVAITGLGE
FT                   LNISDTICDVNAVEALPPLSVDEPTVTMYFCVNTSPFCGKEGKYVTSRQILDRLNKELI
FT                   HNVALRVEETEDADAFRVSGRGELHLSVLIENMRREGFELAVSRPKVINRIIDGRNQEP
FT                   FESVTLDIEEQHQGAVMQAMGERKGDVKDMIPDGKGRIRLDYMIPSRGLIGFRTEFMTM
FT                   TSGTGLLYSTFSHYDDVRPGDIGQRQNGVLISNGQGKAVAFALYKLQDRGKLFIGHGTE
FT                   VYEGQIIGIHSRSNDLTVNCLTGKQLTNMRASGTDEATTLVPFLKKTLEQALEFIDDDE
FT                   LVEVTPQSIRIRKRHLTENDRKRAGRGPREG"
FT   misc_feature    35108..36277
FT                   /note="Pfam match to entry PF00009 GTP_EFTU, Elongation
FT                   factor Tu family, score 368.90, E-value 1.1e-108"
FT                   /inference="protein motif:PF00009"
FT   misc_feature    35135..35158
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:ProSite:PS00017"
FT   misc_feature    35231..35278
FT                   /note="PS00301 GTP-binding elongation factors signature."
FT                   /inference="protein motif:ProSite:PS00301"
FT   CDS_pept        37247..37837
FT                   /transl_table=11
FT                   /locus_tag="YPO0027"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Escherichia coli hypothetical protein
FT                   YihX SW:YIHX_ECOLI (P32145) (199 aa) fasta scores: E():
FT                   0,67.2% id in 195 aa"
FT                   /db_xref="GOA:A0A384LK04"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384LK04"
FT                   /protein_id="CAL18717.1"
FT                   /translation="MLYIFDLGNVIVDIDFKRVLGVWSKLSSVPLATLNERFTMGEVFQ
FT                   QHERGEISDEDFAHQLSDEMGISLSFEQFAEGWQAIFVALRPEVIDIMNKLRREGNRVV
FT                   VLSNTNRLHCYYWPEHYPEVAAAADHMYLSQDLGMRKPEARIYQHVLNAENVPAEQAVF
FT                   FDDVEANVLAAKAVGINAIHVTDRQIIPTYFSL"
FT   misc_feature    37247..37807
FT                   /note="Pfam match to entry PF00702 Hydrolase, haloacid
FT                   dehalogenase-like hydrolase, score 74.60, E-value 2e-18"
FT                   /inference="protein motif:PF00702"
FT   CDS_pept        37934..38818
FT                   /transl_table=11
FT                   /gene="rbn"
FT                   /locus_tag="YPO0028"
FT                   /product="ribonuclease BN"
FT                   /EC_number="3.1.-.-"
FT                   /note="Similar to Escherichia coli ribonuclease BN Rbn
FT                   necessary for the 3' maturation of tRNA SW:RBN_ECOLI
FT                   (P32146) (290 aa) fasta scores: E(): 0, 69.9% id in 279 aa.
FT                   Note the differing N-terminal region of these proteins."
FT                   /db_xref="GOA:Q8ZJR1"
FT                   /db_xref="InterPro:IPR017039"
FT                   /db_xref="InterPro:IPR023679"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZJR1"
FT                   /inference="protein motif:TMHMM:2.0"
FT                   /protein_id="CAL18718.1"
FT                   /translation="MASFRRFRLLSPLKPCVTFGRMLYTRIDKDGLTMLAGHLAYVSLL
FT                   SLVPLITVIFALFAAFPMFAEISIKLKAFIFANFMPATGDIIQNYLEQFVANSNRMTVV
FT                   GTCGLIVTALLLIYSVDSVLNIIWRSKIQRSLVFSFAVYWMVLTLGPILVGASMVISSY
FT                   LLSLHWLAHARVDSMIDEILRVFPLLISWVSFWLLYSVVPTVRVPARDALIGALVAALL
FT                   FELGKKGFAMYITLFPSYQLIYGVLAVIPILFLWVYWSWCIVLLGAEITVTLGEYRAER
FT                   HHAKSVTTQSPEM"
FT   misc_feature    38048..38116
FT                   /gene="rbn"
FT                   /locus_tag="YPO0028"
FT                   /note="one of 7 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    38153..38206
FT                   /gene="rbn"
FT                   /locus_tag="YPO0028"
FT                   /note="one of 7 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    38234..38293
FT                   /gene="rbn"
FT                   /locus_tag="YPO0028"
FT                   /note="one of 7 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    38351..38419
FT                   /gene="rbn"
FT                   /locus_tag="YPO0028"
FT                   /note="one of 7 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    38477..38536
FT                   /gene="rbn"
FT                   /locus_tag="YPO0028"
FT                   /note="one of 7 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    38573..38641
FT                   /gene="rbn"
FT                   /locus_tag="YPO0028"
FT                   /note="one of 7 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    38669..38737
FT                   /gene="rbn"
FT                   /locus_tag="YPO0028"
FT                   /note="one of 7 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        38825..39262
FT                   /transl_table=11
FT                   /locus_tag="YPO0029"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Escherichia coli O157:H7 hypothetical
FT                   protein YihZ TR:AAG59077 (EMBL:AE005619) (145 aa) fasta
FT                   scores: E(): 0, 75.9% id in 145 aa"
FT                   /db_xref="GOA:P58534"
FT                   /db_xref="InterPro:IPR003732"
FT                   /db_xref="InterPro:IPR023509"
FT                   /db_xref="UniProtKB/Swiss-Prot:P58534"
FT                   /inference="similar to sequence:INSDC:AE005619"
FT                   /protein_id="CAL18719.1"
FT                   /translation="MIALIQRALSASVVVEGNIVGEIGPGLLVLLGVEQGDTEQKAQRL
FT                   CERVLGYRIFSDENDKMNLNVQQAGGSVLVVSQFTLVADTQKGMRPSFSRGAIPQEADR
FT                   LYQYFVAQCRERGVKTETGLFAADMKVSLVNDGPVTFWLQV"
FT   repeat_region   complement(39270..41223)
FT                   /note="insertion sequence:IS100"
FT   repeat_region   39270..39297
FT                   /rpt_type=INVERTED
FT                   /note="IS100 inverted repeat"
FT   CDS_pept        complement(39336..40118)
FT                   /transl_table=11
FT                   /gene="ypmt1.57c"
FT                   /locus_tag="YPO0030"
FT                   /product="insertion sequence IS100, ATP-binding protein"
FT                   /note="Similar to Escherichia coli insertion sequence IS21
FT                   putative ATP-binding protein, IstB SW:ISTB_ECOLI (P15026)
FT                   (265 aa) fasta scores: E(): 0, 47.4% id in 249 aa. Also
FT                   almost identical to Yersinia pestis and Escherichia coli
FT                   putative IS100 transposase ypmt1.57c TR:Q9R3L5
FT                   (EMBL:AL117211) (260 aa) fasta scores: E(): 0, 99.6% id in
FT                   260 aa."
FT                   /db_xref="GOA:Q7ARK4"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR002611"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028350"
FT                   /db_xref="UniProtKB/TrEMBL:Q7ARK4"
FT                   /inference="similar to sequence:INSDC:AL117211"
FT                   /protein_id="CAL18720.1"
FT                   /translation="MMMELQHQRLMALAGQLQLESLISAAPALSQQAVDQEWSYMDFLE
FT                   HLLHEEKLARHQRKQAMYTRMAAFPAVKTFEEYDFTFATGAPQKQLQSLRSLSFIERNE
FT                   NIVLLGPSGVGKTHLAIAMGYEAVRAGIKVRFTTAADLLLQLSTAQRQGRYKTTLQRGV
FT                   MAPRLLIIDEIGYLPFSQEEAKLFFQVIAKRYEKSAMILTSNLPFGQWDQTFAGDAALT
FT                   SAMLDRILHHSHVVQIKGESYRLRQKRKAGVIAEANPE"
FT   misc_feature    complement(39411..39950)
FT                   /note="Pfam match to entry PF01695 IstB, IstB-like ATP
FT                   binding protein, score 367.20, E-value 1.7e-106"
FT                   /inference="protein motif:PF01695"
FT   misc_feature    complement(39768..39791)
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:ProSite:PS00017"
FT   CDS_pept        complement(40115..41137)
FT                   /transl_table=11
FT                   /gene="y1093"
FT                   /gene_synonym="ypmt1"
FT                   /locus_tag="YPO0031"
FT                   /product="transposase for insertion sequence IS100"
FT                   /note="Similar to Escherichia coli transposase for
FT                   insertion sequence element IS21 IstA SW:ISTA_ECOLI (P15025)
FT                   (390 aa) fasta scores: E(): 3e-27, 33.1% id in 329 aa.
FT                   Identical to the previously sequenced Yersinia
FT                   pestis,Yersinia pseudotuberculosis, and Escherichia coli
FT                   pesticin plasmid insertion sequence transposase Y1055
FT                   TR:P74993 (EMBL:U59875) (340 aa) fasta scores: E(): 0,
FT                   100.0% id in 340 aa"
FT                   /db_xref="GOA:Q7ARN5"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR006120"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR017894"
FT                   /db_xref="UniProtKB/TrEMBL:Q7ARN5"
FT                   /inference="similar to sequence:INSDC:U59875"
FT                   /protein_id="CAL18721.1"
FT                   /translation="MVTFETVMEIKILHKQGMSSRAIARELGISRNTVKRYLQAKSEPP
FT                   KYTPRPAVASLLDEYRDYIRQRIADAHPYKIPATVIAREIRDQGYRGGMTILRAFIRSL
FT                   SVPQEQEPAVRFETEPGRQMQVDWGTMRNGRSPLHVFVAVLGYSRMLYIEFTDNMRYDT
FT                   LETCHRNAFRFFGGVPREVLYDNMKTVVLQRDAYQTGQHRFHPSLWQFGKEMGFSPRLC
FT                   RPFRAQTKGKVERMVQYTRNSFYIPLMTRLRPMGITVDVETANRHGLRWLHDVANQRKH
FT                   ETIQARPCDRWLEEQQSMLALPPEKKEYDVHLDENLVNFDKHPLHHPLSIYDSFCRGVA
FT                   "
FT   misc_feature    complement(40259..40792)
FT                   /note="Pfam match to entry PF00665 rve, Integrase core
FT                   domain, score 81.90, E-value 1.6e-22"
FT                   /inference="protein motif:PF00665"
FT   misc_feature    complement(41021..41086)
FT                   /note="Predicted helix-turn-helix motif with score 2147
FT                   (+6.50 SD) at aa 18-39, sequence MSSRAIARELGISRNTVKRYLQ"
FT   misc_feature    complement(41030..41113)
FT                   /note="Pfam match to entry PF00239
FT                   recombinase,Site-specific recombinases, score 25.70,
FT                   E-value 4.7e-06"
FT                   /inference="protein motif:PF00239"
FT   repeat_region   complement(41196..41223)
FT                   /rpt_type=INVERTED
FT                   /note="IS100 inverted repeat"
FT   CDS_pept        41407..42330
FT                   /transl_table=11
FT                   /locus_tag="YPO0032"
FT                   /product="conserved membrane protein"
FT                   /note="Similar to Escherichia coli hypothetical protein
FT                   YiiD SW:YIID_ECOLI (P32148) (329 aa) fasta scores: E():
FT                   0,83.9% id in 298 aa. Note lacks the first 16 amino acids
FT                   of the E. coli orthologue."
FT                   /db_xref="GOA:A0A384KQI5"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR012660"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384KQI5"
FT                   /protein_id="CAL18722.1"
FT                   /translation="MYHLRVPITEQELKDYYQFRWEMLRKPLHQPIGSEKDAYDAMAHH
FT                   QMVVDEQGKAVAIGRLYINADNEAAIRFLAVAPSVRNKGLGTLVAMTLESVARQEGVKR
FT                   VVCSAREDAVDFFAKLGFVCQGEITAPQTTPVRHFLMIKPVATMDDILHRPDWCGQLQQ
FT                   AWYDHIPLSEKMGVRISQYTGQRFVTTMPEAGNQNPHHTLFAGSLFSLATLTGWGLIWL
FT                   LLRERHLGGTIILADAHIRYSAPVTGRPRAVAELSSLSGDLDRLARGRRARVQLNVNLF
FT                   GDENQGAVFEGTYMVLPVAAGDDMAN"
FT   misc_feature    41557..41775
FT                   /note="Pfam match to entry PF00583
FT                   Acetyltransf,Acetyltransferase (GNAT) family, score 56.50,
FT                   E-value 5.8e-13"
FT                   /inference="protein motif:PF00583"
FT   misc_feature    41677..41742
FT                   /note="Predicted helix-turn-helix motif with score 1005
FT                   (+2.61 SD) at aa 91-112, sequence MTLESVARQEGVKRVVCSARED"
FT   misc_feature    42010..42078
FT                   /note="1 probable transmembrane helix predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        complement(42465..44174)
FT                   /transl_table=11
FT                   /locus_tag="YPO0033"
FT                   /product="possible exported protein"
FT                   /note="Similar to Escherichia coli hypothetical protein
FT                   YicH SW:YICH_ECOLI (P31433) (569 aa) fasta scores: E():
FT                   0,49.0% id in 563 aa"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384KZW0"
FT                   /protein_id="CAL18723.1"
FT                   /translation="MKFLGKTLLTLLLLFALSIVLCYAVLQTSWAAGWLSRWVSNNSGY
FT                   HLSLRGIDHRWSQPGQISFSDVTLARADQPPFLTAQQVIFGLSWRQLTDPKHFLSLQLQ
FT                   NGSLTLNNSTPSLPLQADTLQLTDMTLNTTVESKNATSQWKIAGQHVNGGLVPWQPIPG
FT                   NSFGENTQFHFSAGFLTINDISAQQIYLQGSIQKDILTLTNFGANIAQGELTGNARQSA
FT                   DGSWLVDRLRLSNIRLQTTASLEDVWNNVLQLPPITLKRFDLIDARVEGKGWAVNDVDL
FT                   TLKNITFKQGDWQSDDGELVFNASDIIKGNIHLIDPIATFTLSPEGVAINQFTTRWQDG
FT                   LLRTLGSWSRATHRLQLGELTVVALVYTLPNDWKQLWQQTLPDWLSEVYVGKLSANRNL
FT                   LIDISPDFPFQITSLDAAGSNLLLAKNHQWGVWSGSLVLNAGNATFNKNDIRRPSLALN
FT                   ANEQQITFSDLSAFTKEGLLEATASIDQTPDRALSLALTGRSVDLNFLHNWGWPALPLQ
FT                   GLGNLKLQIKGNLTADAPLKPTLNGSLQAIDSNGQQINQTVLHGVVQGTAEQ"
FT   misc_feature    complement(44088..44153)
FT                   /note="1 probable transmembrane helix predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        complement(44322..45707)
FT                   /transl_table=11
FT                   /locus_tag="YPO0034"
FT                   /product="putative membrane permease"
FT                   /note="Similar to Escherichia coli putative purine permease
FT                   YicE SW:YICE_ECOLI (P27432) (463 aa) fasta scores: E():
FT                   0,84.0% id in 462 aa and to Vibrio cholerae xanthine/uracil
FT                   permease family protein vc2712 TR:Q9KNM0 (EMBL:AE004337)
FT                   (480 aa) fasta scores: E(): 0, 69.1% id in 450 aa"
FT                   /db_xref="GOA:Q0WKQ8"
FT                   /db_xref="InterPro:IPR006042"
FT                   /db_xref="InterPro:IPR006043"
FT                   /db_xref="InterPro:IPR017588"
FT                   /db_xref="UniProtKB/TrEMBL:Q0WKQ8"
FT                   /inference="protein motif:TMHMM:2.0"
FT                   /inference="similar to sequence:INSDC:AE004337"
FT                   /protein_id="CAL18724.1"
FT                   /translation="MSTQSAELDTAPPSPAHPSELIYHLEDRPPLPQTLFAACQHLLAM
FT                   FVAVITPGLLICQALGLPAEDTQRIISMSLFASGLASLLQIKTWGPVGSGLLSIQGTSF
FT                   NFVSPLIMGGLALKNGGADIPTMMAALFGTLMVASCTEILLSHVLHLARRIITPLVSGI
FT                   VVMIIGLSLIQVGLTSIGGGYGAMSDNTFGAPKNLLLAGAVLGVIILLNRQRNPYLRVA
FT                   SLVIAMAVGYLLAWALGMLPESRPVVDTALITIPTPLYYGLSFDWNLLIPLMLIFMVTS
FT                   LETIGDITATSDVSEQPVRGPLYMKRLKGGVLANGLNSMLSAIFNTFPNSCFGQNNGVI
FT                   QLTGVASRYVGFVVAIMLIILGLFPAVAGFVQHIPEPVLGGATLVMFGTIAASGVRIVS
FT                   RETLNRRAIMIMALSLAVGMGVAQQPLILQFAPDWIKTLFSSGIAAGGITAIVLNLLFP
FT                   QEK"
FT   misc_feature    complement(44337..44393)
FT                   /locus_tag="YPO0034"
FT                   /note="one of 11 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    complement(44424..44489)
FT                   /locus_tag="YPO0034"
FT                   /note="one of 11 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    complement(44427..45614)
FT                   /note="Pfam match to entry PF00860
FT                   xan_ur_permease,Xanthine/uracil permeases family, score
FT                   527.60, E-value 8.7e-155"
FT                   /inference="protein motif:PF00860"
FT   misc_feature    complement(44511..44576)
FT                   /locus_tag="YPO0034"
FT                   /note="one of 11 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    complement(44526..44588)
FT                   /note="PS01116 Xanthine/uracil permeases family signature."
FT                   /inference="protein motif:ProSite:PS01116"
FT   misc_feature    complement(44592..44657)
FT                   /locus_tag="YPO0034"
FT                   /note="one of 11 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    complement(44862..44927)
FT                   /locus_tag="YPO0034"
FT                   /note="one of 11 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    complement(44988..45053)
FT                   /locus_tag="YPO0034"
FT                   /note="one of 11 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    complement(45075..45131)
FT                   /locus_tag="YPO0034"
FT                   /note="one of 11 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    complement(45177..45242)
FT                   /locus_tag="YPO0034"
FT                   /note="one of 11 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    complement(45264..45329)
FT                   /locus_tag="YPO0034"
FT                   /note="one of 11 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    complement(45360..45425)
FT                   /locus_tag="YPO0034"
FT                   /note="one of 11 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    complement(45516..45581)
FT                   /locus_tag="YPO0034"
FT                   /note="one of 11 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        45945..47159
FT                   /transl_table=11
FT                   /gene="gltC"
FT                   /gene_synonym="gltS"
FT                   /locus_tag="YPO0035"
FT                   /product="sodium/glutamate symport carrier protein"
FT                   /note="Highly similar to Escherichia coli sodium/glutamate
FT                   symport carrier protein GltS SW:GLTS_ECOLI (P19933) (401
FT                   aa) fasta scores: E(): 0, 82.5% id in 399 aa"
FT                   /db_xref="GOA:A0A0H2VZZ7"
FT                   /db_xref="InterPro:IPR004445"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2VZZ7"
FT                   /inference="protein motif:TMHMM:2.0"
FT                   /protein_id="CAL18725.1"
FT                   /translation="MFHLDTYGTLVAACLVLLLGRKLVQTVPFLKKYTIPEPVAGGLLV
FT                   AFMMLLVQKTLGWEVSFDMSLKDPLMLAFFATIGLNANLASLRAGGKALSIFVFIVVGL
FT                   LLVQNTIGIVLAKLMGLDPLMGLLAGSITLSGGHGTGAAWSKLFSERYGFENATEVAMA
FT                   CATFGLVLGGLIGGPVARYLVKHSSTPEGTPDDSAVPSAFEKPSAGRMITSLVLIETIA
FT                   MISICLMAGNLIAGWLQGTMFELPIFVCVLFVGVILSNTLSASGFYRVFDRAVSVLGNV
FT                   SLSLFLAMALMSLKLWELASLALPMLVILSVQALAMALYAIFVTYRIMGKNYDAAVLAA
FT                   GHCGFGLGATPTAIANMQAITDRFGPSHLAFLVVPMVGAFFIDIVNAIVIKLYLLLPIF
FT                   PAVTG"
FT   misc_feature    45954..46007
FT                   /gene="gltC"
FT                   /gene_synonym="gltS"
FT                   /locus_tag="YPO0035"
FT                   /note="one of 11 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    46041..46109
FT                   /gene="gltC"
FT                   /gene_synonym="gltS"
FT                   /locus_tag="YPO0035"
FT                   /note="one of 11 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    46152..46205
FT                   /gene="gltC"
FT                   /gene_synonym="gltS"
FT                   /locus_tag="YPO0035"
FT                   /note="one of 11 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    46224..46292
FT                   /gene="gltC"
FT                   /gene_synonym="gltS"
FT                   /locus_tag="YPO0035"
FT                   /note="one of 11 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    46413..46481
FT                   /gene="gltC"
FT                   /gene_synonym="gltS"
FT                   /locus_tag="YPO0035"
FT                   /note="one of 11 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    46581..46649
FT                   /gene="gltC"
FT                   /gene_synonym="gltS"
FT                   /locus_tag="YPO0035"
FT                   /note="one of 11 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    46677..46745
FT                   /gene="gltC"
FT                   /gene_synonym="gltS"
FT                   /locus_tag="YPO0035"
FT                   /note="one of 11 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    46764..46820
FT                   /gene="gltC"
FT                   /gene_synonym="gltS"
FT                   /locus_tag="YPO0035"
FT                   /note="one of 11 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    46848..46916
FT                   /gene="gltC"
FT                   /gene_synonym="gltS"
FT                   /locus_tag="YPO0035"
FT                   /note="one of 11 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    46953..47021
FT                   /gene="gltC"
FT                   /gene_synonym="gltS"
FT                   /locus_tag="YPO0035"
FT                   /note="one of 11 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    47064..47132
FT                   /gene="gltC"
FT                   /gene_synonym="gltS"
FT                   /locus_tag="YPO0035"
FT                   /note="one of 11 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        complement(47525..49606)
FT                   /transl_table=11
FT                   /gene="recG"
FT                   /locus_tag="YPO0036"
FT                   /product="ATP-dependent DNA helicase"
FT                   /EC_number="3.6.1.-"
FT                   /note="Similar to Escherichia coli ATP-dependent DNA
FT                   helicase RecG SW:RECG_ECOLI (P24230) (693 aa) fasta scores:
FT                   E(): 0, 81.5% id in 693 aa"
FT                   /db_xref="GOA:A0A384KKY7"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR004609"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033454"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384KKY7"
FT                   /protein_id="CAL18726.1"
FT                   /translation="MKGRLLDAVPLSTLSGVGASQAGKLAKIGLETIQDLLLHLPLRYE
FT                   DRTRLYRIGDLLPGLSVTVEGEVLRSDISFGRRRMMTCQISDGSGVLTLRFFNFNAAMK
FT                   NSLSVGKHVIAYGEAKRGNNGPEIIHPEYRVHGENIGVELQESLTPVYPTTEGIRQATL
FT                   RKLIDQALAMLDTCVIAELLPIELSRSLISLPEAIHTLHRPPADIQLADLEQGKHPAQR
FT                   RLIMEELLAHNLSMLAVRAGAQSYRALPLMAEEQLKQRFLAALPFTPTQAQQRVVAEIE
FT                   RDMTQSFPMMRLIQGDVGSGKTLVAALAALRAIAHGKQVALMAPTELLAEQHATTFRQW
FT                   LEPLGFSVGWLAGKQKGKARLAQQEAVASGQVSMVIGTHAMFQEQVQFSGLALVIIDEQ
FT                   HRFGVHQRLTLWEKGEEQGFHPHQLIMTATPIPRTLAMTAYADLDTSVIDELPPGRTPV
FT                   TTVAIPDTRRSDVIQRVKNACLEEGRQAYWVCTLIEESELLEAQAAEVTCEELKIALPE
FT                   IKVGLVHGRMKGPEKQAIMLAFKQGELQLLVATTVIEVGVDVPNASLMIIDNPERLGLA
FT                   QLHQLRGRVGRGAVASHCVLLYKTPLSKTAQMRLQVLRDSNDGFVIAQRDLEIRGPGEL
FT                   LGTRQTGSAEFKVADLLRDQAMIPEVQRVARHLHQQYPEHAKALIERWLPERVRYTNA"
FT   misc_feature    complement(47840..48103)
FT                   /note="Pfam match to entry PF00271 helicase_C, Helicases
FT                   conserved C-terminal domain, score 77.80, E-value 2.3e-19"
FT                   /inference="protein motif:PF00271"
FT   misc_feature    complement(48185..48832)
FT                   /note="Pfam match to entry PF00270 DEAD, DEAD/DEAH box
FT                   helicase, score 92.40, E-value 2.6e-28"
FT                   /inference="protein motif:PF00270"
FT   misc_feature    complement(48698..48721)
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:ProSite:PS00017"
FT   misc_feature    complement(49199..49423)
FT                   /note="Pfam match to entry PF01336 tRNA_anti, tRNA
FT                   synthetase anti-codon binding domain, score 25.70, E-value
FT                   0.0011"
FT                   /inference="protein motif:PF01336"
FT   CDS_pept        complement(49607..50299)
FT                   /transl_table=11
FT                   /gene="spoU"
FT                   /gene_synonym="trmH"
FT                   /locus_tag="YPO0037"
FT                   /product="tRNA (guanosine-2'-O-)-methyltransferase"
FT                   /EC_number="2.1.1.34"
FT                   /note="Similar to Escherichia coli tRNA
FT                   (guanosine-2'-O-)-methyltransferase, TrmH SW:TRMH_ECOLI
FT                   (P19396) (229 aa) fasta scores: E(): 0, 82.8% id in 227 aa"
FT                   /db_xref="GOA:A0A0H2W0X5"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR022724"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="InterPro:IPR033671"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2W0X5"
FT                   /protein_id="CAL18727.1"
FT                   /translation="MNPQRYARICDMLATRQPDLTVCLEQVHKPHNVSAIIRTADAVGI
FT                   HQVHAIWPTTQMYTRLSAAAGSNSWVQVKTHPHIADAIAYLKSQDMQILATHLSDKAVD
FT                   FREIDYTRPTCILMGQEKTGISPEALALADQDIIIPMIGMVQSLNVSVASALILYEAQR
FT                   QRQNAGMYKRTHSVLAESEQQRLLFEGGYPVLAHVAKRKGLPQPHIDEQGQIIADAQWW
FT                   SAMQATES"
FT   misc_feature    complement(49823..50173)
FT                   /note="Pfam match to entry PF00588 SpoU_methylase, SpoU
FT                   rRNA Methylase family, score 96.50, E-value 5.2e-25"
FT                   /inference="protein motif:PF00588"
FT   CDS_pept        complement(50305..52413)
FT                   /transl_table=11
FT                   /gene="spoT"
FT                   /locus_tag="YPO0038"
FT                   /product="guanosine-3',5'-bisbis(diphosphate)
FT                   3'-pyrophosphydrolase"
FT                   /EC_number="3.1.7.2"
FT                   /note="Similar to Escherichia coli
FT                   guanosine-3',5'-bis(diphosphate)
FT                   3'-pyrophosphydrolase,mediator of the stringent response,
FT                   SpoT SW:SPOT_ECOLI (P17580) (702 aa) fasta scores: E(): 0,
FT                   91.3% id in 702 aa"
FT                   /db_xref="GOA:A0A0H2W0T4"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR004095"
FT                   /db_xref="InterPro:IPR004811"
FT                   /db_xref="InterPro:IPR007685"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR012676"
FT                   /db_xref="InterPro:IPR033655"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2W0T4"
FT                   /protein_id="CAL18728.1"
FT                   /translation="MYLFESLNLLIQRYLPEEQIKRLKQAYLVARDAHEGQTRSSGEPY
FT                   ITHPVAVACILAEMRLDYETLMAALLHDVIEDTPATYQDMEQLFGKSVAELVEGVSKLD
FT                   KLNFRDKKEAQAENFRKMIMAMVQDIRVILIKLADRTHNMRTLGSLRPDKRRRIARETL
FT                   EIYSPLAHRLGIHHLKTELEELGFEALYPNRYRVIKEVVKAARGNRKEMIQKILAEIEG
FT                   RLTEAGIPCRVSGREKHLYSIYCKMHLKEQRFHSIMDIYAFRVIVKEVDTCYRVLGQAH
FT                   SLYKPRPGRVKDYIAIPKANGYQSLHTSLIGPHGVPVEVQIRTEDMDQMAEMGVAAHWA
FT                   YKEQGESGTTAQIRAQRWMQSLLELQQSAGSSFEFIESVKSDLFPDEIYVFTPEGRIVE
FT                   LPAGATPVDFAYVVHTDIGHACVGARVDRQPYPLSQPLSSGQTVEIITAPGARPNAAWL
FT                   NFVVSSKARAKIRQLLKNLKRDESVSLGRRLLNHALGNGRKLSDISEENIKHELDRMKL
FT                   ATVDDLLAEIGLGNAMSVVVAKNLLGDPSTLGTSASGTRKLPIKGADGVLITFAKCCRP
FT                   IPGDPIIAHISPGKGLVIHHESCRNIRGYQKEPEKFMAVEWDQETEQEFIAEIKVDMFN
FT                   QQGALANLTAAINAAESNIQSLNTEEKDGRVYSAFIRLTTRNRVHLANIMRKIRIMPDV
FT                   VKVSRNRN"
FT   CDS_pept        complement(52433..52708)
FT                   /transl_table=11
FT                   /gene="rpoZ"
FT                   /locus_tag="YPO0039"
FT                   /product="DNA-directed RNA polymerase, omega chain"
FT                   /EC_number="2.7.7.6"
FT                   /note="Similar to Escherichia coli DNA-directed RNA
FT                   polymerase omega chain RpoZ SW:RPOZ_ECOLI (P08374) (91 aa)
FT                   fasta scores: E(): 6.2e-29, 92.3% id in 91 aa"
FT                   /db_xref="GOA:Q8ZJQ3"
FT                   /db_xref="InterPro:IPR003716"
FT                   /db_xref="InterPro:IPR006110"
FT                   /db_xref="InterPro:IPR012293"
FT                   /db_xref="InterPro:IPR036161"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZJQ3"
FT                   /protein_id="CAL18729.1"
FT                   /translation="MARVTVQDAVEKIGNRFDLVLVAARRARQIQSGGKDALVPEENDK
FT                   VTVIALREIEEGLITNQILDVRERQEQQEQQAAEIQAVTAIAEGRR"
FT   CDS_pept        complement(52763..53386)
FT                   /transl_table=11
FT                   /gene="gmk"
FT                   /gene_synonym="spoR"
FT                   /locus_tag="YPO0040"
FT                   /product="guanylate kinase"
FT                   /EC_number="2.7.4.8"
FT                   /note="Similar to Escherichia coli guanylate kinase Gmk
FT                   SW:KGUA_ECOLI (P24234) (207 aa) fasta scores: E(): 0, 87.9%
FT                   id in 207 aa"
FT                   /db_xref="GOA:Q8ZJQ2"
FT                   /db_xref="InterPro:IPR008144"
FT                   /db_xref="InterPro:IPR008145"
FT                   /db_xref="InterPro:IPR017665"
FT                   /db_xref="InterPro:IPR020590"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZJQ2"
FT                   /protein_id="CAL18730.1"
FT                   /translation="MVQGTLYIVSAPSGAGKSSLIQALLKTQPLYDTQVSISHTTRAKR
FT                   PGENHGEHYFFVSEKEFCQMIDDDAFLEHAKVFENYYGTSRLAIEQVLATGVDVFLDID
FT                   WQGAQQIRAKMPTARSIFILPPSKTELDRRLRGRGQDSEEVIAKRMEQAVAEMAHYAEY
FT                   DYLIVNDDFNLALSDLKTIIRAERLRLGRQKQRHDALISKLLAD"
FT   misc_feature    complement(52952..53266)
FT                   /note="Pfam match to entry PF00625 Guanylate_kin, Guanylate
FT                   kinase, score 189.60, E-value 4.9e-53"
FT                   /inference="protein motif:PF00625"
FT   misc_feature    complement(53216..53269)
FT                   /note="PS00856 Guanylate kinase signature."
FT                   /inference="protein motif:ProSite:PS00856"
FT   misc_feature    complement(53333..53356)
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:ProSite:PS00017"
FT   CDS_pept        53787..55490
FT                   /transl_table=11
FT                   /locus_tag="YPO0041"
FT                   /product="putative DNA ligase"
FT                   /note="Similar to Chlamydia trachomatis DNA ligase LigA
FT                   SW:DNLJ_CHLTR (O84148) (663 aa) fasta scores: E():
FT                   3.1e-07,24.0% id in 555 aa, and to Escherichia coli
FT                   hypothetical protein YicF SW:YICF_ECOLI (P25772) (560 aa)
FT                   fasta scores: E(): 0, 43.8% id in 564 aa"
FT                   /db_xref="GOA:Q7CLB2"
FT                   /db_xref="InterPro:IPR004150"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013839"
FT                   /db_xref="InterPro:IPR013840"
FT                   /db_xref="InterPro:IPR020923"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7CLB2"
FT                   /protein_id="CAL18731.1"
FT                   /translation="MNILNLKIIMFLLISNTIVVGGAWATSTCPDWPATRIAVEINALE
FT                   QQLNKWSAAYHQQGHSPVTDDIYDQLQDKLRVWQSCRGLPDKTESQPIPGKGQFLHPVA
FT                   HTGLKKLKDETALTRWMAGRKNLWVQPKVDGVAVTLVYHGGKLVQLLSRGNGVKGQNWT
FT                   EKAPFISAIPQYIANAPALLTLQGELFLLMDGHQQAKSGGVNARSTVAGALMRKSPSPL
FT                   LAQVGVFIWAWPDGPTTMKEKVALLQVMGFPFTAKYSEPVMSHLDVVQWRQFWFQAPLP
FT                   FVTDGVVVRQEEEPAGRYWQATPGQWSMAWKYPPLQHIAEVKDIHFTLGRTGKGTVVLE
FT                   VLPIKIDDKWIRRVNIGSVTRWKQWDIAPGDHITLALAGHGIPRLDNVVWRVHQRNTIT
FT                   APNWDKFHQLSCFQRLPHGCEPQFLSRLIWLSGPGGLDIGGIGGGFWQELIHHELINDL
FT                   VGWLLLTPEQIASIPGIGNARAEKIYQQFQRAKQQPFSRWLLALGFPQVVSVDAQWQVV
FT                   LRRSLSEWATMAGIGQMRAKQIKHFLDHPDVQALADFLSTQKVVGFELTE"
FT   misc_feature    53787..53855
FT                   /note="PS00430 TonB-dependent receptor proteins signature
FT                   1."
FT                   /inference="protein motif:ProSite:PS00430"
FT   misc_feature    53889..54734
FT                   /note="Pfam match to entry PF01653
FT                   DNA_ligase_N,NAD-dependent DNA ligase, score 117.70,
FT                   E-value 2.2e-31"
FT                   /inference="protein motif:PF01653"
FT   misc_feature    55344..55409
FT                   /note="Predicted helix-turn-helix motif with score 1148
FT                   (+3.10 SD) at aa 520-541, sequence RSLSEWATMAGIGQMRAKQIKH"
FT   CDS_pept        complement(55503..56126)
FT                   /transl_table=11
FT                   /locus_tag="YPO0042"
FT                   /product="putative membrane protein"
FT                   /note="Similar to Escherichia coli hypothetical protein
FT                   YicG SW:YICG_ECOLI (P31432) (205 aa) fasta scores: E():
FT                   0,74.2% id in 182 aa and to Escherichia coli O157:H7
FT                   orf,hypothetical protein YicG TR:AAG58790 (EMBL:AE005592)
FT                   (223 aa) fasta scores: E(): 0, 74.2% id in 182 aa"
FT                   /db_xref="InterPro:IPR005115"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384L090"
FT                   /inference="protein motif:TMHMM:2.0"
FT                   /inference="similar to sequence:INSDC:AE005592"
FT                   /protein_id="CAL18732.1"
FT                   /translation="MLLSVLYIIGITAEAMTGALAAGRRQMDMFGVIIIASATAIGGGS
FT                   VRDMLLGHYPLGWVKHPEYIVIVAIAAIVTTWMAPLMKQLRHLFLVLDAIGLIVFSIIG
FT                   AQIALDMGHSTIIAAIAAVITGVFGGVLRDMLCNCIPLVFQKEIYAGISFAAAWIYIAL
FT                   QYTPLSHNWVIIITLITGLALDYSPYDSGLACLYSNMSTQTIKL"
FT   misc_feature    complement(55545..55610)
FT                   /locus_tag="YPO0042"
FT                   /note="one of 6 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    complement(55641..55706)
FT                   /locus_tag="YPO0042"
FT                   /note="one of 6 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    complement(55728..55793)
FT                   /locus_tag="YPO0042"
FT                   /note="one of 6 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    complement(55806..55862)
FT                   /locus_tag="YPO0042"
FT                   /note="one of 6 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    complement(55884..55934)
FT                   /locus_tag="YPO0042"
FT                   /note="one of 6 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    complement(55980..56036)
FT                   /locus_tag="YPO0042"
FT                   /note="one of 6 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        complement(56529..57392)
FT                   /transl_table=11
FT                   /locus_tag="YPO0043"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Escherichia coli hypothetical protein
FT                   YicC SW:YICC_ECOLI (P23839) (287 aa) fasta scores: E():
FT                   0,87.5% id in 287 aa"
FT                   /db_xref="InterPro:IPR005229"
FT                   /db_xref="InterPro:IPR013527"
FT                   /db_xref="InterPro:IPR013551"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384LCX1"
FT                   /protein_id="CAL18733.1"
FT                   /translation="MIRSMTAYARRDIKGEWGNAAWELRSVNQRYLETYIRLPEQFRSL
FT                   EPVIRERIRSRLTRGKIECHLRFELDANAQSSLILNEKLAKQLVEAGNWVKMQSDEGEI
FT                   NPVDILRWPGVMSAEEQDLDAISTELMQALDTALDDFIVSRETEGAALKTLIEQRLEGV
FT                   SAEVVKVRAHMPNILQWQRERLLNKLEEAQVQLENTRLEQELVLMAQRIDVAEELDRLE
FT                   AHVKETYNILKKKEAVGRRLDFMMQEFNRESNTLASKSINAEVTNSAIELKVLIEQMRE
FT                   QIQNIE"
FT   CDS_pept        57519..58235
FT                   /transl_table=11
FT                   /gene="rph"
FT                   /locus_tag="YPO0044"
FT                   /product="ribonuclease PH"
FT                   /EC_number="2.7.7.56"
FT                   /note="Similar to Escherichia coli ribonuclease PH Rph
FT                   SW:RNPH_ECOLI (P03842) (238 aa) fasta scores: E(): 0, 87.7%
FT                   id in 236 aa"
FT                   /db_xref="GOA:Q8ZJP8"
FT                   /db_xref="InterPro:IPR001247"
FT                   /db_xref="InterPro:IPR002381"
FT                   /db_xref="InterPro:IPR015847"
FT                   /db_xref="InterPro:IPR018336"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027408"
FT                   /db_xref="InterPro:IPR036345"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZJP8"
FT                   /protein_id="CAL18734.1"
FT                   /translation="MRPADRAAQQVRPLTLTRNYTKHAEGSVLVEFGDTKVLCTATVEE
FT                   GVPRFLKGQGQGWITAEYGMLPRSTHSRNAREAAKGKQGGRTLEIQRLIARSLRAAVDL
FT                   KKLGEFTITLDCDVLQADGGTRTASISGACVALADALNKLVASGKLKANPMKGLVAAVS
FT                   VGIVKGEALCDLEYVEDSAAETDMNVVMMEDGRMIEVQGTAEGEPFSHEELLALLDLAR
FT                   GGIETIFQAQKAALES"
FT   misc_feature    57522..58190
FT                   /note="Pfam match to entry PF01138 RNase_PH, 3'
FT                   exoribonuclease family, score 293.00, E-value 3.8e-84"
FT                   /inference="protein motif:PF01138"
FT   misc_feature    57864..57902
FT                   /note="PS01277 Ribonuclease PH signature."
FT                   /inference="protein motif:ProSite:PS01277"
FT   CDS_pept        58402..59049
FT                   /transl_table=11
FT                   /gene="pyrE"
FT                   /locus_tag="YPO0045"
FT                   /product="orotate phosphoribosyltransferase"
FT                   /EC_number="2.4.2.10"
FT                   /note="Similar to Escherichia coli orotate
FT                   phosphoribosyltransferase PyrE, involved in pyrimidine
FT                   biosynthesis SW:PYRE_ECOLI (P00495) (212 aa) fasta scores:
FT                   E(): 0, 85.8% id in 212 aa"
FT                   /db_xref="GOA:Q8ZJP7"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR004467"
FT                   /db_xref="InterPro:IPR023031"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZJP7"
FT                   /protein_id="CAL18735.1"
FT                   /translation="MKAYQREFIEFALNKQVLKFGEFTLKSGRISPYFFNAGLFNTGLD
FT                   LAKLGRFYAAALMDCGVEFDLLFGPAYKGIPIATTTAVALAEHHERDVPYCFNRKEAKT
FT                   HGEGGNLVGSPLQGRVMLVDDVITAGTAIRESMEIINAQGATLAGVMISLDRQERGRGE
FT                   ISAIQEVERDYHCKVIAIVTLNDVIRYLEDKPEMAEHLVAVRQYREQYGVTL"
FT   misc_feature    58495..58956
FT                   /note="Pfam match to entry PF00156
FT                   Pribosyltran,Phosphoribosyl transferase domain, score
FT                   96.50, E-value 5.1e-25"
FT                   /inference="protein motif:PF00156"
FT   misc_feature    58759..58797
FT                   /note="PS00103 Purine/pyrimidine phosphoribosyl
FT                   transferases signature."
FT                   /inference="protein motif:ProSite:PS00103"
FT   CDS_pept        complement(59184..59780)
FT                   /transl_table=11
FT                   /gene="ttk"
FT                   /locus_tag="YPO0046"
FT                   /product="TetR-family regulatory protein"
FT                   /note="Similar to Escherichia coli Ttk regulatory protein
FT                   SW:TTK_ECOLI (P06969) (198 aa) fasta scores: E(): 0, 83.3%
FT                   id in 198 aa"
FT                   /db_xref="GOA:Q8ZJP6"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR023769"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZJP6"
FT                   /protein_id="CAL18736.1"
FT                   /translation="MAEKENTKRNRREEILQALAQMLESSDGSQRITTAKLAANVGVSE
FT                   AALYRHFPSKTRMFDSLIEFIEDSLMSRINLILQDEKETFNRLRLILLLVLGFAERNPG
FT                   LTRIMTGHALMFEQDRLQGRINQLFERIEMQLRQVLREKKLRDGQGFIHDEALLATQLL
FT                   AFCEGMLSRFVRSEFRYCPTQEFDSRWPLIVAQLQ"
FT   misc_feature    complement(59595..59738)
FT                   /note="Pfam match to entry PF00440 tetR, Bacterial
FT                   regulatory proteins, tetR family, score 39.00, E-value
FT                   2e-08"
FT                   /inference="protein motif:PF00440"
FT   misc_feature    complement(59607..59699)
FT                   /note="PS01081 Bacterial regulatory proteins, tetR family
FT                   signature."
FT                   /inference="protein motif:ProSite:PS01081"
FT   misc_feature    complement(59622..59687)
FT                   /note="Predicted helix-turn-helix motif with score 1905
FT                   (+5.68 SD) at aa 32-53, sequence ITTAKLAANVGVSEAALYRHFP"
FT   CDS_pept        complement(59902..60357)
FT                   /transl_table=11
FT                   /gene="dnaS"
FT                   /gene_synonym="dut"
FT                   /gene_synonym="sof"
FT                   /locus_tag="YPO0047"
FT                   /product="deoxyuridine 5'-triphosphate nucleotidohydrolase"
FT                   /EC_number="3.6.1.23"
FT                   /note="Similar to Escherichia coli deoxyuridine
FT                   5'-triphosphate nucleotidohydrolase Dut, involved in
FT                   nucleotide metabolism SW:DUT_ECOLI (P06968) (151 aa) fasta
FT                   scores: E(): 0, 84.8% id in 151 aa"
FT                   /db_xref="GOA:Q8ZJP5"
FT                   /db_xref="InterPro:IPR008181"
FT                   /db_xref="InterPro:IPR029054"
FT                   /db_xref="InterPro:IPR033704"
FT                   /db_xref="InterPro:IPR036157"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZJP5"
FT                   /protein_id="CAL18737.1"
FT                   /translation="MKKIDIKILDPRVGNEFPLPTYATEGSAGLDLRACLDHAVELQPG
FT                   QTTLLPTGLAIHIGDSALAAVILPRSGLGHKHGIVLGNLVGLIDSDYQGQLMVSVWNRG
FT                   QQPFTIEPGERIAQMVFVPVVQAEFNLVEDFTDSERGTGGFGHSGRQ"
FT   misc_feature    complement(59911..60213)
FT                   /note="Pfam match to entry PF00692 dUTPase, dUTPase, score
FT                   92.70, E-value 7.4e-24"
FT                   /inference="protein motif:PF00692"
FT   CDS_pept        complement(60338..61555)
FT                   /transl_table=11
FT                   /gene="dfp"
FT                   /locus_tag="YPO0048"
FT                   /product="DNA/pantothenate metabolism flavoprotein"
FT                   /note="Similar to Escherichia coli DNA/pantothenate
FT                   metabolism flavoprotein Dfp SW:DFP_ECOLI (P24285) (430 aa)
FT                   fasta scores: E(): 0, 75.2% id in 407 aa, and to Vibrio
FT                   cholerae DNA/pantothenate metabolism flavoprotein VC0215
FT                   TR:Q9KVD1 (EMBL:AE004111) (399 aa) fasta scores: E():
FT                   0,66.2% id in 396 aa"
FT                   /db_xref="GOA:Q74YA6"
FT                   /db_xref="InterPro:IPR003382"
FT                   /db_xref="InterPro:IPR005252"
FT                   /db_xref="InterPro:IPR007085"
FT                   /db_xref="InterPro:IPR035929"
FT                   /db_xref="InterPro:IPR036551"
FT                   /db_xref="UniProtKB/TrEMBL:Q74YA6"
FT                   /inference="similar to sequence:INSDC:AE004111"
FT                   /protein_id="CAL18738.1"
FT                   /translation="MMTGLSGKHIVLGISGGIAAYKSPELVRRLRDKGADVRVVMTHAA
FT                   KAFIAPLTLQAVSGYPVSDDLLDPAAEAAMGHIELGKWADLVIIAPATADLLARMAAGM
FT                   ANDLLTTVCLATAAPIAAVPAMNQQMYRAPATQENLQTLSKWGVLLWGPDSGSQACGDI
FT                   GPGRMLDPQEIVALAYNHFSAKQDLQHLSVMITAGPTREPLDPVRFISNQSSGKMGFAI
FT                   AQALAARGSNVTLIAGPVNLSTPEGVKRIDVITALEMQQAVQKIAQQQNIFISCAAVAD
FT                   YRAEHVSDEKIKKQGDEITLKLVKNPDIVAGVASMAKNRPFVVGFAAETQNVEEYARQK
FT                   LARKNLDLICANDVSLAEHGFNSDTNALHLFWSTGEKRLPLSDKYLLSQRLIDEIVSRY
FT                   DEKNRH"
FT   misc_feature    complement(60728..60760)
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:ProSite:PS00013"
FT   misc_feature    complement(61181..61534)
FT                   /note="Pfam match to entry PF02441 Flavoprotein, , score
FT                   168.70, E-value 9.7e-47"
FT                   /inference="protein motif:PF02441"
FT   CDS_pept        61749..62417
FT                   /transl_table=11
FT                   /gene="radC"
FT                   /locus_tag="YPO0049"
FT                   /product="putative DNA repair protein"
FT                   /note="Similar to Escherichia coli DNA repair protein RadC
FT                   SW:RADC_ECOLI (P25531) (222 aa) fasta scores: E(): 0, 58.2%
FT                   id in 213 aa"
FT                   /db_xref="GOA:Q8ZJP3"
FT                   /db_xref="InterPro:IPR001405"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR020891"
FT                   /db_xref="InterPro:IPR022820"
FT                   /db_xref="InterPro:IPR025657"
FT                   /db_xref="InterPro:IPR037518"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZJP3"
FT                   /protein_id="CAL18739.1"
FT                   /translation="MDEWYGQVAPREKLLKYGAAVLTDAELLAIFLRTGIPGMHVMKMA
FT                   EYLIETFGSLHGLISADYQTLCAHKGIGASKYSQIQAIGELACRCFSSHLMRESVLLNP
FT                   GITQKFLQNILSHREREIFLVVFLDNQHRVIRHEEMFTGTISSVEVHPREIVREALKVN
FT                   AAALILAHNHPSGKAEPSQADRLITTQVIKACSLLDIRVLDHLVVGRGECVSFAERGWL
FT                   "
FT   misc_feature    62259..62276
FT                   /note="PS01302 DNA repair protein radC family signature."
FT                   /inference="protein motif:ProSite:PS01302"
FT   CDS_pept        62680..62916
FT                   /transl_table=11
FT                   /gene="rpmB"
FT                   /locus_tag="YPO0050"
FT                   /product="50S ribosomal protein L28"
FT                   /note="Similar to Escherichia coli 50S ribosomal protein
FT                   L28 RpmB SW:RL28_ECOLI (P02428) (77 aa) fasta scores: E():
FT                   1.1e-32, 92.2% id in 77 aa"
FT                   /db_xref="GOA:Q8ZJP2"
FT                   /db_xref="InterPro:IPR001383"
FT                   /db_xref="InterPro:IPR026569"
FT                   /db_xref="InterPro:IPR034704"
FT                   /db_xref="InterPro:IPR037147"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZJP2"
FT                   /protein_id="CAL18740.1"
FT                   /translation="MSRVCQVTGKRPMSGNNRSHAMNATKRRFLPNLHSHRFWVEGEKR
FT                   FVTLRVSAKGMRVIDKKGIETVLAEIRARGEKY"
FT   misc_feature    62686..62868
FT                   /note="Pfam match to entry PF00830 Ribosomal_L28, Ribosomal
FT                   L28 family, score 132.40, E-value 8.1e-36"
FT                   /inference="protein motif:PF00830"
FT   CDS_pept        62928..63095
FT                   /transl_table=11
FT                   /gene="rpmG"
FT                   /locus_tag="YPO0051"
FT                   /product="50S ribosomal protein L33"
FT                   /note="Similar to Escherichia coli and Salmonella
FT                   typhimurium 50S ribosomal protein L33 SW:RL33_ECOLI
FT                   (P02436) (54 aa) fasta scores: E(): 1.7e-21, 96.3% id in 54
FT                   aa"
FT                   /db_xref="GOA:Q8ZJP1"
FT                   /db_xref="InterPro:IPR001705"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="InterPro:IPR018264"
FT                   /db_xref="InterPro:IPR038584"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZJP1"
FT                   /protein_id="CAL18741.1"
FT                   /translation="MAKGVREKIKLVSSAGTGHFYTTTKNKRTKPEKLELKKFDPVVRQ
FT                   HVLYKEAKIK"
FT   misc_feature    62943..63086
FT                   /note="Pfam match to entry PF00471 Ribosomal_L33, Ribosomal
FT                   protein L33, score 91.30, E-value 2e-23"
FT                   /inference="protein motif:PF00471"
FT   misc_feature    62988..63047
FT                   /note="PS00582 Ribosomal protein L33 signature."
FT                   /inference="protein motif:ProSite:PS00582"
FT   CDS_pept        63178..63987
FT                   /transl_table=11
FT                   /gene="fpg"
FT                   /gene_synonym="mutM"
FT                   /locus_tag="YPO0052"
FT                   /product="formamidopyrimidine-DNA glycosylase"
FT                   /EC_number="3.2.2.23"
FT                   /note="Similar to Escherichia coli formamidopyrimidine-DNA
FT                   glycosylase involved in DNA-damage repair, MutM
FT                   SW:FPG_ECOLI (P05523) (269 aa) fasta scores: E(): 0, 79.5%
FT                   id in 268 aa"
FT                   /db_xref="GOA:Q8ZJP0"
FT                   /db_xref="InterPro:IPR000214"
FT                   /db_xref="InterPro:IPR010663"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR012319"
FT                   /db_xref="InterPro:IPR015886"
FT                   /db_xref="InterPro:IPR015887"
FT                   /db_xref="InterPro:IPR020629"
FT                   /db_xref="InterPro:IPR035937"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZJP0"
FT                   /protein_id="CAL18742.1"
FT                   /translation="MPELPEVETSRRGIEPYLVGQTILYAVVRNARLRWPVSDEILTLS
FT                   DQPVLSVQRRAKYLLLELPKGWIIIHLGMSGSLRVLSEETAAEKHDHVDLVVSNGKILR
FT                   YTDPRRFGAWLWAKDLETSNVLAHLGPEPLSDEFTAQYLFDKSRNKRTLIKPWLMDNKV
FT                   VVGVGNIYASESLFAAGILPDRAAGSLTDAESVLLVATIKAVLLHSIEQGGTTLRDFLQ
FT                   SDGKPGYFAQELQVYGRAGEPCRQCGHPIEIAKHGQRSTFFCRHCQH"
FT   misc_feature    63181..63981
FT                   /note="Pfam match to entry PF01149
FT                   Fapy_DNA_glyco,Formamidopyrimidine-DNA glycosylase, score
FT                   473.90, E-value 1.3e-138"
FT                   /inference="protein motif:PF01149"
FT   CDS_pept        complement(63993..64472)
FT                   /transl_table=11
FT                   /gene="coaD"
FT                   /gene_synonym="kdtB"
FT                   /locus_tag="YPO0053"
FT                   /product="phosphopantetheine adenylyltransferase"
FT                   /EC_number="2.7.7.3"
FT                   /note="Similar to Serratia marcescens phosphopantetheine
FT                   adenylyltransferase CoaD SW:COAD_SERMA (Q9X980) (161 aa)
FT                   fasta scores: E(): 0, 82.4% id in 159 aa, and to
FT                   Escherichia coli phosphopantetheine adenylyltransferase
FT                   KdtB SW:COAD_ECOLI (P23875) (159 aa) fasta scores: E():
FT                   0,73.6% id in 159 aa"
FT                   /db_xref="GOA:Q8ZJN9"
FT                   /db_xref="InterPro:IPR001980"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="PDB:3L92"
FT                   /db_xref="PDB:3L93"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZJN9"
FT                   /protein_id="CAL18743.1"
FT                   /translation="MITKAIYPGTFDPITNGHLDLVTRASAMFSHVILAIADSSSKKPM
FT                   FTLDERVALAKKVTAPLKNVEVLGFSELMAEFAKKHNANILVRGLRSVSDFEYEWQLAN
FT                   MNRHLMPKLESVFLIPSEKWSFISSSLVKEVARHGGDITPFLPKPVTKALLAKLA"
FT   misc_feature    complement(64059..64457)
FT                   /note="Pfam match to entry PF01467
FT                   Cytidylyltransf,Cytidylyltransferase, score 158.30, E-value
FT                   1.4e-43"
FT                   /inference="protein motif:PF01467"
FT   CDS_pept        complement(64469..65251)
FT                   /transl_table=11
FT                   /gene="kdtX"
FT                   /gene_synonym="waaE"
FT                   /locus_tag="YPO0054"
FT                   /product="lipopolysaccharide core biosynthesis glycosyl
FT                   transferase"
FT                   /note="Similar to Serratia marcescens lipopolysaccharide
FT                   core biosynthesis glycosyl transferase KdtX SW:KDTX_SERMA
FT                   (Q54435) (257 aa) fasta scores: E(): 0, 76.1% id in 259 aa
FT                   and to Klebsiella pneumoniae lipopolysaccharide core
FT                   biosynthesis glycosyl transferase WaaE SW:WAAE_KLEPN
FT                   (Q9XC90) (258 aa) fasta scores: E(): 0, 70.6% id in 255 aa"
FT                   /db_xref="GOA:A0A384LNE9"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384LNE9"
FT                   /protein_id="CAL18744.1"
FT                   /translation="MGTKKRLSVVMITKNEASLLTDCLASVAWADEIIVLDSGSEDETR
FT                   ALAQQFGAKVYSNINWPGYGKQRQLAQQYASGDYILMLDADERVTPELKIAIESVLLAP
FT                   EEGAVYSCSRRNLFLGRFMRHSGWYPDRVTRLYPHHQYRYNDNLVHESLDSGSAKVIPL
FT                   AGDLLHLTCRDFFAFQRKQLSYAEAWAIQRHQQGKSCSYFAILSHTLGAFSKTWLLRAG
FT                   FLDGKQGLLLAVVNAQYTFNKYAALWALSHQYQKSEKS"
FT   misc_feature    complement(64748..65230)
FT                   /note="Pfam match to entry PF00535 Glycos_transf_2,Glycosyl
FT                   transferases, score 71.00, E-value 2.6e-17"
FT                   /inference="protein motif:PF00535"
FT   CDS_pept        complement(65252..66529)
FT                   /transl_table=11
FT                   /gene="kdtA"
FT                   /gene_synonym="waaA"
FT                   /locus_tag="YPO0055"
FT                   /product="3-deoxy-D-manno-octulosonic-acid transferase"
FT                   /note="Similar to Escherichia coli
FT                   3-deoxy-D-manno-octulosonic-acid transferase KdtA
FT                   SW:KDTA_ECOLI (P23282) (425 aa) fasta scores: E(): 0, 79.8%
FT                   id in 425 aa and to Serratia marcescens KdtA TR:Q54434
FT                   (EMBL:U52844) (425 aa) fasta scores: E(): 0, 88.5% id in
FT                   425 aa"
FT                   /db_xref="GOA:A0A384KS98"
FT                   /db_xref="InterPro:IPR007507"
FT                   /db_xref="InterPro:IPR038107"
FT                   /db_xref="InterPro:IPR039901"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384KS98"
FT                   /inference="protein motif:TMHMM:2.0"
FT                   /inference="similar to sequence:INSDC:U52844"
FT                   /protein_id="CAL18745.1"
FT                   /translation="MLLRLYQVLLYLIQPLIWLRLLLRSRKAPAYRKRWGERYGFCAGK
FT                   VVAGGIMLHSVSVGETLAAIPLVRALRHRYPSLPITVTTMTPTGSERVQSAFGKDVHHV
FT                   YLPYDLPGSVNRFLDQVNPKLVIIMETELWPNLINTLHRRKIPLVIANARLSARSAAGY
FT                   KKIGSFIRTILQRITLIAAQNQEDGDRFIELGLKRSQLTVTGSLKFDISVTPELAARAV
FT                   TLRRQWAPHRPVWIATSTHDGEETILLEAHRQLLQQFPTLLLILVPRHPERFGKAVELT
FT                   QKIGLSYTLRSKGEVPSSSTQVVIGDTMGELMLLYGIADLAFVGGSLVERGGHNPLEAA
FT                   AHAIPVLMGPHTFNFKDICAKLEQAEGLITVTDTLSLVKEITVLLTDEDCRLYYGRHAV
FT                   DVLHENQGALQRLLHLLEPYLPQRSH"
FT   misc_feature    complement(65327..65605)
FT                   /note="Pfam match to entry PF00534 Glycos_transf_1,Glycosyl
FT                   transferases group 1, score 25.70, E-value 6.9e-06"
FT                   /inference="protein motif:PF00534"
FT   misc_feature    complement(66335..66400)
FT                   /gene="kdtA"
FT                   /gene_synonym="waaA"
FT                   /locus_tag="YPO0055"
FT                   /note="one of 2 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    complement(66461..66526)
FT                   /gene="kdtA"
FT                   /gene_synonym="waaA"
FT                   /locus_tag="YPO0055"
FT                   /note="one of 2 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        complement(66949..67914)
FT                   /transl_table=11
FT                   /gene="rfa-2"
FT                   /gene_synonym="rfaC"
FT                   /gene_synonym="waaC"
FT                   /locus_tag="YPO0056"
FT                   /product="lipopolysaccharide heptosyltransferase-1"
FT                   /note="Similar to Escherichia coli lipopolysaccharide core
FT                   biosynthesis heptosyltransferase-1 RfaC SW:RFAC_ECOLI
FT                   (P24173) (319 aa) fasta scores: E(): 0, 68.3% id in 319 aa"
FT                   /db_xref="GOA:A0A384KMM1"
FT                   /db_xref="InterPro:IPR002201"
FT                   /db_xref="InterPro:IPR011908"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384KMM1"
FT                   /protein_id="CAL18746.1"
FT                   /translation="MHVLIVKTSSMGDVLHTLPALTDAMNAIPGIRFDWVVEEGFSQIP
FT                   SWHPAVDKVIPVAIRRWRKNWFGSDTRQERCDFKRVVQQRSYDRVIDAQGLIKSAALIT
FT                   RIAKGTKHGPDCKSAREPFASWFYNCRHEIDTKQHAVERIRQLFAKSLGYDKPESYGDY
FT                   AIAQRFLNQLPADAGQYLVFLHATTRDNKHWPESHWVQLIELVQPTGLKIKLPWGAEHE
FT                   HQRALRLAEHFPHVEVLPKLSLQQVAEVLAGAKAVVSVDTGLSHLTAALDRPNITLFGP
FT                   TDPGLIGGYGKNQIAVISEQKKMDSLSAPTIMARLETLIS"
FT   misc_feature    complement(66964..67692)
FT                   /note="Pfam match to entry PF01075
FT                   Heptosyltranf,Heptosyltransferase, score 312.00, E-value
FT                   7.1e-90"
FT                   /inference="protein motif:PF01075"
FT   CDS_pept        complement(67914..68978)
FT                   /transl_table=11
FT                   /gene="rfaF"
FT                   /gene_synonym="waaF"
FT                   /locus_tag="YPO0057"
FT                   /product="ADP-heptose--LPS heptosyltransferase II"
FT                   /note="Similar to Escherichia coli ADP-heptose--LPS
FT                   heptosyltransferase II RfaF, involved in LPS core
FT                   biosynthesis, SW:RFAF_ECOLI (P37692) (348 aa) fasta scores:
FT                   E(): 0, 73.8% id in 347 aa"
FT                   /db_xref="GOA:Q0WKN5"
FT                   /db_xref="InterPro:IPR002201"
FT                   /db_xref="InterPro:IPR011910"
FT                   /db_xref="UniProtKB/TrEMBL:Q0WKN5"
FT                   /protein_id="CAL18747.1"
FT                   /translation="MKILVIGPSWVGDMMMSQSLYRTLKAEYPAADIDVMAPAWCRPLL
FT                   ARMPEVRHAIPMPLGHGAFAFEERRRLGLALRETEYDRAYVLPNSFKSALIPYFSGIKR
FT                   RIGWRGEMRYFLLNDLRILDKQAFPMMVQRYVALAYDKERIRSAADLPQPLLWPQLQVR
FT                   DEEIAETTASFNLTDNRPIIGFCPGAEFGPAKRWPHYHYATLAQKLIDDGYQVILFGSA
FT                   KDNEAGEDIRQALSDTDREYCLNLAGQTSLEQAVVLIAACSAVVSNDSGLMHVAAALNK
FT                   PLVALYGPSSPDFTPPLSEKATVIRLITGYHKVRKGDSAQGYHQSLIDIQPEHVMAALE
FT                   KQLATQECSVKGGD"
FT   misc_feature    complement(68007..68774)
FT                   /note="Pfam match to entry PF01075
FT                   Heptosyltranf,Heptosyltransferase, score 371.70, E-value
FT                   7.4e-108"
FT                   /inference="protein motif:PF01075"
FT   CDS_pept        complement(69009..69941)
FT                   /transl_table=11
FT                   /gene="htrM"
FT                   /gene_synonym="rfaD"
FT                   /locus_tag="YPO0058"
FT                   /product="ADP-L-glycero-D-manno-heptose-6-epimerase"
FT                   /EC_number="5.1.3.20"
FT                   /note="Similar to Escherichia coli
FT                   ADP-L-glycero-D-manno-heptose-6-epimerase RfaD, involved in
FT                   lipopolysaccharide biosynthesis SW:RFAD_ECOLI (P17963) (310
FT                   aa) fasta scores: E(): 0, 83.1% id in 308 aa"
FT                   /db_xref="GOA:Q8ZJN4"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR011912"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZJN4"
FT                   /protein_id="CAL18748.1"
FT                   /translation="MIIVTGGAGFIGSNIVKALNNIGYKDILVVDNLKDGTKFVNLVDL
FT                   DIADYMDKEDFVASIVAGDDMGDIDAIFHEGACSSTTEWDGKYMMDNNYQYSKDILHFC
FT                   LDRSIPFLYASSAATYGGRTDNFIEDRQYEQPLNVYGYSKFLFDQYVREILPQADSQIC
FT                   GFRYFNVYGPREGHKGSMASVAFHLNNQINAGERPKLFAGSENFKRDFIYVGDVADVNL
FT                   WFWQNGVSGIFNCGTGRAESFQAVADAVVDYHQSGPVEYIEFPEKLKGRYQAYTQADLT
FT                   KLRAAGYGKPFKTVAEGVKEYLAWLNRSV"
FT   misc_feature    complement(69012..69938)
FT                   /note="Pfam match to entry PF01370 Epimerase, NAD dependent
FT                   epimerase/dehydratase family, score 13.20, E-value 4.9e-13"
FT                   /inference="protein motif:PF01370"
FT   CDS_pept        70187..71398
FT                   /transl_table=11
FT                   /gene="kbl"
FT                   /locus_tag="YPO0059"
FT                   /product="2-amino-3-ketobutyrate coenzyme A ligase"
FT                   /EC_number="2.3.1.29"
FT                   /note="Similar to Escherichia coli 2-amino-3-ketobutyrate
FT                   coenzyme A ligase Kbl SW:KBL_ECOLI (P07912) (398 aa) fasta
FT                   scores: E(): 0, 84.8% id in 394 aa"
FT                   /db_xref="GOA:A0A384KV81"
FT                   /db_xref="InterPro:IPR001917"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR011282"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384KV81"
FT                   /protein_id="CAL18749.1"
FT                   /translation="MSLPCNKHPFYQQLEQQLDTTRTEGLYKNERVITSAQQANIAVAD
FT                   GSRVINFCANNYLGLANHPKLIAAAKAGMDSHGFGMASVRFICGTQDIHKELEHKLASF
FT                   LGMEDAILYSSCFDANGGLFETLLGPEDAIISDALNHASIIDGVRLCKAKRYRYANNDM
FT                   TELEAQLKQAKAEGARHIMIATDGVFSMDGVIANLKRVCDLADEYQALVMVDDSHAVGV
FT                   IGANGRGTHEYCEVMDRVDIITGTLGKALGGASGGYTAGRKELVEWLRQRSRPYLFSNS
FT                   LAPAIVAASIEVLSLLEEGGALRDRLWANARLFREKMSAAGFTLAGADHAIIPVMLGEA
FT                   KLAQDFANALLKEGIYVTGFFFPVVPKGQARIRTQMSAGHTTEQVERAIEAFVRIGKQL
FT                   NVIA"
FT   misc_feature    70451..71305
FT                   /note="Pfam match to entry PF00222
FT                   aminotran_2,Aminotransferases class-II, score 427.90,
FT                   E-value 8.9e-125"
FT                   /inference="protein motif:PF00222"
FT   misc_feature    70922..70951
FT                   /note="PS00599 Aminotransferases class-II
FT                   pyridoxal-phosphate attachment site."
FT                   /inference="protein motif:ProSite:PS00599"
FT   CDS_pept        71408..72433
FT                   /transl_table=11
FT                   /gene="tdh"
FT                   /locus_tag="YPO0060"
FT                   /product="threonine 3-dehydrogenase"
FT                   /EC_number="1.1.1.103"
FT                   /note="Similar to Escherichia coli threonine
FT                   3-dehydrogenase Tdh SW:TDH_ECOLI (P07913) (341 aa) fasta
FT                   scores: E(): 0, 92.1% id in 341 aa"
FT                   /db_xref="GOA:Q8ZJN2"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR004627"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZJN2"
FT                   /protein_id="CAL18750.1"
FT                   /translation="MKALSKLKAEEGIWMTDVPQPELGHNDIMIKIRKTAICGTDVHIY
FT                   NWDEWSQKTIPVPMVVGHEYVGEVVAIGQEVKGFNIGDRVSGEGHITCGHCRNCRGGRT
FT                   HLCRNTVGVGVNRPGSFAEYLVIPAFNAFKIPDNISDELAAIFDPFGNAVHTALSFDLV
FT                   GEDVLVSGAGPIGIMAAAVCKHVGARHVVIADVNEYRLDLARKMGVTRAVNVSKENLND
FT                   VMTELGMTEGFDVGLEMSGAPPAFRSLLNSMNHGGRIAMLGIPPSDMSIDWNQVIFKGL
FT                   FIKGIYGREMFETWYKMAALIQSGLDLTPIITHRFPIDEFQQGFDAMRSGKSGKVVLSW
FT                   D"
FT   misc_feature    71441..72427
FT                   /note="Pfam match to entry PF00107 adh_zinc, Zinc-binding
FT                   dehydrogenases, score 370.40, E-value 1.8e-107"
FT                   /inference="protein motif:PF00107"
FT   misc_feature    71591..71635
FT                   /note="PS00059 Zinc-containing alcohol dehydrogenases
FT                   signature."
FT                   /inference="protein motif:ProSite:PS00059"
FT   CDS_pept        complement(72571..73370)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="YPO0061"
FT                   /product="conserved hypothetical protein (pseudogene)"
FT                   /note="Similar to Escherichia coli hypothetical 30.7 kDa
FT                   protein YibQ SW:YIBQ_ECOLI (P37691) (277 aa) fasta scores:
FT                   E(): 4.2e-22, 58.5% id in 265 aa. Is likely to have
FT                   undergone a deletion event which has also lead to a shift
FT                   in reading frame (after aa 97)."
FT   CDS_pept        complement(73529..74881)
FT                   /transl_table=11
FT                   /locus_tag="YPO0063"
FT                   /product="putative membrane protein"
FT                   /note="Similar to many proteins of unknown function e.g.
FT                   Escherichia coli hypothetical 46.6 kDa protein in secB-tdh
FT                   intergenic region, YibP SW:YIBP_ECOLI (P37690) (419 aa)
FT                   fasta scores: E(): 0, 63.2% id in 418 aa"
FT                   /db_xref="GOA:Q0WKN1"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="UniProtKB/TrEMBL:Q0WKN1"
FT                   /protein_id="CAL18752.1"
FT                   /translation="MAKSITTKDAVSDGRESPSLLSDKLSRLPWSTLYASVFCAGVLLL
FT                   PFSGQAVEPPVAAKASENKNQLKTLQQDIAEKEKSVQQQKKQRSSLLDQLKQQENTISQ
FT                   TSRSLRETQAALAELSKDIASLTTSIEKLQNQQSQQQSILSKQLAAAFKQGKHSSLQLI
FT                   LSGEESQRSERILAYFSYLNEARQKAIEELKQTRTTLSAEKKMLEQKQNQHKALLDEQK
FT                   AQQQKLEQARIARQKTLTSLEASLEKDQQSLAELKLNESRLRDQIAKAEREAKARAERE
FT                   AKEAARVREQVKVKEQQAKKTGSSYKPSESERSLMARTGGLGRPGGQALWPVRGNVSHR
FT                   FGEPLQGELRWKGMVITAPEGSEVKAIADGRVLLADWLQGYGLVVVIEHGKGDMSLYGY
FT                   NQSALVNVGAQVKAGQPIALVGTSGGQGEPSLYFEIRRQGQAVNPQPWLGR"
FT   misc_feature    complement(73541..73789)
FT                   /note="Pfam match to entry PF01551 Peptidase_M37, Peptidase
FT                   family M23/M37, score 120.60, E-value 2.8e-32"
FT                   /inference="protein motif:PF01551"
FT   CDS_pept        complement(74909..76456)
FT                   /transl_table=11
FT                   /locus_tag="YPO0064"
FT                   /product="2,3-bisphosphoglycerate-independent
FT                   phosphoglycerate mutase"
FT                   /EC_number="5.4.2.1"
FT                   /note="Similar to Escherichia coli
FT                   2,3-bisphosphoglycerate-independent phosphoglycerate mutase
FT                   YibO SW:PMGI_ECOLI (P37689) (514 aa) fasta scores: E():
FT                   0,83.3% id in 515 aa"
FT                   /db_xref="GOA:Q8ZJN0"
FT                   /db_xref="InterPro:IPR005995"
FT                   /db_xref="InterPro:IPR006124"
FT                   /db_xref="InterPro:IPR011258"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="InterPro:IPR036646"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZJN0"
FT                   /protein_id="CAL18753.1"
FT                   /translation="MSSTKKPLVLTILDGYGHREEQQDNAILNAKTPVMDVLWQQQPHT
FT                   LIAASGLDVGLPDGQMGNSEVGHVNLGAGRIVYQDLTRLDKEIKEGDFFTNPTLTAAVD
FT                   NAVKTGKAVHIMGLLSAGGVHSHEDHIMAMVELAAKRGATAIYLHAFLDGRDTPPRSAE
FT                   SSLKRFTAKFAELGNGRIASIIGRYYAMDRDNRWDRVQLAYDLLTQAKGEFTADNAVAG
FT                   LQAAYARGENDEFVKPTVIQATGEADAAMNEGDTLIFMNFRADRARQITRTFVNAEFDG
FT                   FKRDKVVNFGDFIMLTEYAADIKVACAYPPASLTNTFGEWLMKHDKTQLRISETEKYAH
FT                   VTFFYNGGVEEPFKGEDRILINSPKVATYDLQPEMSSAELTEKLVSAIGSGKYDVIICN
FT                   YPNGDMVGHTGDYDAAVKAVETLDNCIEQVVAAVKAADGQLLITADHGNAEQMRDPATG
FT                   QAHTAHTSLPVPLIYVGNKAVKAVEGGKLSDIAPTMLSLMEMEIPQEMTGKPLFIVE"
FT   misc_feature    complement(74987..75337)
FT                   /note="Pfam match to entry PF01676
FT                   Metalloenzyme,Metalloenzyme superfamily, score 185.20,
FT                   E-value 1e-51"
FT                   /inference="protein motif:PF01676"
FT   CDS_pept        76853..77287
FT                   /transl_table=11
FT                   /locus_tag="YPO0065"
FT                   /product="putative membrane protein"
FT                   /note="Similar to Escherichia coli hypothetical protein
FT                   YibN SW:YIBN_ECOLI (P37688) (143 aa) fasta scores: E():
FT                   0,65.7% id in 143 aa"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384L1D1"
FT                   /protein_id="CAL18754.1"
FT                   /translation="MLQEIMQFISQHPILSLAWVLLFGAVVFTSFKNSLSKVKEVTRGE
FT                   ATRLINKEDAVVVDIRTREDYRKGHIANSINLIPSDIKNGNLGELEKHKTQPIIVVCAM
FT                   GTTSRASADMLSKAGFERVFTLKEGISGWSGENLPLARGK"
FT   misc_feature    76889..76945
FT                   /note="1 probable transmembrane helix predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    76976..77260
FT                   /note="Pfam match to entry PF00581 Rhodanese,Rhodanese-like
FT                   domain, score 76.30, E-value 6.4e-19"
FT                   /inference="protein motif:PF00581"
FT   CDS_pept        77406..77654
FT                   /transl_table=11
FT                   /gene="grxC"
FT                   /locus_tag="YPO0066"
FT                   /product="glutaredoxin"
FT                   /note="Similar to Escherichia coli glutaredoxin 3 GrxC
FT                   SW:GLR3_ECOLI (P37687) (82 aa) fasta scores: E():
FT                   1.9e-27,77.8% id in 81 aa"
FT                   /db_xref="GOA:Q0WKM8"
FT                   /db_xref="InterPro:IPR002109"
FT                   /db_xref="InterPro:IPR011767"
FT                   /db_xref="InterPro:IPR011900"
FT                   /db_xref="InterPro:IPR014025"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q0WKM8"
FT                   /protein_id="CAL18755.1"
FT                   /translation="MAKIEMYTKATCPFCHRAKALLNAKGAAFHEIAIDNDPAKREEMI
FT                   ARSGRTTVPQIFIDGQHIGGCDDLHALDARGGLDPLL"
FT   misc_feature    77412..77585
FT                   /note="Pfam match to entry PF00462
FT                   glutaredoxin,Glutaredoxin, score 79.20, E-value 8.4e-20"
FT                   /inference="protein motif:PF00462"
FT   CDS_pept        77742..78218
FT                   /transl_table=11
FT                   /gene="secB"
FT                   /locus_tag="YPO0067"
FT                   /product="protein-export protein"
FT                   /note="Similar to Escherichia coli protein-export protein
FT                   SecB SW:SECB_ECOLI (P15040) (155 aa) fasta scores: E():
FT                   0,91.8% id in 158 aa"
FT                   /db_xref="GOA:Q8ZJM7"
FT                   /db_xref="InterPro:IPR003708"
FT                   /db_xref="InterPro:IPR035958"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZJM7"
FT                   /protein_id="CAL18756.1"
FT                   /translation="MSEQNNTEMAFQIQRIYTKDISFEAPNAPQVFQQDWQPEVKLDLD
FT                   TASSQLAEDVYEVVLRVTVTASLGEETAFLCEVQQGGIFSVAGIEGTQLAHCLGAYCPN
FT                   ILFPYARECITSLVSRGTFPQLNLAPVNFDALFMNYLQQQAEGEVEGVEQRQDA"
FT   CDS_pept        78218..79237
FT                   /transl_table=11
FT                   /gene="gpsA"
FT                   /locus_tag="YPO0068"
FT                   /product="glycerol-3-phosphate dehydrogenase"
FT                   /EC_number="1.1.1.8"
FT                   /note="Similar to Escherichia coli glycerol-3-phosphate
FT                   dehydrogenase [NAD+] GpsA SW:GPDA_ECOLI (P37606) (339 aa)
FT                   fasta scores: E(): 0, 84.5% id in 336 aa"
FT                   /db_xref="GOA:Q8ZJM6"
FT                   /db_xref="InterPro:IPR006109"
FT                   /db_xref="InterPro:IPR006168"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR011128"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZJM6"
FT                   /protein_id="CAL18757.1"
FT                   /translation="MNTNPASMAVIGAGSYGTALAITLARNGHQVVLWGHDPKHIQQLQ
FT                   QDRCNRAFLPDAAFPDTLRLETDLACALAASRDVLVVVPSHVFGAVLHQLKPHLRKDAR
FT                   IVWATKGLEAETGRLLQDVAREVLGEAIPLAVISGPTFAKELAAGLPTAIALASTDVQF
FT                   SEDLQQLLHCGKSFRVYSNPDFIGVQLGGAVKNVIAIGAGMSDGIGFGANARTALITRG
FT                   LAEMTRLGTALGADPSTFMGMAGLGDLVLTCTDNQSRNRRFGIMLGQGLGVKEAQDNIG
FT                   QVVEGYRNTKEVLALAQRHGVEMPITEQIYQVLYCHKNAREAALTLLGRTKKDEKIGI"
FT   misc_feature    78230..79198
FT                   /note="Pfam match to entry PF01210
FT                   NAD_Gly3P_dh,NAD-dependent glycerol-3-phosphate
FT                   dehydrogenase, score 553.10, E-value 1.9e-162"
FT                   /inference="protein motif:PF01210"
FT   misc_feature    78791..78856
FT                   /note="PS00957 NAD-dependent glycerol-3-phosphate
FT                   dehydrogenase signature."
FT                   /inference="protein motif:ProSite:PS00957"
FT   CDS_pept        79297..79437
FT                   /transl_table=11
FT                   /locus_tag="YPO0069"
FT                   /product="hypothetical protein"
FT                   /note="No significant database hits"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384KXN4"
FT                   /protein_id="CAL18758.1"
FT                   /translation="MELQQGSKRAYPDELIHVSDSGGREPLMLIITKSIVTIINRNSAT
FT                   A"
FT   CDS_pept        79503..80324
FT                   /transl_table=11
FT                   /gene="cysE"
FT                   /locus_tag="YPO0070"
FT                   /product="serine acetyltransferase"
FT                   /EC_number="2.3.1.30"
FT                   /note="Similar to Escherichia coli serine acetyltransferase
FT                   CysE involved in cysteine biosynthesis SW:CYSE_ECOLI
FT                   (P05796) (273 aa) fasta scores: E(): 0, 86.1% id in 273 aa"
FT                   /db_xref="GOA:A0A384KMH6"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005881"
FT                   /db_xref="InterPro:IPR010493"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR042122"
FT                   /db_xref="PDB:3GVD"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384KMH6"
FT                   /protein_id="CAL18759.1"
FT                   /translation="MSSEELEQVWSNIKSEARALAECEPMLASFFHATLLKHENLGSAL
FT                   SYILANKLANPIMPAIAIREVVEEAYRSDAHMIVSAARDILAVRLRDPAVDKYSTPLLY
FT                   LKGFHALQAYRIGHWLWAQDRKALAIYLQNQVSVAFGVDIHPAATIGCGIMLDHATGIV
FT                   IGETAVVENDVSILQSVTLGGTGKTSGDRHPKIREGVMIGAGAKILGNIEVGRGAKIGA
FT                   GSVVLQSVPAHTTAAGVPARIVGKPESDKPSLDMDQHFNGSIQGFEYGDGI"
FT   misc_feature    79905..79958
FT                   /note="Pfam match to entry PF00132 hexapep, Bacterial
FT                   transferase hexapeptide (four repeats), score 4.50, E-value
FT                   1.9e+02"
FT                   /inference="protein motif:PF00132"
FT   misc_feature    80001..80054
FT                   /note="Pfam match to entry PF00132 hexapep, Bacterial
FT                   transferase hexapeptide (four repeats), score 10.40,E-value
FT                   30"
FT                   /inference="protein motif:PF00132"
FT   misc_feature    80079..80132
FT                   /note="Pfam match to entry PF00132 hexapep, Bacterial
FT                   transferase hexapeptide (four repeats), score 9.40, E-value
FT                   41"
FT                   /inference="protein motif:PF00132"
FT   misc_feature    80106..80192
FT                   /note="PS00101 Hexapeptide-repeat containing-transferases
FT                   signature."
FT                   /inference="protein motif:ProSite:PS00101"
FT   misc_feature    80133..80186
FT                   /note="Pfam match to entry PF00132 hexapep, Bacterial
FT                   transferase hexapeptide (four repeats), score 11.90,E-value
FT                   16"
FT                   /inference="protein motif:PF00132"
FT   CDS_pept        complement(80447..80935)
FT                   /transl_table=11
FT                   /locus_tag="YPO0071"
FT                   /product="putative methyltransferase"
FT                   /note="Similar to Escherichia coli hypothetical tRNA/rRNA
FT                   methyltransferase YibK SW:YIBK_ECOLI (P33899) (157 aa)
FT                   fasta scores: E(): 0, 80.2% id in 162 aa and to Neisseria
FT                   meningitidis RNA methyltransferase NMB0268 TR:Q9K199
FT                   (EMBL:AE002383) (154 aa) fasta scores: E(): 0, 61.0% id in
FT                   159 aa"
FT                   /db_xref="GOA:Q74Y93"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR016914"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="PDB:3N4J"
FT                   /db_xref="PDB:3N4K"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q74Y93"
FT                   /inference="similar to sequence:INSDC:AE002383"
FT                   /protein_id="CAL18760.1"
FT                   /translation="MLNIVLFEPEIPPNTGNIIRLCANTGCQLHLIKPLGFTWDDKRLR
FT                   RAGLDYHEFADIKHHHDYQAFLDSEKLDSTQPARLFALTTKGTPAHSAVSYQANDYLLF
FT                   GPETRGLPAYILDALPAQQKIRIPMQADSRSMNLSNAVSVVVYEAWRQLGYPGALLKE"
FT   misc_feature    complement(80495..80935)
FT                   /note="Pfam match to entry PF00588 SpoU_methylase, SpoU
FT                   rRNA Methylase family, score 182.80, E-value 5.7e-51"
FT                   /inference="protein motif:PF00588"
FT   CDS_pept        81124..82188
FT                   /transl_table=11
FT                   /locus_tag="YPO0072"
FT                   /product="bifunctional regulatory protein/DNA repair
FT                   protein"
FT                   /EC_number="2.1.1.63"
FT                   /note="Similar to Escherichia coli Ada regulatory protein
FT                   of the adaptive response, involved in DNA repair and global
FT                   regulation SW:ADA_ECOLI (P06134) (354 aa) fasta scores:
FT                   E(): 0, 52.8% id in 345 aa"
FT                   /db_xref="GOA:A0A384KG00"
FT                   /db_xref="InterPro:IPR001497"
FT                   /db_xref="InterPro:IPR004026"
FT                   /db_xref="InterPro:IPR008332"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR014048"
FT                   /db_xref="InterPro:IPR016221"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR035451"
FT                   /db_xref="InterPro:IPR036217"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036631"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384KG00"
FT                   /protein_id="CAL18761.1"
FT                   /translation="MNNVKDPRWAAIINRDKTADGQFVYAVKTTGIYCRPSCPSRRAKA
FT                   ENIEFFIDNTAAEQAGYRPCKRCQPTQLSRAQQQVEKISQACRLIELAETPPKLNELAA
FT                   QLGLSTFYFHRLFKAITGLTPKGYANATRSERIRAQLSHGGSVTDAIFEAGYNSSSRFY
FT                   AQSQQLLGMTPTRYRKGGCDARLHFAVGESSLGAILVAKSELGVCAILLGDDPVRLVQQ
FT                   LQDKFPQANLVGGDAEFEQWVAQVVGCVEAPKLGLNLPLDIRGTAFQQRVWQALREIPI
FT                   GETASYADIASRIGSPTAVRAVAGACAANILAVAIPCHRVIRQDGALSGYRWGVERKRL
FT                   LLEREGVEKEAEDH"
FT   misc_feature    81367..81498
FT                   /note="PS00041 Bacterial regulatory proteins, araC family
FT                   signature."
FT                   /inference="protein motif:ProSite:PS00041"
FT   misc_feature    81409..81666
FT                   /note="Pfam match to entry PF00165 HTH_AraC, Bacterial
FT                   regulatory helix-turn-helix proteins, araC family, score
FT                   76.50, E-value 5.3e-19"
FT                   /inference="protein motif:PF00165"
FT   misc_feature    81412..81477
FT                   /note="Predicted helix-turn-helix motif with score 1162
FT                   (+3.14 SD) at aa 97-118, sequence PKLNELAAQLGLSTFYFHRLFK"
FT   misc_feature    81841..82173
FT                   /note="Pfam match to entry PF01035
FT                   Methyltransf_1,6-O-methylguanine DNA methyltransferase,
FT                   score 179.70,E-value 4.7e-50"
FT                   /inference="protein motif:PF01035"
FT   misc_feature    82069..82089
FT                   /note="PS00374 Methylated-DNA--protein-cysteine
FT                   methyltransferase active site."
FT                   /inference="protein motif:ProSite:PS00374"
FT   CDS_pept        complement(82237..83613)
FT                   /transl_table=11
FT                   /gene="cpxA"
FT                   /locus_tag="YPO0073"
FT                   /product="two component sensor kinase"
FT                   /EC_number="2.7.3.-"
FT                   /note="Similar to Escherichia coli two component sensor
FT                   kinase, CpxA SW:CPXA_ECOLI (P08336) (457 aa) fasta scores:
FT                   E(): 0, 80.8% id in 454 aa"
FT                   /db_xref="GOA:A0A0H2W0U8"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR032404"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR038515"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2W0U8"
FT                   /inference="protein motif:TMHMM:2.0"
FT                   /protein_id="CAL18762.1"
FT                   /translation="MINSLTTRIFAIFWFTLALVLMLVLMVPKLDSRQLTVLLDSEQRQ
FT                   GTMLEQHIEAELANDPANDLMWWRRLHRAIEKWAPPGQHLILVTSEGRIIGVQRQEVQM
FT                   VRNFIGQSDNADQPKKKKYGRVEMVGPFSIRDGEDNYQLYLIRPANSPQSDFINLMFDR
FT                   PLLLLIATMLISAPLLLWLAWSLAKPARKLKNAADDVARGNLKQHPELESGPQEFLATG
FT                   ASFNQMISSLDRMVVAQQRLISDISHELRTPLTRLQLATALMRRRHGEGKELERIEMEA
FT                   QRLDSMINDLLVLSRSQHKNELHREPIKADELWSDVLENAQFEAEQMGKTLVVTAPPGP
FT                   WPLFCNPAALDSALENIVRNALRYSHHHIAVAFSIDNQGVTIIVDDDGPGVSPEDREQI
FT                   FRPFYRTDEARDRASGGTGLGLAIVETAVSQHRGWVKAEDSPLGGLRLIVWLPLHPLKS
FT                   "
FT   misc_feature    complement(82258..82872)
FT                   /note="Pfam match to entry PF00512 signal, Histidine
FT                   kinase, score 242.80, E-value 4.8e-69"
FT                   /inference="protein motif:PF00512"
FT   misc_feature    complement(82912..83124)
FT                   /note="Pfam match to entry PF00672 DUF5, HAMP domain, score
FT                   58.70, E-value 1.3e-13"
FT                   /inference="protein motif:PF00672"
FT   misc_feature    complement(83053..83118)
FT                   /gene="cpxA"
FT                   /locus_tag="YPO0073"
FT                   /note="one of 2 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    complement(83533..83598)
FT                   /gene="cpxA"
FT                   /locus_tag="YPO0073"
FT                   /note="one of 2 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        complement(83610..84308)
FT                   /transl_table=11
FT                   /gene="cpxR"
FT                   /locus_tag="YPO0074"
FT                   /product="two component system response regulatory protein"
FT                   /note="Similar to Escherichia coli two component system
FT                   response regulatory protein CpxR SW:CPXR_ECOLI (P16244)
FT                   (232 aa) fasta scores: E(): 0, 89.7% id in 232 aa"
FT                   /db_xref="GOA:A0A384KAY5"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384KAY5"
FT                   /protein_id="CAL18763.1"
FT                   /translation="MHKILLVDDDRELTSLLKELLEMEGFNVVVAYDGEQALSQLDSSI
FT                   DLLLLDIMMPRKNGIETLKELRQHHQTPVIMLTARGSELDRVLGLELGADDYLAKPFND
FT                   RELVARIRAILRRSNWSEQQQNAEQGAPTLEVDCLQLNPGRQEASFEGQPLELTGTEFT
FT                   LLYLLAQHLGQVVSREHLSQEVLGKRLTPFDRAIDMHISNLRRKLPDRKDGLPWFKTLR
FT                   GRGYLMVSET"
FT   misc_feature    complement(83634..83852)
FT                   /note="Pfam match to entry PF00486
FT                   trans_reg_C,Transcriptional regulatory protein, C terminal,
FT                   score 112.90, E-value 1.8e-32"
FT                   /inference="protein motif:PF00486"
FT   misc_feature    complement(83976..84305)
FT                   /note="Pfam match to entry PF00072 response_reg, Response
FT                   regulator receiver domain, score 150.30, E-value 3.4e-41"
FT                   /inference="protein motif:PF00072"
FT   CDS_pept        84482..84970
FT                   /transl_table=11
FT                   /gene="cpxP"
FT                   /locus_tag="YPO0075"
FT                   /product="putative exported protein"
FT                   /note="Similar to Escherichia coli periplasmic protein CpxP
FT                   precursor involved in detoxification of extracytoplasmic
FT                   proteins: SW:CPXP_ECOLI (P32158) (166 aa) fasta scores:
FT                   E(): 6.8e-23, 52.5% id in 162 aa"
FT                   /db_xref="GOA:A0A384K9Y3"
FT                   /db_xref="InterPro:IPR012899"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384K9Y3"
FT                   /protein_id="CAL18764.1"
FT                   /translation="MRKVTTLVMASMFVLGSSAAFAADNTKVTEGYHGDGKMMMNKKGD
FT                   RGHHNMFDGINLTEQQRQQMRDLMRQSHQSQPRLDLEDREAMHKLITADKFDEAAVRAQ
FT                   AEKMSQNQIERHVEMAKVRNQMYNLLTPEQKEALNKKHQERIEKLQQKPAAQPSSAQK"
FT   CDS_pept        85648..86607
FT                   /transl_table=11
FT                   /locus_tag="YPO0076"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Salmonella typhimurium hypothetical
FT                   protein SW:YTL2_SALTY (P37415) (313 aa) fasta scores: E():
FT                   0, 62.3% id in 308 aa and to Yersinia pestis putative
FT                   transposase Y1072, located on plasmid pMT1, TR:O68786
FT                   (EMBL:AF074611) (328 aa) fasta scores: E(): 0, 59.0% id in
FT                   312 aa"
FT                   /db_xref="InterPro:IPR006842"
FT                   /db_xref="InterPro:IPR010106"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384KBM0"
FT                   /inference="similar to sequence:INSDC:AF074611"
FT                   /protein_id="CAL18765.1"
FT                   /translation="MIAQEDAHDYHRPMKTTPTPHDALFKNFMTQPATACDLLEFHLPP
FT                   ELRQLCDLSTLRLESGSFIENNLRACYSDVLYSLKTTVGDGYVYALIEHQSSPDKHMAF
FT                   RLMRYAIAAMQSHLEAGYDKLPLVIPILFYHGMVTPYPYPMSWLHAFNQPELAGQLYCG
FT                   NFPLVDVTVIPDHEIMTHRRIALLELLQKHIRQRDLSELLDQLVILIASGYTTEDQLKS
FT                   AINYIIQVGETAEPEVFIRSLAHRLPEHEESLMTIAQKLEQKGEARGIVKGRVEGRVEG
FT                   AQETALKIARTMLANGLDRATVMKMTGLSEEELTQIHH"
FT   CDS_pept        87169..88071
FT                   /transl_table=11
FT                   /locus_tag="YPO0077"
FT                   /product="putative integral membrane protein"
FT                   /note="Similar to several proteins of undefined function
FT                   e.g. Vibrio cholerae hypothetical protein Vc2690 TR:Q9KNP1
FT                   (EMBL:AE004334) (302 aa) fasta scores: E(): 0, 62.1% id in
FT                   290 aa. Also similar to several putative efflux proteins
FT                   e.g. Bacillus halodurans cation efflux system BH1238
FT                   TR:Q9KDH5 (EMBL:AP001511) (300 aa) fasta scores: E():
FT                   7.5e-17, 27.4% id in 296 aa"
FT                   /db_xref="GOA:Q8ZJL7"
FT                   /db_xref="InterPro:IPR002524"
FT                   /db_xref="InterPro:IPR023783"
FT                   /db_xref="InterPro:IPR027469"
FT                   /db_xref="InterPro:IPR027470"
FT                   /db_xref="InterPro:IPR036837"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZJL7"
FT                   /inference="protein motif:TMHMM:2.0"
FT                   /inference="similar to sequence:INSDC:AE004334"
FT                   /inference="similar to sequence:INSDC:AP001511"
FT                   /protein_id="CAL18766.1"
FT                   /translation="MDPQYARWVKAAALSATALASILLIIKIFAWWHTGSVSLLAALVD
FT                   SLVDLAASLTNLFVVRYSLQPADEEHTFGHGKAESLAALAQSMFISGSALFLFLTGFRH
FT                   LASPEPLQDPSIGIGVTLVALFSTLILVTFQRWVVRKTHSQAIRADMLHYQSDVLMNGA
FT                   ILIALALSWYGFRRADALFALGIGVYILYSALRMGYEAVQSLLDRALPDDERQQIIDIV
FT                   TSWPGVIGAHDLRTRRSGQTRFIQLHLEMEDMMPLMEAHVLAEQVEHALLYRFPGADVL
FT                   IHQDPCSVVPKERHAHWEL"
FT   misc_feature    87202..87270
FT                   /locus_tag="YPO0077"
FT                   /note="one of 6 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    87280..87348
FT                   /locus_tag="YPO0077"
FT                   /note="one of 6 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    87364..88035
FT                   /note="Pfam match to entry PF01545 Cation_efflux, Cation
FT                   efflux family, score 254.70, E-value 1.3e-72"
FT                   /inference="protein motif:PF01545"
FT   misc_feature    87406..87474
FT                   /locus_tag="YPO0077"
FT                   /note="one of 6 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    87517..87585
FT                   /locus_tag="YPO0077"
FT                   /note="one of 6 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    87640..87693
FT                   /locus_tag="YPO0077"
FT                   /note="one of 6 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    87706..87765
FT                   /locus_tag="YPO0077"
FT                   /note="one of 6 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        88289..89272
FT                   /transl_table=11
FT                   /gene="pfkA"
FT                   /locus_tag="YPO0078"
FT                   /product="6-phosphofructokinase"
FT                   /EC_number="2.7.1.11"
FT                   /note="Similar to Escherichia coli 6-phosphofructokinase
FT                   isozyme I PfkA SW:K6P1_ECOLI (P06998) (320 aa) fasta
FT                   scores: E(): 0, 75.2% id in 327 aa"
FT                   /db_xref="GOA:Q8ZJL6"
FT                   /db_xref="InterPro:IPR000023"
FT                   /db_xref="InterPro:IPR012003"
FT                   /db_xref="InterPro:IPR012828"
FT                   /db_xref="InterPro:IPR015912"
FT                   /db_xref="InterPro:IPR022953"
FT                   /db_xref="InterPro:IPR035966"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZJL6"
FT                   /protein_id="CAL18767.1"
FT                   /translation="MVKKIGVLTSGGDAPGMNAAIRGVVRAALSAGLDVFGIEDGYLGL
FT                   YENRMKKLDRYSVSDMINRGGTFLGSARFPEFRDPEVRKVALKNMHERGIDGLVVIGGD
FT                   GSYAGADLLTKEGGIHCVGLPGTIDNDVAGTDYTIGFFTALETVVEAIDRLRDTSSSHQ
FT                   RISIVEVMGRYCGDLTLAAAIAGGCEFIAIPEVEFKRDDLVAEIKAGIAKGKKHAIVAI
FT                   TEKLDDIDSLAKYIEKETGRETRGTVLGHIQRGGAPVAYDRILASRMGAYAVDLLLQDH
FT                   DYKKGGFCVGVQNEKMVHELISVCIAPENKKSKFKEDWYDTAKKLF"
FT   misc_feature    88295..89125
FT                   /note="Pfam match to entry PF00365 PFK,Phosphofructokinase,
FT                   score 606.70, E-value 7.4e-222"
FT                   /inference="protein motif:PF00365"
FT   misc_feature    89021..89077
FT                   /note="PS00433 Phosphofructokinase signature."
FT                   /inference="protein motif:ProSite:PS00433"
FT   CDS_pept        89493..90482
FT                   /transl_table=11
FT                   /gene="sbp1"
FT                   /locus_tag="YPO0079"
FT                   /product="exported sulfate-binding protein"
FT                   /note="Similar to Escherichia coli sulfate-binding protein
FT                   precursor Sbp involved in sulphate transport: SW:SUBI_ECOLI
FT                   (P06997) (329 aa) fasta scores: E(): 0, 83.3% id in 329 aa"
FT                   /db_xref="GOA:A0A384LQ14"
FT                   /db_xref="InterPro:IPR005669"
FT                   /db_xref="InterPro:IPR034408"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384LQ14"
FT                   /protein_id="CAL18768.1"
FT                   /translation="MRKWGVGLSLLVLASGAMAKDIQLLNVSYDPTREFYQEYNQAFSK
FT                   YWQQQTGDKVTVRQSHGGSGKQATSVINGIEADVVTLALAYDVDAIAERGRIDKNWIKR
FT                   LPDNSAPYTSTIVFLVRKGNPKQIHDWSDLVKPGTSVITPNPKTSGGARWNYLAAWGYA
FT                   LEHNNNDQAKAQEFVNALYKNVEVLDSGARGATNTFVERGIGDVLIAWENEALLAVNEV
FT                   GNGQFDIVTPSVSILAEPTVSVVDKVVDKRGTRDVADAYLKYLYSPEGQTIAAKNYYRP
FT                   RDPVVAAKFAKEFPQLKLFTIDEVFGGWTQAQKTHFATGGVFDEISKR"
FT   misc_feature    89493..90479
FT                   /note="Pfam match to entry PF01100
FT                   Sulphate_bind,Prokaryotic sulphate- and
FT                   thiosulphate-binding protein,score 756.90, E-value
FT                   8.6e-224"
FT                   /inference="protein motif:PF01100"
FT   misc_feature    89925..89951
FT                   /note="PS00757 Prokaryotic sulfate-binding proteins
FT                   signature 2."
FT                   /inference="protein motif:ProSite:PS00757"
FT   CDS_pept        complement(90732..91550)
FT                   /transl_table=11
FT                   /locus_tag="YPO0080"
FT                   /product="hypothetical protein"
FT                   /note="Weakly similar to Bacillus subtilis hypothetical
FT                   protein YvgL TR:O32208 (EMBL:Z99121) (260 aa) fasta scores:
FT                   E(): 4.5e-05, 22.6% id in 261 aa"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384KJ87"
FT                   /inference="similar to sequence:INSDC:Z99121"
FT                   /protein_id="CAL18769.1"
FT                   /translation="MACLLAQYNSGDILMKYSNVIVSGLCMSMVSLATAAPTEVPSDEP
FT                   VTLRIISSMATRQFLTEVIAQFAQQSKYQVELESVGGVDATKRVEAGEAFDVVILSANA
FT                   IDKLIDSGKILPNSRIDLVKSGVAIAVKEGAQIMDVSSEETVKQAVLAANTIAYSTGPS
FT                   GVYLTEVFEHWGIAEQIKDRIVKVPPGVPVGSLVAKGEVELGFQQLSELLHLKGIIILG
FT                   PLPTDIQIMTHFSAGVPLKTNQQKAIKVLLDFLASPAATEAKIKNGMEPI"
FT   CDS_pept        complement(91626..93053)
FT                   /transl_table=11
FT                   /locus_tag="YPO0081"
FT                   /product="putative membrane transport protein"
FT                   /note="Similar to several including: Escherichia coli
FT                   hypothetical 51.4 kDa protein YbhI SW:YBHI_ECOLI (P75763)
FT                   (477 aa) fasta scores: E(): 0, 52.2% id in 477
FT                   aa,Arabidopsis thaliana 2-oxoglutarate/malate translocator
FT                   protein TR:Q9LXV3 (EMBL:AL353013) (557 aa) fasta scores:
FT                   E(): 0, 36.1% id in 465 aa and Neisseria meningitidis
FT                   C4-dicarboxylate transporter NMB0470 TR:Q9K0U2
FT                   (EMBL:AE002404) (488 aa) fasta scores: E(): 0, 35.7% id in
FT                   479 aa"
FT                   /db_xref="GOA:A0A384L191"
FT                   /db_xref="InterPro:IPR001898"
FT                   /db_xref="InterPro:IPR030676"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384L191"
FT                   /inference="protein motif:TMHMM:2.0"
FT                   /inference="similar to sequence:INSDC:AL353013"
FT                   /inference="similar to sequence:INSDC:AE002404"
FT                   /protein_id="CAL18770.1"
FT                   /translation="MKNKIWKLCILVMIPLVIWFIPPPEGLTELSWRLSGFYLAAICGL
FT                   ILKPFSEAVVLLGVVGFAGFFLNNTSQILVGYATSTVWLVFAAFGISISFVKTGLGRRI
FT                   AFHMIRFCGSTTLRLGYVTAFLEFVISPVTPSNTARSGGIVFPIILSVVKALGSEPGDT
FT                   AKKAGSYLMSNIYFVMKVSSFMFITAMAPNLLAADFAAKILGIHLDWGVWALAMVVPGL
FT                   LLLLIVPAVGYYLDKPELKKVDNKKIADEGLAELGPITRNEKLLVGIFISALLGWALPS
FT                   LLGQLFGITLKIDATAVAIMAMALCILLGVIKWDDVLQNKGAWNTLLWFGGIIGLASAL
FT                   SKEKVFDWLANLIQNNVDFGHNPFIALTIIGFLSIIIRYFFASASSYAIAMLPVFLTVG
FT                   KVAGADPMALALVLAATNSYGGALTHYGGGSAPIIFGAGYNNVKQWWASGAVIATVCFI
FT                   VTMTVGYVWWQFLGFVK"
FT   misc_feature    complement(91632..93053)
FT                   /note="Pfam match to entry PF00939
FT                   Na_sulph_symp,Sodium:sulfate symporter transmembrane
FT                   region, score 606.70, E-value 1.4e-178"
FT                   /inference="protein motif:PF00939"
FT   misc_feature    complement(91653..91718)
FT                   /locus_tag="YPO0081"
FT                   /note="one of 11 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    complement(91782..91847)
FT                   /locus_tag="YPO0081"
FT                   /note="one of 11 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    complement(91908..91973)
FT                   /locus_tag="YPO0081"
FT                   /note="one of 11 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    complement(92034..92087)
FT                   /locus_tag="YPO0081"
FT                   /note="one of 11 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    complement(92118..92168)
FT                   /locus_tag="YPO0081"
FT                   /note="one of 11 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    complement(92190..92255)
FT                   /locus_tag="YPO0081"
FT                   /note="one of 11 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    complement(92358..92423)
FT                   /locus_tag="YPO0081"
FT                   /note="one of 11 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    complement(92463..92528)
FT                   /locus_tag="YPO0081"
FT                   /note="one of 11 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    complement(92766..92831)
FT                   /locus_tag="YPO0081"
FT                   /note="one of 11 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    complement(92853..92942)
FT                   /locus_tag="YPO0081"
FT                   /note="one of 11 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    complement(92988..93038)
FT                   /locus_tag="YPO0081"
FT                   /note="one of 11 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        complement(93119..93832)
FT                   /transl_table=11
FT                   /locus_tag="YPO0082"
FT                   /product="possible transferase"
FT                   /note="Similar to Sphingomonas SPLB126 FldZ protein FldZ
FT                   TR:Q9L3A1 (EMBL:AJ277295) (224 aa) fasta scores: E():
FT                   0,61.6% id in 224 aa and to Pseudomonas ochraceae
FT                   4-hydroxy-4-methyl-2-oxoglutarate aldolase ProA TR:BAB21456
FT                   (EMBL:AB050935) (227 aa) fasta scores: E(): 0, 57.8% id in
FT                   223 aa. Note residue 6 offers an alternative translation
FT                   initiation site"
FT                   /db_xref="GOA:Q0WKL2"
FT                   /db_xref="InterPro:IPR005493"
FT                   /db_xref="InterPro:IPR014165"
FT                   /db_xref="InterPro:IPR036704"
FT                   /db_xref="UniProtKB/TrEMBL:Q0WKL2"
FT                   /inference="similar to sequence:INSDC:AJ277295"
FT                   /inference="similar to sequence:INSDC:AB050935"
FT                   /protein_id="CAL18771.1"
FT                   /translation="MSLVNMKGVVVTNIERAELALLQRFAEYGVATVHEAQLRQGLLDE
FT                   RIKPIQQGRCIAGNAVTVLVTPGDNWMFHVAVEQCQPGDVLLVAPTSECHDGFFGDLLA
FT                   TSLLARGVVALVGDIGIRDSQTLREMNFPVWSRAVWAQGTVKASLGSVNVPVICAGQLV
FT                   NPGDIVVADDDGVVIVPREQATAIADAAQTRVDLETSKRQRLANGELGLDIYQMRAPLA
FT                   KKGLRYVNSLNALKS"
FT   CDS_pept        complement(93829..94761)
FT                   /transl_table=11
FT                   /locus_tag="YPO0083"
FT                   /product="hypothetical protein"
FT                   /note="Weakly similar to several proteins e.g. Pyrococcus
FT                   horikoshii hypothetical 31.6 kDa protein PH0499 TR:O58235
FT                   (EMBL:AP000002) (272 aa) fasta scores: E(): 1.8e-05, 25.5%
FT                   id in 247 aa"
FT                   /db_xref="InterPro:IPR003737"
FT                   /db_xref="InterPro:IPR024078"
FT                   /db_xref="UniProtKB/TrEMBL:Q0WKL1"
FT                   /inference="similar to sequence:INSDC:AP000002"
FT                   /protein_id="CAL18772.1"
FT                   /translation="MQNALICIIFIELRSFFFCIFRRVILFNFFSLNKTCRLGNKTHYF
FT                   PLIKPCQNPRQLKQQKKEKDMAMIPQKTALVVSAHSADFVWRAGGAIALHVEQGYQVHI
FT                   VCLSYGERGESAKLWRKGDMTEERVKASRHTEAQAAANVLGASIEFFDMGDYPLRADKE
FT                   SLFRLADVFRRIQPHFVLTHSLADPYNYDHPLAANLAQEARIIAQAEGYRPGEAIIGAP
FT                   PVYCFEPHQPEQCGWKPDVLLDITSVWEKKYAAIQCMAGQEHLWEYYTRVALQRGVQAK
FT                   RNIGIASTKTIIHGEGYQSLFPRVTEDLS"
FT   CDS_pept        94892..95938
FT                   /transl_table=11
FT                   /locus_tag="YPO0084"
FT                   /product="possible transcriptional regulator"
FT                   /note="Similar to several including: Sphingomonas sp LB126
FT                   protein FldY TR:Q9L3A2 (EMBL:AJ277295) (383 aa) fasta
FT                   scores: E(): 3.1e-24, 32.1% id in 271 aa and to
FT                   Agrobacterium radiobacter putative transcriptional
FT                   regulator PcaQ TR:AAG27520 (EMBL:AF230648) (315 aa) fasta
FT                   scores: E(): 2e-17, 27.0% id in 293 aa"
FT                   /db_xref="GOA:Q0WKL0"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q0WKL0"
FT                   /inference="similar to sequence:INSDC:AJ277295"
FT                   /inference="similar to sequence:INSDC:AF230648"
FT                   /protein_id="CAL18773.1"
FT                   /translation="MLLTDLGNVILPRARSAMEELTRIPALLRRLQQRDDEGIEDLEPT
FT                   WLFNERRLQIFLSLYRQQHALHVAQALDITQSAVSAALKVLEKGAGMYLFHRTPKGMLP
FT                   TPAGHEIAPCISRALNALHHIPEEITAHRGDLTGSVRVGALPLSRARLLPQAMIKLISR
FT                   HPGIKIVTNESGFTALIAELRAGDIDFIIGALRNEKMLLDIHSEILFEEELILLARPNH
FT                   PLSDRRVKNQELKDIQWVLPRNHAPSRHLLEVAFCKMGLASPQPVVESGDPAVVRALLL
FT                   GSDMVAAVSSHQLDFEVSEGILIPLQVNLTGTRREIGLMTRQKALNSPATDALINCVRE
FT                   VIQSSNDK"
FT   misc_feature    95039..95467
FT                   /note="Pfam match to entry PF00126 HTH_1, Bacterial
FT                   regulatory helix-turn-helix protein, lysR family, score
FT                   107.40, E-value 2.7e-28"
FT                   /inference="protein motif:PF00126"
FT   misc_feature    95078..95143
FT                   /note="Predicted helix-turn-helix motif with score 1283
FT                   (+3.56 SD) at aa 63-84, sequence QHALHVAQALDITQSAVSAALK"
FT   misc_feature    95081..95173
FT                   /note="PS00044 Bacterial regulatory proteins, lysR family
FT                   signature."
FT                   /inference="protein motif:ProSite:PS00044"
FT   CDS_pept        complement(96170..96937)
FT                   /transl_table=11
FT                   /gene="tpi"
FT                   /gene_synonym="tpiA"
FT                   /locus_tag="YPO0085"
FT                   /product="triosephosphate isomerase"
FT                   /EC_number="5.3.1.1"
FT                   /note="Similar to Escherichia coli triosephosphate
FT                   isomerase TpiA SW:TPIS_ECOLI (P04790) (255 aa) fasta
FT                   scores: E(): 0, 82.4% id in 255 aa"
FT                   /db_xref="GOA:Q8ZJK9"
FT                   /db_xref="InterPro:IPR000652"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR020861"
FT                   /db_xref="InterPro:IPR022896"
FT                   /db_xref="InterPro:IPR035990"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZJK9"
FT                   /protein_id="CAL18774.1"
FT                   /translation="MRHPLVMGNWKLNGSTHMVNELIAGLRKELSTVDGCGVAIAPPAI
FT                   YLNQAKHELAGSRIALGAQNVDVNLSGAFTGETSAEMLKDIGAQYIIIGHSERRTYHQE
FT                   SDELIAKKFGVLKEIGLIPVLCIGESEAENEAGQTEAVCAKQLDAVLNTLGVKAFEGAV
FT                   IAYEPIWAIGTGKSATPAQAQAVHKFIRDHIAKQDAAVAAQVIIQYGGSVNDKNAAELF
FT                   TQPDIDGALVGGASLKADAFAVIVKAAAKAKKA"
FT   misc_feature    complement(96182..96934)
FT                   /note="Pfam match to entry PF00121 TIM, Triosephosphate
FT                   isomerase, score 518.70, E-value 2.9e-167"
FT                   /inference="protein motif:PF00121"
FT   misc_feature    complement(96413..96445)
FT                   /note="PS00171 Triosephosphate isomerase active site."
FT                   /inference="protein motif:ProSite:PS00171"
FT   CDS_pept        complement(97066..97701)
FT                   /transl_table=11
FT                   /locus_tag="YPO0086"
FT                   /product="putative exported protein"
FT                   /note="Similar in parts to Escherichia coli hypothetical
FT                   21.8 kDa protein in YiiQ SW:YIIQ_ECOLI (P32160) (199 aa)
FT                   fasta scores: E(): 0, 55.9% id in 195 aa"
FT                   /db_xref="InterPro:IPR009918"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384KR25"
FT                   /protein_id="CAL18775.1"
FT                   /translation="MRKEIVSMRIILLLAALLLITFMLITTINHAHADPTNDSSPPKEG
FT                   APPIAPYLLFNAPTFDLTLVKFRESYNRANPTLPINEFHAITVKEDSPPLTRAASKINE
FT                   NLYASTALEKGTGKIKTLQITYLPIKGNEEKTAKLLAINYMAALMRQFEPTLSVAQSLA
FT                   NVQKLLTEGKGSPFYAHTIGAIRYVVADNGEKGLTFAVEPIKLSLSEA"
FT   CDS_pept        97849..98283
FT                   /transl_table=11
FT                   /locus_tag="YPO0087"
FT                   /product="conserved membrane protein"
FT                   /note="Similar to Escherichia coli hypothetical protein
FT                   YiiR SW:YIIR_ECOLI (P32161) (146 aa) fasta scores: E():
FT                   0,66.7% id in 141 aa and to Escherichia coli O157:H7
FT                   putative cytochrome YhaH TR:AAG58236 (EMBL:AE005540) (121
FT                   aa) fasta scores: E(): 0.00022, 30.5% id in 131 aa"
FT                   /db_xref="GOA:A0A384LAN2"
FT                   /db_xref="InterPro:IPR008523"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384LAN2"
FT                   /inference="protein motif:TMHMM:2.0"
FT                   /inference="similar to sequence:INSDC:AE005540"
FT                   /protein_id="CAL18776.1"
FT                   /translation="MTIQQWCFSFKGRIGRREFWIWMGLWLLAMLVIFTLAGKEWLPIQ
FT                   SASFALVFLLWPTAAVVVKRLHDRNKAGWWALLAVLAWMLMAGNWQMLTPIWQWGVGRF
FT                   IPTLIFVMMFIDCGAFLGTEGDNRFGPEAVPVKFFADKAK"
FT   misc_feature    97903..97959
FT                   /locus_tag="YPO0087"
FT                   /note="one of 4 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    97969..98037
FT                   /locus_tag="YPO0087"
FT                   /note="one of 4 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    98062..98130
FT                   /locus_tag="YPO0087"
FT                   /note="one of 4 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    98143..98211
FT                   /locus_tag="YPO0087"
FT                   /note="one of 4 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        complement(98624..99370)
FT                   /transl_table=11
FT                   /gene="fpr"
FT                   /gene_synonym="mvrA"
FT                   /locus_tag="YPO0088"
FT                   /product="ferredoxin--NADP reductase"
FT                   /EC_number="1.18.1.2"
FT                   /note="Similar to Escherichia coli ferredoxin--NADP
FT                   reductase Fpr SW:FENR_ECOLI (P28861) (247 aa) fasta scores:
FT                   E(): 0, 74.1% id in 247 aa"
FT                   /db_xref="GOA:Q0WKK6"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR008333"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR033892"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:Q0WKK6"
FT                   /protein_id="CAL18777.1"
FT                   /translation="MAEWVSGKITHIEHWTDALFSLQVNAPVDPFTAGQFAKLALDING
FT                   ERVQRAYSYVNAPSDHNLEFYLVTVPEGKLSPRLDQLSVGGEVMITKQAAGFFVLEEIP
FT                   DCDTLWMLATGTAIGPYLSILQEGQDLERFKHLVLVHAARFAHDLSYLPLMQQLEQRYN
FT                   GKLRIQTVVSREESPGSLTGRVPALIENGALEAAVGLKIDAKDSHVMLCGNPQMVRDTQ
FT                   QLLKEQREMRKHLRRKPGHMTSEQYW"
FT   misc_feature    complement(98699..99055)
FT                   /note="Pfam match to entry PF00175
FT                   oxidored_fad,Oxidoreductase FAD/NAD-binding domain, score
FT                   87.60, E-value 2.5e-22"
FT                   /inference="protein motif:PF00175"
FT   CDS_pept        complement(99525..100193)
FT                   /pseudo
FT                   /transl_table=11
FT                   /gene="'glpX"
FT                   /locus_tag="YPO0089"
FT                   /product="GlpX protein (pseudogene)"
FT                   /note="Partial CDS which is highly similar to Escherichia
FT                   coli protein GlpX, a protein of unknown function thought to
FT                   be involved in glycerol metabolism, SW:GLPX_ECOLI (P28860)
FT                   (336 aa) fasta scores: E(): 0, 81.1% id in 222 aa. The
FT                   predicted product of this CDS lacks 114 aa from the
FT                   N-terminal following a likely deletion event"
FT   misc_feature    complement(100261..101094)
FT                   /note="Pfam match to entry PF00370 FGGY, FGGY family of
FT                   carbohydrate kinases, score 449.90, E-value 2.2e-131"
FT                   /inference="protein motif:PF00370"
FT   CDS_pept        complement(100264..101355)
FT                   /pseudo
FT                   /transl_table=11
FT                   /gene="glpK'"
FT                   /locus_tag="YPO0090"
FT                   /product="glycerol kinase (pseudogene)"
FT                   /EC_number="2.7.1.30"
FT                   /note="Partial CDS which is highly similar to Escherichia
FT                   coli glycerol kinase GlpK SW:GLPK_ECOLI (P08859) (501 aa)
FT                   fasta scores: E(): 0, 81.3% id in 380 aa. The predicted
FT                   product of this CDS lacks approximately 120 aa from the
FT                   C-terminal following a likely deletion event."
FT   misc_feature    complement(100897..100935)
FT                   /note="PS00933 FGGY family of carbohydrate kinases
FT                   signature 1."
FT                   /inference="protein motif:ProSite:PS00933"
FT   CDS_pept        complement(101532..102380)
FT                   /transl_table=11
FT                   /gene="glpF"
FT                   /locus_tag="YPO0091"
FT                   /product="glycerol uptake facilitator protein"
FT                   /note="Similar to Escherichia coli glycerol uptake
FT                   facilitator protein GlpF SW:GLPF_ECOLI (P11244) (281 aa)
FT                   fasta scores: E(): 0, 82.6% id in 282 aa"
FT                   /db_xref="GOA:Q7CLC8"
FT                   /db_xref="InterPro:IPR000425"
FT                   /db_xref="InterPro:IPR022357"
FT                   /db_xref="InterPro:IPR023271"
FT                   /db_xref="UniProtKB/TrEMBL:Q7CLC8"
FT                   /inference="protein motif:TMHMM:2.0"
FT                   /protein_id="CAL18780.1"
FT                   /translation="MSQTASSTLKGQCIAEFLGTGLLIFFGAGCVAALKLAGASFGQWE
FT                   ISIIWGLGVAMAIYLTAAISGAHLNPAVTIALWLFACFERRKVLPYIVAQVAGAFCAAA
FT                   LVYGLYYSLFVDFEQTHQMVRGSTESLQLAGIFSTYPNPHISVVQAFLVETVITAILMC
FT                   LILALTDDGNGIPRGPLAPLLIGILIAVIGASMGPLTGFALNPARDLGPKAFSYLAGWG
FT                   DIAFTGGRDIPYFLVPIFGPIVGALLGAFGYRALIGRHLPCDVCTLEDEESTTITTERK
FT                   A"
FT   misc_feature    complement(101610..101675)
FT                   /gene="glpF"
FT                   /locus_tag="YPO0091"
FT                   /note="one of 6 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    complement(101622..102380)
FT                   /note="Pfam match to entry PF00230 MIP, Major intrinsic
FT                   protein, score 419.10, E-value 7.5e-136"
FT                   /inference="protein motif:PF00230"
FT   misc_feature    complement(101775..101840)
FT                   /gene="glpF"
FT                   /locus_tag="YPO0091"
FT                   /note="one of 6 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    complement(101880..101945)
FT                   /gene="glpF"
FT                   /locus_tag="YPO0091"
FT                   /note="one of 6 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    complement(102048..102113)
FT                   /gene="glpF"
FT                   /locus_tag="YPO0091"
FT                   /note="one of 6 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    complement(102153..102179)
FT                   /note="PS00221 MIP family signature."
FT                   /inference="protein motif:ProSite:PS00221"
FT   misc_feature    complement(102174..102239)
FT                   /gene="glpF"
FT                   /locus_tag="YPO0091"
FT                   /note="one of 6 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    complement(102285..102341)
FT                   /gene="glpF"
FT                   /locus_tag="YPO0091"
FT                   /note="one of 6 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        complement(102390..102629)
FT                   /transl_table=11
FT                   /locus_tag="YPO0092"
FT                   /product="hypothetical protein"
FT                   /note="No significant database hits"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384KZL2"
FT                   /protein_id="CAL18781.1"
FT                   /translation="MTAPLMRYTPLTFSQKITGPITLLKSLNALKLRENAHFMTNNTYF
FT                   DFATSRFRSLTINLHYPLHCSKGKNKKYPINLCL"
FT   CDS_pept        103008..103247
FT                   /transl_table=11
FT                   /locus_tag="YPO0093"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Escherichia coli hypothetical protein
FT                   YiiU SW:YIIU_ECOLI (P32164) (81 aa) fasta scores: E():
FT                   3.7e-19, 75.9% id in 79 aa"
FT                   /db_xref="GOA:Q7CLC9"
FT                   /db_xref="InterPro:IPR009252"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7CLC9"
FT                   /protein_id="CAL18782.1"
FT                   /translation="MSFEVFEKLEVKVQQAIDTITLLQMEIEELKEKNNTLTQEVQDAA
FT                   GSREALVRENEQLKQEQHVWQDRLRALLGKMEEV"
FT   repeat_region   complement(103347..104058)
FT                   /note="Contains an 'A' at nucleotide position 315."
FT                   /note="IS200-like insertion sequence:IS1541"
FT   CDS_pept        complement(103455..103913)
FT                   /transl_table=11
FT                   /gene="tnp"
FT                   /locus_tag="YPO0094"
FT                   /product="transposase for the IS1541 insertion element"
FT                   /note="Similar to Salmonella typhimurium and Salmonella
FT                   typhi transposase for insertion sequence IS200,
FT                   TnpA,SW:TNPA_SALTY (Q57334) (152 aa) fasta scores: E(): 0,
FT                   93.4% id in 152 aa. Almost identical to the Yersinia
FT                   pseudotuberculosis IS1541 element transposase Tnp TR:Q9X9F5
FT                   (EMBL:AJ238014) (152 aa) fasta scores: E(): 0, 99.3% id in
FT                   152 aa"
FT                   /db_xref="GOA:Q56938"
FT                   /db_xref="InterPro:IPR002686"
FT                   /db_xref="InterPro:IPR036515"
FT                   /db_xref="UniProtKB/TrEMBL:Q56938"
FT                   /inference="similar to sequence:INSDC:AJ238014"
FT                   /protein_id="CAL18783.1"
FT                   /translation="MRDEKSLAHTRWNCKYHIVFAPKYRRQVFYREKRRAIGSILRKLC
FT                   EWKNVNILEAEYCVDHIHMLLEIPPKMSVSGFMGYLKGKSSLMLYEQFGDLKFKYRNRE
FT                   FWCRGYYVDTVGKNTARIQEYIKHQLEEDKMGEQLSIPYPGSPFTGRK"
FT   misc_feature    complement(103548..103859)
FT                   /note="Pfam match to entry PF01797
FT                   Transposase_17,Transposase IS200 like, score 230.20,
FT                   E-value 3e-65"
FT                   /inference="protein motif:PF01797"
FT   CDS_pept        complement(join(104291..105577,107535..108365))
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="YPO0095"
FT                   /product="ABC-transport protein, ATP-binding component
FT                   (pseudogene)"
FT                   /note="Similar to Escherichia coli colicin V secretion
FT                   ATP-binding protein CvaB SW:CVAB_ECOLI (P22520) (698 aa)
FT                   fasta scores: E(): 0, 56.1% id in 699 aa. This CDS has been
FT                   disrupted by the insertion of an IS100 element."
FT                   /db_xref="PSEUDO:CAL18784.1"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    complement(104303..104851)
FT                   /note="Pfam match to entry PF00005 ABC_tran, ABC
FT                   transporter, score 183.80, E-value 2.8e-51"
FT                   /inference="protein motif:PF00005"
FT   misc_feature    complement(104474..104518)
FT                   /note="PS00211 ABC transporters family signature."
FT                   /inference="protein motif:ProSite:PS00211"
FT   misc_feature    complement(104807..104830)
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:ProSite:PS00017"
FT   misc_feature    complement(105149..105214)
FT                   /locus_tag="YPO0095"
FT                   /note="one of 2 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    complement(105440..105505)
FT                   /locus_tag="YPO0095"
FT                   /note="one of 2 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   repeat_region   complement(105579..107532)
FT                   /note="insertion sequence:IS100"
FT   repeat_region   105579..105606
FT                   /rpt_type=INVERTED
FT                   /note="IS100 inverted repeat"
FT   CDS_pept        complement(105645..106427)
FT                   /transl_table=11
FT                   /gene="ypmt1.57c"
FT                   /locus_tag="YPO0096"
FT                   /product="insertion sequence IS100, ATP-binding protein"
FT                   /note="Similar to Escherichia coli insertion sequence IS21
FT                   putative ATP-binding protein, IstB SW:ISTB_ECOLI (P15026)
FT                   (265 aa) fasta scores: E(): 0, 47.4% id in 249 aa.
FT                   Identical to Yersinia pestis and Escherichia coli putative
FT                   IS100 transposase ypmt1.57c TR:Q9R3L5 (EMBL:AL117211) (260
FT                   aa) fasta scores: E(): 0, 99.6% id in 260 aa."
FT                   /db_xref="GOA:Q7ARK4"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR002611"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028350"
FT                   /db_xref="UniProtKB/TrEMBL:Q7ARK4"
FT                   /inference="similar to sequence:INSDC:AL117211"
FT                   /protein_id="CAL18785.1"
FT                   /translation="MMMELQHQRLMALAGQLQLESLISAAPALSQQAVDQEWSYMDFLE
FT                   HLLHEEKLARHQRKQAMYTRMAAFPAVKTFEEYDFTFATGAPQKQLQSLRSLSFIERNE
FT                   NIVLLGPSGVGKTHLAIAMGYEAVRAGIKVRFTTAADLLLQLSTAQRQGRYKTTLQRGV
FT                   MAPRLLIIDEIGYLPFSQEEAKLFFQVIAKRYEKSAMILTSNLPFGQWDQTFAGDAALT
FT                   SAMLDRILHHSHVVQIKGESYRLRQKRKAGVIAEANPE"
FT   misc_feature    complement(105720..106259)
FT                   /note="Pfam match to entry PF01695 IstB, IstB-like ATP
FT                   binding protein, score 367.20, E-value 1.7e-106"
FT                   /inference="protein motif:PF01695"
FT   misc_feature    complement(106077..106100)
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:ProSite:PS00017"
FT   CDS_pept        complement(106424..107446)
FT                   /transl_table=11
FT                   /gene="y1093"
FT                   /gene_synonym="ypmt1"
FT                   /locus_tag="YPO0097"
FT                   /product="transposase for insertion sequence IS100"
FT                   /note="Similar to Escherichia coli transposase for
FT                   insertion sequence element IS21 IstA SW:ISTA_ECOLI (P15025)
FT                   (390 aa) fasta scores: E(): 3e-27, 33.1% id in 329 aa.
FT                   Identical to the previously sequenced Yersinia
FT                   pestis,Yersinia pseudotuberculosis, and Escherichia coli
FT                   pesticin plasmid insertion sequence transposase Y1055
FT                   TR:P74993 (EMBL:U59875) (340 aa) fasta scores: E(): 0,
FT                   100.0% id in 340 aa"
FT                   /db_xref="GOA:Q0WKK0"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR006120"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR017894"
FT                   /db_xref="UniProtKB/TrEMBL:Q0WKK0"
FT                   /inference="similar to sequence:INSDC:U59875"
FT                   /protein_id="CAL18786.1"
FT                   /translation="MVTFETVMEIKILHKQGMSSRAIARELGISRNTVKRYLQAKSEPP
FT                   KYTPRPAVASLLDEYRDYIRQRIADAHPYKIPATVIAREIRDQGYRGGMTILRAFIRSL
FT                   SVPQEQEPAVRFETEPGRQMQVDWGTMRNGRSPLHVFVAVLGYSRMLYIEFTDNMRYDT
FT                   LETCHRNAFRFFGGVPREVLYDNMKTVVLQRDAYQTGQHRFHPSLWQFGKEMGFSPRLC
FT                   RPFRAQTKGKVERMVQYTRNSFYIPLMTRLRPMGITVDVETANRHGLRWLHDVANQRKH
FT                   ETIQACTCDRWLEEQQSMLALPPEKKEYDVHLDENLVNFDKHPLHHPLSIYDSFCRGVA
FT                   "
FT   misc_feature    complement(106568..107101)
FT                   /note="Pfam match to entry PF00665 rve, Integrase core
FT                   domain, score 78.30, E-value 1.8e-21"
FT                   /inference="protein motif:PF00665"
FT   misc_feature    complement(107330..107395)
FT                   /note="Predicted helix-turn-helix motif with score 2147
FT                   (+6.50 SD) at aa 18-39, sequence MSSRAIARELGISRNTVKRYLQ"
FT   misc_feature    complement(107339..107422)
FT                   /note="Pfam match to entry PF00239
FT                   recombinase,Site-specific recombinases, score 25.70,
FT                   E-value 4.7e-06"
FT                   /inference="protein motif:PF00239"
FT   repeat_region   complement(107505..107532)
FT                   /rpt_type=INVERTED
FT                   /note="IS100 inverted repeat"
FT   misc_feature    complement(107673..107729)
FT                   /locus_tag="YPO0098"
FT                   /note="one of 2 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    complement(107775..107840)
FT                   /locus_tag="YPO0098"
FT                   /note="one of 2 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        complement(108358..109593)
FT                   /transl_table=11
FT                   /locus_tag="YPO0099"
FT                   /product="putative exported protein"
FT                   /note="Similar to several members of the HlyD family of
FT                   secretion proteins e.g. Escherichia coli colicin V
FT                   secretion protein CvaA SW:CVAA_ECOLI (P22519) (413 aa)
FT                   fasta scores: E(): 0, 47.1% id in 410 aa and to Escherichia
FT                   coli MtfA TR:Q46972 (EMBL:U47048) (414 aa) fasta scores:
FT                   E(): 0, 46.6% id in 410 aa"
FT                   /db_xref="GOA:A0A384KAW1"
FT                   /db_xref="InterPro:IPR006144"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384KAW1"
FT                   /inference="similar to sequence:INSDC:U47048"
FT                   /protein_id="CAL18787.1"
FT                   /translation="MGKALLTSGYSTTFIAALCAIFLVLLITLIIYGTYTRRINVNGEV
FT                   ISQPHPINIFSPQQGFITKKWVEVGDIVRKGQHLYQIDVSRTTFSGNVSLNSLEAINNQ
FT                   LSQIDSIINNTQKNKELTLLNLRQQLAQYQKAHKKSQELVDNAGKGMDDMRRTMASYGT
FT                   YQRQGLITKDQLTNQRSLFYQQQNAFQSLNTQLIQESLQIAKLESEISTRASDFDNDIS
FT                   QYLFQKGDLKRQLAEVDASGMLLINSPSDGKIENMSVTQGQMVNVNDSLVQLTPSDNPY
FT                   YCLVLWVPNNSVPYINTGDKVNIRYDAFPFEKFGQFPGRIISISNVPVSQQEIASYNIA
FT                   PRLPNGGLIEPYYKVIVALDDIHFRYQSKPLMLSNGLKANVTLFLEKRPLYQWMLSPFY
FT                   DIKKSVTGPVNE"
FT   misc_feature    complement(108409..108477)
FT                   /note="PS00543 HlyD family secretion proteins signature."
FT                   /inference="protein motif:ProSite:PS00543"
FT   misc_feature    complement(108451..109446)
FT                   /note="Pfam match to entry PF00529 HlyD, HlyD family
FT                   secretion protein, score 19.80, E-value 0.0014"
FT                   /inference="protein motif:PF00529"
FT   misc_feature    complement(109489..109554)
FT                   /note="1 probable transmembrane helix predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        109863..110102
FT                   /transl_table=11
FT                   /locus_tag="YPO0100"
FT                   /product="hypothetical protein"
FT                   /note="no significant database hits"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384KPS4"
FT                   /protein_id="CAL18788.1"
FT                   /translation="MKELTQTEVMEVSGAGIVSDAGKVLGSGFGALIDAGASIFGIKPN
FT                   ASATIGKIGESIGSAFDAGISGVKQFFGLSAPQQ"
FT   CDS_pept        110277..110426
FT                   /transl_table=11
FT                   /locus_tag="YPO0101"
FT                   /product="hypothetical protein"
FT                   /note="Doubtful CDS with no significant database hits"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384L889"
FT                   /protein_id="CAL18789.1"
FT                   /translation="MKIAYRTIRFINLWIYAVFYSEFFGFELSHYLSTADMIFFGDYEF
FT                   ILYH"
FT   misc_feature    110313..110381
FT                   /note="1 probable transmembrane helix predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        110732..111316
FT                   /transl_table=11
FT                   /locus_tag="YPO0102"
FT                   /product="putative exported protein"
FT                   /note="No significant database hits"
FT                   /db_xref="InterPro:IPR025326"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384L1B8"
FT                   /protein_id="CAL18790.1"
FT                   /translation="MQRGCCFLRSTTTAGVALIVAMTLSVSAWAISEQAKSEQATTVPN
FT                   NDIVCHVAHLNARFDDKEGLFEGASQSGTLLILRNISARACQVNAMPVISFEGAVGQQL
FT                   AVFRKVPRGMRQEPVLSPVTVAAGAEVAVQLRWVASDAFDGNNCVTPEKVVVTLLGGTL
FT                   RLPFGRQMCAASGDTEFFSQAPVGPATNEVQ"
FT   misc_feature    110750..110818
FT                   /note="1 probable transmembrane helix predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        complement(111433..111918)
FT                   /transl_table=11
FT                   /gene="menG"
FT                   /locus_tag="YPO0103"
FT                   /product="S-adenosylmethionine:2-demethylmenaquinone
FT                   methyltransferase"
FT                   /EC_number="2.1.-.-"
FT                   /note="Similar to Escherichia coli
FT                   S-adenosylmethionine:2-demethylmenaquinone
FT                   methyltransferase MenG SW:MENG_ECOLI (P32165) (161 aa)
FT                   fasta scores: E(): 0, 87.6% id in 161 aa"
FT                   /db_xref="GOA:Q8ZJJ7"
FT                   /db_xref="InterPro:IPR005493"
FT                   /db_xref="InterPro:IPR010203"
FT                   /db_xref="InterPro:IPR014339"
FT                   /db_xref="InterPro:IPR036704"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZJJ7"
FT                   /protein_id="CAL18791.1"
FT                   /translation="MKYDTSDLCDIYHEEVNVVEPLFSNFGGRTSFGGKITTVKCFEDN
FT                   GLLFDLLEENGLGRVLVVDGGGSVRRALINAELAELALKNEWEGIVVYGAVRQVDDLAE
FT                   LDIGIQAMAAIPVGAADEGVGESDIRVNFGGVTFFSGDHLYADNTGIILSEDPLDIE"
FT   CDS_pept        complement(112060..112977)
FT                   /transl_table=11
FT                   /gene="menA"
FT                   /locus_tag="YPO0104"
FT                   /product="1,4-dihydroxy-2-naphthoate octaprenyltransferase"
FT                   /EC_number="2.5.1.-"
FT                   /note="Highly similar to Escherichia coli
FT                   1,4-dihydroxy-2-naphthoate octaprenyltransferase MenA
FT                   SW:MENA_ECOLI (P32166) (308 aa) fasta scores: E(): 0, 68.1%
FT                   id in 298 aa"
FT                   /db_xref="GOA:A0A384L2R4"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="InterPro:IPR004657"
FT                   /db_xref="InterPro:IPR026046"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384L2R4"
FT                   /inference="protein motif:TMHMM:2.0"
FT                   /protein_id="CAL18792.1"
FT                   /translation="MSLSINTSQTQAWLESLRPRTLPLAFASIVTGSALAVWLDSFKPA
FT                   VALLALLTAGLLQILSNLANDYGDAVKGSDTEERIGPLRGMQKGIISHQQMKVALIITV
FT                   ILTIISGIALIAVACEKPSDILGFLLLGLMAIVAAITYTVGRKPYGYMGLGDISVLVFF
FT                   GWLSVAGTYYLQAGHFDSIVMLPATACGLLATAVLNINNLRDIENDKANGKNTLAVRLG
FT                   PVVARYYHALLIGAAIFCLALFSILHLHSWHGWIFLLAIPLLGKHALFVLRDPTAAGMR
FT                   PMLEQMVKAALLTNILFAVGLVFS"
FT   misc_feature    complement(112159..112224)
FT                   /gene="menA"
FT                   /locus_tag="YPO0104"
FT                   /note="one of 8 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    complement(112240..112305)
FT                   /gene="menA"
FT                   /locus_tag="YPO0104"
FT                   /note="one of 8 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    complement(112369..112434)
FT                   /gene="menA"
FT                   /locus_tag="YPO0104"
FT                   /note="one of 8 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    complement(112450..112506)
FT                   /gene="menA"
FT                   /locus_tag="YPO0104"
FT                   /note="one of 8 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    complement(112546..112602)
FT                   /gene="menA"
FT                   /locus_tag="YPO0104"
FT                   /note="one of 8 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    complement(112618..112683)
FT                   /gene="menA"
FT                   /locus_tag="YPO0104"
FT                   /note="one of 8 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    complement(112789..112845)
FT                   /gene="menA"
FT                   /locus_tag="YPO0104"
FT                   /note="one of 8 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    complement(112861..112914)
FT                   /gene="menA"
FT                   /locus_tag="YPO0104"
FT                   /note="one of 8 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        complement(113213..114544)
FT                   /transl_table=11
FT                   /gene="hslU"
FT                   /locus_tag="YPO0105"
FT                   /product="ATP-binding heat shock protein"
FT                   /note="Similar to Escherichia coli heat shock protein HslU
FT                   SW:HSLU_ECOLI (P32168) (443 aa) fasta scores: E(): 0, 90.3%
FT                   id in 443 aa"
FT                   /db_xref="GOA:Q8ZJJ5"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004491"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZJJ5"
FT                   /protein_id="CAL18793.1"
FT                   /translation="MSEMTPREIVSELDSHIIGQDKAKRAVAIALRNRWRRMQLNEELR
FT                   HEVTPKNILMIGPTGVGKTEIARRLAKLANAPFIKVEATKFTEVGYVGKEVDSIIRDLT
FT                   DAAVKMVRHQSIEKMRYRAEELAEERILDVLIPPAKNNWGVPDESQEPSATRQTFRKKL
FT                   REGQLDDKEIEIDLAAAPMGVEIMAPPGMEEMTNQLQSMFQNIAGQKQKPRKIKIKEAL
FT                   KLLIEEEAAKLVNPEELKQQAIDAVEQHGIVFIDEIDKICKRGQTSGPDVSREGVQRDL
FT                   LPLVEGCTVSTKHGMVKTDHILFIASGAFQVSSPSDLIPELQGRLPIRVELQALTTDDF
FT                   ERILTEPSASLTEQYKALMATEGVTIEFTREGIRKIAEAAWQVNERTENIGARRLHTVL
FT                   ERLMEDISYDASESSGQSITIDAEYVGKHLDELVADEDLSRFIL"
FT   misc_feature    complement(113396..114391)
FT                   /note="Pfam match to entry PF00004 AAA, ATPases associated
FT                   with various cellular activities (AAA), score 26.20,E-value
FT                   1.2e-05"
FT                   /inference="protein motif:PF00004"
FT   misc_feature    complement(114353..114376)
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:ProSite:PS00017"
FT   CDS_pept        complement(114615..115139)
FT                   /transl_table=11
FT                   /gene="hslV"
FT                   /locus_tag="YPO0106"
FT                   /product="heat shock protein"
FT                   /EC_number="3.4.-.-"
FT                   /note="Similar to Escherichia coli heat shock protein HslV
FT                   SW:HSLV_ECOLI (P31059) (175 aa) fasta scores: E(): 0, 90.8%
FT                   id in 173 aa"
FT                   /db_xref="GOA:Q8ZJJ4"
FT                   /db_xref="InterPro:IPR001353"
FT                   /db_xref="InterPro:IPR022281"
FT                   /db_xref="InterPro:IPR023333"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZJJ4"
FT                   /protein_id="CAL18794.1"
FT                   /translation="MTTIVSVRRDGHVVIGGDGQVTLGNTVMKGNAKKVRRLYNNKVIA
FT                   GFAGGTADAFTLFELFERKLEMHQGHLTKAAVELAKDWRTDRMLRKLEALLAVADETAS
FT                   LIITGNGDVVQPEDDLIAIGSGGPYAQSAARALLENTELGARDIVEKSLSIAGDICIYT
FT                   NRFQTIEELTY"
FT   misc_feature    complement(114969..115025)
FT                   /note="1 probable transmembrane helix predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        complement(115239..116084)
FT                   /transl_table=11
FT                   /gene="ftsN"
FT                   /gene_synonym="msgA"
FT                   /locus_tag="YPO0107"
FT                   /product="cell division protein"
FT                   /note="Similar to Escherichia coli cell division protein
FT                   FtsN SW:FTSN_ECOLI (P29131) (319 aa) fasta scores: E():
FT                   7.5e-24, 51.3% id in 320 aa"
FT                   /db_xref="GOA:A0A0H2W2E4"
FT                   /db_xref="InterPro:IPR007730"
FT                   /db_xref="InterPro:IPR011930"
FT                   /db_xref="InterPro:IPR036680"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2W2E4"
FT                   /protein_id="CAL18795.1"
FT                   /translation="MAQRDYVSRGRSGARRKSTSRKKRSAPIVSKTVMALAVALLVVFV
FT                   GGLYFITHNKPGELPLLPNHDPRTGNGLPPKPEERWRYIKELENRQIGVPMPTEPSAGG
FT                   EVNAKTELTNEQRQLLEQMQADMRQQPTQLSEVPYNQGMQQVPRSAVTIKPPATSVQPQ
FT                   PVTPPRQTTIPVQPQAPAPVRTPPAAPVTQAVTPPKVEKEKEKTQRWMVQCGSFKAVDQ
FT                   AESIRAQLAFAGIESRITSGGGWNRVVLGPYNSKAAADKALQRLQGAGQSGCIPLSVGG
FT                   "
FT   CDS_pept        complement(116150..117178)
FT                   /transl_table=11
FT                   /gene="cytR"
FT                   /locus_tag="YPO0108"
FT                   /product="transcriptional repressor"
FT                   /note="Similar to Escherichia coli transcriptional
FT                   repressor CytR SW:CYTR_ECOLI (P06964) (341 aa) fasta
FT                   scores: E(): 0, 71.1% id in 339 aa"
FT                   /db_xref="GOA:Q0WKJ0"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:Q0WKJ0"
FT                   /protein_id="CAL18796.1"
FT                   /translation="MENKKEFTMTTMKDVAEMAGVSTATVSRALMNPEKVSTVTRQKVE
FT                   QAVLAVGYSPHALSRNIKRNESRTILVIVPDISDPFFADVIQGIEHAAAQQGYLILIGD
FT                   CAQQTQQERTFVNLIITKQIDGMLLLGSNLPFDASKEEQRNLPPMVMANEFAPELELPT
FT                   VHIDNLTAAYEAVNYLHELGHKRIACIAGPESLPLSHYRLQGYIQALRRNGITVDNDYI
FT                   IRGDFSYEAGAQSFAALMELPHPPTAIFSHNDVMAVGAIWQAKQLGLRIPQDVSLVGFD
FT                   DLKLSQFCDPPLTTVAQPRYQIGQQAMLLLLEQLQGHSVQSGSRLLDTELIIRESTAAP
FT                   KH"
FT   misc_feature    complement(116258..116983)
FT                   /note="Pfam match to entry PF00532
FT                   Peripla_BP_like,Periplasmic binding proteins and sugar
FT                   binding domain of the LacI family., score 177.00, E-value
FT                   3.1e-49"
FT                   /inference="protein motif:PF00532"
FT   CDS_pept        complement(117531..119729)
FT                   /transl_table=11
FT                   /gene="priA"
FT                   /locus_tag="YPO0110"
FT                   /product="primosomal protein n'"
FT                   /note="Highly similar to Escherichia coli primosomal
FT                   protein n' PriA SW:PRIA_ECOLI (P17888) (732 aa) fasta
FT                   scores: E(): 0, 73.0% id in 732 aa"
FT                   /db_xref="GOA:A0A0H2W0X9"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR005259"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040498"
FT                   /db_xref="InterPro:IPR041222"
FT                   /db_xref="InterPro:IPR041236"
FT                   /db_xref="InterPro:IPR042115"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2W0X9"
FT                   /protein_id="CAL18797.1"
FT                   /translation="MSVVQVALPVPLARTFDYRLDSAMACPVVGARVSVPFGKRKAIGI
FT                   VVGLSDTSTFPLEQLKTIDAILDNHSLFPPSLWRILCWATEYYHYPIGEVLFHALPILL
FT                   RQGRPAQSAPLWQWFVTEQGRATPPESLKRAPKQQQALAALLQKPVYRHQVNEMALTES
FT                   ALQALRSKGLIDLRAQEATTTDWRHSFSVLGERLRLNTEQATAVGAIRSEDNQFAAWLL
FT                   AGVTGSGKTEVYLSVLENILAQGRQALILVPEIGLTPQTIARFRERFNAPVEVLHSGLN
FT                   DSERLSVWLRARSGEAAIVIGTRSALFTPFSRLGVIIIDEEHDSSYKQQEGWRYHARDL
FT                   AVFRAREEGIPIVMGTATPALETLHNVQMGKYRQLTLTKRAGSAKPAAQHLLDLKGLPL
FT                   KVGLSQPLLKQMKTHLQAGNQVILFLNRRGYAPALLCHECGWIAECQRCDHYYTLHQNH
FT                   RQLRCHHCDSQRPVPQQCPKCGSTHLVSVGVGTEQLENELAPLFPETPITRIDRDTTSR
FT                   KGSLEQYLADVHQGGARILIGTQMLAKGHHFPDVTLVALLDVDGALFSADFRSAERFAQ
FT                   LYTQVSGRAGRAGKQGEVILQTHHPEHPLLQILLQQGYDAFAKQALEERKSVFLPPYTS
FT                   HIIVRSEDHDNQQSALFLQQLRNLLEASPLKDEALWIMGPVPALQAKRGGRFRWQLLLQ
FT                   HPSRQLLQRLIKTSQPLISTLPQARKVKWTIDVDPIDS"
FT   misc_feature    complement(119037..119060)
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:ProSite:PS00017"
FT   CDS_pept        119972..120187
FT                   /transl_table=11
FT                   /gene="rpmE"
FT                   /locus_tag="YPO0111"
FT                   /product="50S ribosomal protein L31"
FT                   /note="Similar to Escherichia coli 50S ribosomal protein
FT                   L31 RpmE SW:RL31_ECOLI (P02432) (70 aa) fasta scores: E():
FT                   1.4e-25, 81.4% id in 70 aa"
FT                   /db_xref="GOA:P58471"
FT                   /db_xref="InterPro:IPR002150"
FT                   /db_xref="InterPro:IPR027491"
FT                   /db_xref="InterPro:IPR034704"
FT                   /db_xref="InterPro:IPR042105"
FT                   /db_xref="UniProtKB/Swiss-Prot:P58471"
FT                   /protein_id="CAL18798.1"
FT                   /translation="MKQGIHPKYEQVTASCSCGNVIKINSTVGHDLNLDVCGECHPFYT
FT                   GKQRDVASGGRVDRFNKRFSVPGAKK"
FT   misc_feature    119972..120172
FT                   /note="Pfam match to entry PF01197 Ribosomal_L31, Ribosomal
FT                   protein L31, score 147.10, E-value 3.2e-40"
FT                   /inference="protein motif:PF01197"
FT   misc_feature    120080..120097
FT                   /note="PS00190 Cytochrome c family heme-binding site
FT                   signature."
FT                   /inference="protein motif:ProSite:PS00190"
FT   misc_feature    120092..120148
FT                   /note="PS01143 Ribosomal protein L31 signature."
FT                   /inference="protein motif:ProSite:PS01143"
FT   CDS_pept        complement(120748..121203)
FT                   /transl_table=11
FT                   /locus_tag="YPO0112"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Escherichia coli hypothetical protein
FT                   YiaA SW:YIAA_ECOLI (P11287) (145 aa) fasta scores: E():
FT                   0,62.5% id in 136 aa"
FT                   /db_xref="InterPro:IPR008024"
FT                   /db_xref="InterPro:IPR038972"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384L9P1"
FT                   /inference="protein motif:TMHMM:2.0"
FT                   /protein_id="CAL18799.1"
FT                   /translation="MNPNYAKPSAAFTAASWSALLGGFVIFLIGLWNADMQLNERGYYF
FT                   AVLILGLFSAVSLQKTVRDKLEGLAITSIYYGLCWVAFIVAVLLLCIGLWNATLALSEK
FT                   GFYGVTFFMTLFGAIAVQKNTRDSAMSSDTESASLFKKVRDQLKAED"
FT   misc_feature    complement(120838..120888)
FT                   /locus_tag="YPO0112"
FT                   /note="one of 4 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    complement(120916..120981)
FT                   /locus_tag="YPO0112"
FT                   /note="one of 4 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    complement(121027..121080)
FT                   /locus_tag="YPO0112"
FT                   /note="one of 4 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    complement(121108..121173)
FT                   /locus_tag="YPO0112"
FT                   /note="one of 4 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        121254..121415
FT                   /transl_table=11
FT                   /locus_tag="YPO0113"
FT                   /product="hypothetical protein"
FT                   /note="No significant database hits"
FT                   /db_xref="UniProtKB/TrEMBL:Q74Y57"
FT                   /protein_id="CAL18800.1"
FT                   /translation="MISNHLKTGYIPIIRSSKIIIDNMLFYRDIHGGMVCENILIQYVD
FT                   IAKTILEL"
FT   CDS_pept        complement(121552..121869)
FT                   /transl_table=11
FT                   /gene="metJ"
FT                   /locus_tag="YPO0114"
FT                   /product="transcriptional repressor protein"
FT                   /note="Similar to Escherichia coli methionine regulon
FT                   repressor protein MetJ SW:METJ_ECOLI (P08338) (104 aa)
FT                   fasta scores: E(): 0, 89.4% id in 104 aa"
FT                   /db_xref="GOA:Q8ZJI8"
FT                   /db_xref="InterPro:IPR002084"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="InterPro:IPR023453"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZJI8"
FT                   /protein_id="CAL18801.1"
FT                   /translation="MAEWNGEYVSPYAEHGKKSKQVKKITVSIPLKVLKILTDERTRRQ
FT                   VNNLRHATNSELLCEAFLHAFTGQPLPNDEDLRKERSDEIPEAAKILMRELGVDPDTWE
FT                   Y"
FT   misc_feature    complement(121555..121866)
FT                   /note="Pfam match to entry PF01340 MetJ, Met
FT                   Apo-repressor,MetJ, score 288.90, E-value 6.5e-83"
FT                   /inference="protein motif:PF01340"
FT   CDS_pept        122247..123406
FT                   /pseudo
FT                   /transl_table=11
FT                   /gene="metB"
FT                   /locus_tag="YPO0115"
FT                   /product="cystathionine gamma-synthase (pseudogene)"
FT                   /EC_number="2.5.1.48"
FT                   /note="Similar to Escherichia coli cystathionine
FT                   gamma-synthase MetB, the second stage in methionine
FT                   biosynthetic pathway SW:METB_ECOLI (P00935) (386 aa) fasta
FT                   scores: E(): 0, 83.3% id in 383 aa. This CDS possesses a
FT                   frameshift mutation following codon 329. The sequence has
FT                   been checked and is believed to be correct"
FT   misc_feature    122262..123233
FT                   /note="Pfam match to entry PF01053 Cys_Met_Meta_PP, Cys/Met
FT                   metabolism PLP-dependent enzyme, score 513.20, E-value
FT                   2e-150"
FT                   /inference="protein motif:PF01053"
FT   misc_feature    122814..122858
FT                   /note="PS00868 Cys/Met metabolism enzymes
FT                   pyridoxal-phosphate attachment site."
FT                   /inference="protein motif:ProSite:PS00868"
FT   CDS_pept        123409..125844
FT                   /transl_table=11
FT                   /gene="metL"
FT                   /gene_synonym="metM"
FT                   /locus_tag="YPO0116"
FT                   /product="bifunctional aspartokinase/homoserine
FT                   dehydrogenase II"
FT                   /EC_number="2.7.2.4"
FT                   /note="Similar to Escherichia coli bifunctional
FT                   aspartokinase/homoserine dehydrogenase II MetL
FT                   SW:AK2H_ECOLI (P00562) (809 aa) fasta scores: E(): 0, 84.0%
FT                   id in 804 aa"
FT                   /db_xref="GOA:A0A0H2W0Y3"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001341"
FT                   /db_xref="InterPro:IPR001342"
FT                   /db_xref="InterPro:IPR005106"
FT                   /db_xref="InterPro:IPR011147"
FT                   /db_xref="InterPro:IPR018042"
FT                   /db_xref="InterPro:IPR019811"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR041743"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2W0Y3"
FT                   /protein_id="CAL18803.1"
FT                   /translation="MNATAVAAAATGRQLHKFGGSSLADVKCYLRVANIMANYSHPGDL
FT                   MVVSAAGSTTNQLISWLKLSQNDRLSAHQVQQSLRRYQHDLINGLLPPEMAEPLISEFI
FT                   HDLERLAGLLDNKIDDVIYAEVVGHGEIWSARLMSALLNKLDMDAVWLDARRFLRAERA
FT                   AQPQIDESRSYPLLQQLMAQHPHQRLVVTGFISRNEAGETVLLGRNGSDYSATQVGALA
FT                   GAERVTIWSDVAGVYSADPRKVKDACLLPLLRLDEASELARLAAPVLHTRTLQPVSGSD
FT                   IDLQLRCSYQPEQGSTRIERVLASGLGAKIVTSHDDVCLIELQIASHHDFSLAQKEIDL
FT                   LLKRAQIKPLATGIHPDRNLLQLCYTSEVVNSALRVLEDAALPGKLSLREGLALVALVG
FT                   AGVSKNPLHSHRFYQQLKDQPVEFVWQAEDGISMVAVLRLGPTEHLIQGLHQSLFRAEK
FT                   RIGLMLFGKGNIGARWLELFAREQKSLSARSGFEFVLAGVVDSRRSLLSYDGLDASRTL
FT                   AFYNDEAKEQDEESLFLWMRAHPFDDLVVLDVTASPSLAEQYLDFASYGFHVISANKLA
FT                   GASSSNNYRQIRDAFAKTGRHWLYNATVGAGLPVNHTVRDLRDSGDSILAISGIFSGTL
FT                   SWLFLQFDGSVPFTELVDQAWQQGLTEPDPRVDLSGQDVMRKLVILAREAGYDIEPNQV
FT                   RVESLVPAGAESGSVDQFFENGEALNQQMIQRLEAAKEMGLVLRYVARFDANGKARVGV
FT                   EAVRTDHPLASLLPCDNVFAIESRWYRDNPLVIRGPGAGRDVTAGAIQSDLNRLSQLL"
FT   misc_feature    123442..124185
FT                   /note="Pfam match to entry PF00696 aakinase, Amino acid
FT                   kinase family, score 141.60, E-value 1.4e-38"
FT                   /inference="protein motif:PF00696"
FT   misc_feature    123451..123477
FT                   /note="PS00324 Aspartokinase signature."
FT                   /inference="protein motif:ProSite:PS00324"
FT   misc_feature    124876..125835
FT                   /note="Pfam match to entry PF00742 Homoserine_dh,Homoserine
FT                   dehydrogenase, score 518.70, E-value 4.3e-152"
FT                   /inference="protein motif:PF00742"
FT   misc_feature    125371..125439
FT                   /note="PS01042 Homoserine dehydrogenase signature."
FT                   /inference="protein motif:ProSite:PS01042"
FT   CDS_pept        126077..126961
FT                   /transl_table=11
FT                   /gene="metF"
FT                   /locus_tag="YPO0117"
FT                   /product="5,10-methylenetetrahydrofolate reductase"
FT                   /note="Similar to Erwinia carotovora
FT                   5,10-methylenetetrahydrofolate reductase MetF SW:METF_ERWCA
FT                   (P71319) (298 aa) fasta scores: E(): 0, 91.8% id in 294
FT                   aa,and to Escherichia coli 5,10-methylenetetrahydrofolate
FT                   reductase MetF SW:METF_ECOLI (P00394) (296 aa) fasta
FT                   scores: E(): 0, 86.4% id in 294 aa"
FT                   /note="deleted EC_number 1.7.99.5"
FT                   /db_xref="GOA:A0A384KTU3"
FT                   /db_xref="InterPro:IPR003171"
FT                   /db_xref="InterPro:IPR004620"
FT                   /db_xref="InterPro:IPR029041"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384KTU3"
FT                   /protein_id="CAL18804.1"
FT                   /translation="MSFFHANQREALNQSLSELQGQINVSFEFFPPRTSEMEDTLWSSI
FT                   DRLSTLKPKFVSVTYGANSGERDRTHSIIKGIKERTGLEAAPHLTCIDASPTQLRDIAI
FT                   DYWNSGIRHIVALRGDLPPNSGKPEMYACDLVGLLKDVGDFDISVAAYPEIHPEAKSAQ
FT                   ADLINLKRKIDAGANRAITQFFFDVESYLRFRDRCVATGIDVEIVPGILPVSNFKQLQR
FT                   FATMTNVRVPNWMTSIFDGLDNDPETRKMVGASVAMDMVKILSREGVKDFHFYTLNRAE
FT                   LSYAICHTLGVRP"
FT   misc_feature    126107..126949
FT                   /note="Pfam match to entry PF02219
FT                   MTHFR,Methylenetetrahydrofolate reductase, score 545.30,
FT                   E-value 4.1e-160"
FT                   /inference="protein motif:PF02219"
FT   misc_feature    complement(127098..128558)
FT                   /note="IS1397-like insertion element: IS1661."
FT   repeat_region   127098..127130
FT                   /rpt_type=INVERTED
FT                   /note="Inverted repeat for IS1661 insertion element"
FT   CDS_pept        complement(127139..127924)
FT                   /transl_table=11
FT                   /locus_tag="YPO0118"
FT                   /product="transposase for insertion sequence IS1661"
FT                   /note="Similar to Escherichia coli insertion sequence
FT                   IS1397 transposase, OrfB TR:Q47310 (EMBL:X92970) (240 aa)
FT                   fasta scores: E(): 0, 53.0% id in 234 aa"
FT                   /db_xref="GOA:Q7CKI6"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:Q7CKI6"
FT                   /inference="similar to sequence:INSDC:X92970"
FT                   /protein_id="CAL18805.1"
FT                   /translation="MARSTYYYHASKPDGVIDDYADAVKAIGALSRRHAQRYGYRRMTV
FT                   ALRKEGFTLNHKTVRKLMNQHGLLSLIRRKKYRSYRADGGRASDNLLARNFTSEISGLK
FT                   WCTDVTEFRVGAQKLYLSVIQDLFNNEIISWHMSERAALILTCKTLEKALKVKGRKEGL
FT                   MLHSDQGWHYRTPMWRSMLVEAGIRQSMSRKGNCLDNAVMENFFSHLKAEMYHRKKYDS
FT                   ATVLKRDIVEYIHYYNTERISLKTGGMSPAEYRTQVEKQ"
FT   misc_feature    complement(127157..127636)
FT                   /note="Pfam match to entry PF00665 rve, Integrase core
FT                   domain, score 141.50, E-value 9.6e-40"
FT                   /inference="protein motif:PF00665"
FT   CDS_pept        complement(127978..128493)
FT                   /transl_table=11
FT                   /locus_tag="YPO0119"
FT                   /product="insertion element DNA-binding protein"
FT                   /note="Similar to Escherichia coli insertion element IS1397
FT                   OrfA hypothetical 20.1 kDa protein SW:YI9A_ECOLI (Q47309)
FT                   (173 aa) fasta scores: E(): 2.3e-20, 39.6% id in 169 aa"
FT                   /db_xref="GOA:Q74RD6"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="UniProtKB/TrEMBL:Q74RD6"
FT                   /protein_id="CAL18806.1"
FT                   /translation="MKHPFSTRLAAVQHYLSGKATLRETARQFSVGKSPLTRWIRAFRR
FT                   QGEAGLEHHLSRTYTPEFRLCVVRYMMANRCSAADASAHFNIPNETIIQNWMKRYREGG
FT                   KEALNPSKTGPTMPKDKYEHDSKPFSEMTHAELEKELEYLRAENAYLKKRKALREEKAL
FT                   REQQKKPE"
FT   misc_feature    complement(128371..128436)
FT                   /note="Predicted helix-turn-helix motif with score 1691
FT                   (+4.95 SD) at aa 20-41, sequence ATLRETARQFSVGKSPLTRWIR"
FT   repeat_region   complement(128526..128558)
FT                   /rpt_type=INVERTED
FT                   /note="Inverted repeat for IS1661 insertion element"
FT   CDS_pept        complement(128686..129444)
FT                   /transl_table=11
FT                   /gene="glpR"
FT                   /locus_tag="YPO0120"
FT                   /product="glycerol-3-phosphate repressor protein"
FT                   /note="Similar to Escherichia coli glycerol-3-phosphate
FT                   regulon repressor GlpR SW:GLPR_ECOLI (P09392) (252 aa)
FT                   fasta scores: E(): 0, 77.0% id in 252 aa"
FT                   /db_xref="GOA:A0A384LNK1"
FT                   /db_xref="InterPro:IPR001034"
FT                   /db_xref="InterPro:IPR014036"
FT                   /db_xref="InterPro:IPR018356"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384LNK1"
FT                   /protein_id="CAL18807.1"
FT                   /translation="MKQTQRHDAIIELVRLQGYVSTEELVEHFAVSPQTIRRDLNELAD
FT                   QNKIHRHHGGAALPSSSVNAAYNDRKVMWSEEKARIAQRVASQIPDGATLFIDIGTTPE
FT                   AVAHALMNHKGLRVVTNNLNVATLLTAKEDFRLILAGGEVRTRDGGIIGEATLDFISQF
FT                   RLDYGILGISGIDMDGSLLEFDYHEVRTKRAIIENSRCVMLVTDHSKFGRNAMVNLGNM
FT                   NLIDYLFTDQQPPASVMKIIEQHEVQLELC"
FT   misc_feature    complement(128752..129429)
FT                   /note="Pfam match to entry PF00455 deoR, Bacterial
FT                   regulatory proteins, deoR family, score 376.30, E-value
FT                   3.1e-109"
FT                   /inference="protein motif:PF00455"
FT   misc_feature    complement(129322..129387)
FT                   /note="Predicted helix-turn-helix motif with score 1448
FT                   (+4.12 SD) at aa 20-41, sequence VSTEELVEHFAVSPQTIRRDLN"
FT   misc_feature    complement(129325..129429)
FT                   /note="PS00894 Bacterial regulatory proteins, deoR family
FT                   signature."
FT                   /inference="protein motif:ProSite:PS00894"
FT   CDS_pept        complement(129479..130315)
FT                   /transl_table=11
FT                   /gene="glpG"
FT                   /locus_tag="YPO0121"
FT                   /product="probable membrane protein"
FT                   /note="Similar to Escherichia coli hypothetical protein
FT                   GlpG SW:GLPG_ECOLI (P09391) (276 aa) fasta scores: E():
FT                   0,52.7% id in 275 aa"
FT                   /db_xref="GOA:Q7CFX8"
FT                   /db_xref="InterPro:IPR022732"
FT                   /db_xref="InterPro:IPR022764"
FT                   /db_xref="InterPro:IPR023662"
FT                   /db_xref="InterPro:IPR035952"
FT                   /db_xref="InterPro:IPR038236"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7CFX8"
FT                   /inference="protein motif:TMHMM:2.0"
FT                   /protein_id="CAL18808.1"
FT                   /translation="MTRVIVISNLRLAQAFVDYMATHHVALEIRPDAQGVEIWLADDEQ
FT                   LSAVQHELEQFLLDPLNPRYQAASWQAGNVNSNLPYQRFSYLQTLRSQAGPLTLSVMVL
FT                   CIAIYILMLITGDMAVMSWLAWPYNSSQYLQIWRWVSHAFLHFSLLHILFNLMWWWYLG
FT                   GQMEKRLGTSKLLVLTIVSAVFSGWGQSLFSGANFGGLSGVVYALMGYVWLTGERAPER
FT                   GISLPRGLMAFSVLWLIAGYFDILGLSIANAAHVSGLIIGLLMAFWDTRNSARTVQ"
FT   misc_feature    complement(129494..129928)
FT                   /note="Pfam match to entry PF01694 Rhomboid, Rhomboid
FT                   family, score 135.60, E-value 9.1e-37"
FT                   /inference="protein motif:PF01694"
FT   misc_feature    complement(129515..129580)
FT                   /gene="glpG"
FT                   /locus_tag="YPO0121"
FT                   /note="one of 6 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    complement(129593..129643)
FT                   /gene="glpG"
FT                   /locus_tag="YPO0121"
FT                   /note="one of 6 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    complement(129671..129736)
FT                   /gene="glpG"
FT                   /locus_tag="YPO0121"
FT                   /note="one of 6 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    complement(129749..129805)
FT                   /gene="glpG"
FT                   /locus_tag="YPO0121"
FT                   /note="one of 6 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    complement(129827..129892)
FT                   /gene="glpG"
FT                   /locus_tag="YPO0121"
FT                   /note="one of 6 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    complement(129953..130018)
FT                   /gene="glpG"
FT                   /locus_tag="YPO0121"
FT                   /note="one of 6 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        complement(130333..130716)
FT                   /transl_table=11
FT                   /locus_tag="YPO0122"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Escherichia coli GlpE hypothetical
FT                   protein SW:GLPE_ECOLI (P09390) (108 aa) fasta scores: E():
FT                   5.9e-28, 66.3% id in 104 aa. Note alternative possible
FT                   translational start site at codon 19"
FT                   /db_xref="GOA:Q8ZJI3"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR023695"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZJI3"
FT                   /protein_id="CAL18809.1"
FT                   /translation="MITMALLRIQSSLRVISSMEQFEATSVEQAYLRWKEGKTALVDIR
FT                   DPQSYEAGHAPGAFHLTNSSLHTFMQQTDFDQPVMVMCYHGNSSKGAAQYLLQQGFDVV
FT                   YSIDGGFEAWARSYPQDITSESR"
FT   misc_feature    complement(130366..130635)
FT                   /note="Pfam match to entry PF00581 Rhodanese,Rhodanese-like
FT                   domain, score 67.20, E-value 3.5e-16"
FT                   /inference="protein motif:PF00581"
FT   CDS_pept        complement(131037..133748)
FT                   /transl_table=11
FT                   /gene="malT"
FT                   /locus_tag="YPO0123"
FT                   /product="maltose regulon positive regulatory protein"
FT                   /note="Similar to Escherichia coli positive regulator of
FT                   the maltose regulon MalT SW:MALT_ECOLI (P06993) (901 aa)
FT                   fasta scores: E(): 0, 74.2% id in 902 aa."
FT                   /db_xref="GOA:Q8ZJI2"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR023768"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR041617"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZJI2"
FT                   /protein_id="CAL18810.1"
FT                   /translation="MLIPSKLSRPVRLQNTVVRDRLLVKLSSAANYRLTLINCPAGYGK
FT                   TTLIAQWAADQSNLGWYSLDESDNQSERFATYLIAAIQLATGGHCSKSEALSQKHQYAN
FT                   LSALFSQLFIELSNWDGPLYLVIDDYHLITNDAIHEAMRFFLRHQPENLTLIILSRTLP
FT                   SLGIANLRVRDQLLELGMQQLAFNHHEAQQFFECRLSSPLEQGDSSRLCDEVEGWVTAL
FT                   QLIALSSRQPNSSAQKSAKRLAGLNASHLSDYLVDEVLDQVDSKARAFLLRCSVLRSMN
FT                   DALIVRLTGEDNGQQLLEELERQGLFIHRMDDSAEWFCFHPLFATFLRQRCQWELALEL
FT                   PELHHAAAEGWMALGYPAEAIHHALAAGDVGMLRDILLQHAWSLFHHSELALLEQCLTA
FT                   LPYPLLVQNPELALLQAWLAQSQHRYSEVNTLLEQAELAMQERKIPVDEILRAEFGALR
FT                   AQVAINAGKPDEAEKLATDALKYLPMAHYYSRIVATSVTGEVHHCKGELARALPMMQQT
FT                   EQMARRHEAYHYALWALLQQSEILIAQGFLQAAYETQEKAFELIREQHLEQLPMHEFLL
FT                   RIRSQVLWSWSRLDEAEEAARKGVEILANYQPQQQLQCLAMLAKCSLARGDLDNANVYI
FT                   QRCEALQHGSQYHLDWITNADKPRVIHWQMTGDKVAAASWLRQTEKPGMADNHFLQGQW
FT                   RNIARVQIILGRFDEAEVVLDELNENARRLRLTSDLNRNLLLSNTLYWQTERKGEAQKA
FT                   LIESLTLANRTGFISHFVIEGEAMAQQLRQLIQLNALPELEQHRAQRILKDINQHHRHK
FT                   FAHFDEIFVDKLLTHPQVPELIRTSPLTQREWQVLGLIYSGYSNDQIANELDVAATTIK
FT                   THIRNLYQKLGVAHRQEAVQQAQRLLQMMGYV"
FT   misc_feature    complement(131046..131243)
FT                   /note="Pfam match to entry PF00196 GerE, Bacterial
FT                   regulatory proteins, luxR family, score 89.40, E-value
FT                   7.5e-23"
FT                   /inference="protein motif:PF00196"
FT   misc_feature    complement(131109..131192)
FT                   /note="PS00622 Bacterial regulatory proteins, luxR family
FT                   signature."
FT                   /inference="protein motif:ProSite:PS00622"
FT   CDS_pept        134066..136470
FT                   /pseudo
FT                   /transl_table=11
FT                   /gene="malP"
FT                   /locus_tag="YPO0124"
FT                   /product="maltodextrin phosphorylase (pseudogene)"
FT                   /EC_number="2.4.1.1"
FT                   /note="Similar to Escherichia coli maltodextrin
FT                   phosphorylase, part of the E. coli maltose and maltodextrin
FT                   transport and utilisation system, MalP SW:PHSM_ECOLI
FT                   (P00490) (796 aa) fasta scores: E(): 0, 75.2% id in 801 aa.
FT                   Contains a frameshift after codon 107. The sequence has
FT                   been checked and is believed to be correct"
FT   misc_feature    134422..136467
FT                   /note="Pfam match to entry PF00343
FT                   phosphorylase,Carbohydrate phosphorylases, score 1475.30,
FT                   E-value 0"
FT                   /inference="protein motif:PF00343"
FT   misc_feature    135991..136029
FT                   /note="PS00102 Phosphorylase pyridoxal-phosphate attachment
FT                   site."
FT                   /inference="protein motif:ProSite:PS00102"
FT   CDS_pept        136483..138579
FT                   /transl_table=11
FT                   /gene="malQ"
FT                   /locus_tag="YPO0126"
FT                   /product="4-alpha-glucanotransferase"
FT                   /EC_number="2.4.1.25"
FT                   /note="Similar to Escherichia coli
FT                   4-alpha-glucanotransferase MalQ SW:MALQ_ECOLI (P15977) (694
FT                   aa) fasta scores: E(): 0, 68.5% id in 693 aa"
FT                   /db_xref="GOA:A0A384L7I3"
FT                   /db_xref="InterPro:IPR003385"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384L7I3"
FT                   /protein_id="CAL18812.1"
FT                   /translation="MDRKSLDQAATLAGIAASYINAHGKPQATLAETKEQLLAAMGRSL
FT                   GAHDTQTANTPLPVVKVFTFGSPMQLPMAGSGDYHWQLQTENGELHQGRISAKKTLTLP
FT                   ASLPLGYHRLILEQDLQQWQCSIIVAPKRCYEPDALLQGKKLWGACVQLYTLRSEHNWG
FT                   IGDFGDLKQMLEQVGERGGSFIGLNPIHALYPANPHSASPYSPSSRRWLNVIYIDINRV
FT                   EEFQQSEAAQRWWHQAETQQALAKSRESEWVDYPLVMQLKLTALRLSFPLFTARKAKDA
FT                   QVQAFRHFVEQGGSSLHQQAVFDALHAHLSEHDPMMWGWPVWPEKYRDGHSSAVADFCR
FT                   EHADEVTFYLWLQWLAASQFDDCFQSSQQRKMPIGLYRDLAVGVAEGGAETWCDRELYC
FT                   LKASVGAPPDILGPLGQNWGLPPMDPHVMVARAYQPFIDLLRANMTSCGALRIDHVMAL
FT                   LRLWWIPYGHTADQGAYVKYPVDDLLAVLALESQRHHCMVIGEDLGTVPVEIVGKLRDS
FT                   GVYSYKVLYFEHDSENIFRAPQSYPVQAMATITTHDLPTLRGYWQADDLTLGNKLGLYP
FT                   DQQILKQLYLDRERAKQGLLEGLHRYDCVPKKVGHKAALLSMSPVLNRGLQRYVADSAS
FT                   ALLGLQPEDWLDMAAPVNIPGTTDEYPNWRRKLSASLEEIFADSQINRLLKDLDKRRKN
FT                   VSVG"
FT   misc_feature    136933..138549
FT                   /note="Pfam match to entry PF02446 4A_glucanotrans, , score
FT                   742.50, E-value 1.8e-219"
FT                   /inference="protein motif:PF02446"
FT   CDS_pept        complement(138908..139483)
FT                   /transl_table=11
FT                   /locus_tag="YPO0127"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Escherichia coli hypothetical protein
FT                   YhgI SW:YHGI_ECOLI (P46847) (191 aa) fasta scores: E():
FT                   0,89.5% id in 191 aa. Similar in small regions to nitrogen
FT                   fixation proteins e.g. Bacillus halodurans nitrogen
FT                   fixation protein BH3419 TR:Q9K7E5 (EMBL:AP001518) (79 aa)
FT                   fasta scores: E(): 0.0062, 31.3% id in 80 aa"
FT                   /db_xref="GOA:Q8ZJI0"
FT                   /db_xref="InterPro:IPR000361"
FT                   /db_xref="InterPro:IPR001075"
FT                   /db_xref="InterPro:IPR017726"
FT                   /db_xref="InterPro:IPR034904"
FT                   /db_xref="InterPro:IPR035903"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZJI0"
FT                   /inference="similar to sequence:INSDC:AP001518"
FT                   /protein_id="CAL18813.1"
FT                   /translation="MITITDAAQSHFAKLLANQEEGTQIRVFVINPGTPTAECGVSYCP
FT                   PDAVEATDTELKFEQLSAYVDELSVPYLQDAEIDFVTDQLGSQLTLKAPNAKMRKVDDS
FT                   APLMERVEYVLQSQINPQLAGHGGRVTLMEITPEGLAILQFGGGCNGCSMVDVTLKEGI
FT                   EKELLQKFPELKGVRDLTEHQRGEHSYY"
FT   misc_feature    complement(138944..139153)
FT                   /note="Pfam match to entry PF01106 NifU-like, NifU-like
FT                   domain, score 24.30, E-value 5.1e-06"
FT                   /inference="protein motif:PF01106"
FT   misc_feature    complement(139037..139069)
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:ProSite:PS00013"
FT   misc_feature    complement(139163..139483)
FT                   /note="Pfam match to entry PF01521 HesB-like, HesB-like
FT                   domain, score 127.00, E-value 3.4e-34"
FT                   /inference="protein motif:PF01521"
FT   CDS_pept        complement(139543..140244)
FT                   /transl_table=11
FT                   /locus_tag="YPO0128"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to competence proteins from several e.g.
FT                   Haemophilus influenzae competence protein ComF
FT                   SW:COMF_HAEIN (P31773) (229 aa) fasta scores: E():
FT                   1.9e-26,38.2% id in 228 aa. Also similar to Escherichia
FT                   coli hypothetical 25.7 kDa protein in bioH-gntT intergenic
FT                   region yhgH SW:YHGH_ECOLI (P46846) (227 aa) fasta scores:
FT                   E(): 0, 47.6% id in 233 aa"
FT                   /db_xref="GOA:A0A384LF70"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384LF70"
FT                   /protein_id="CAL18814.1"
FT                   /translation="MLTTVSQCWLCQQPLYHNRHGICCYCQRHLPVLPPCCPCCGLPST
FT                   STFLRCGRCLIAPPRWHHMTFVGDYAPPLSGLIKQLKFGGAPQLAPVLARLLLLRWLRH
FT                   WRETQCRKSDKAIKPQRIVSVPLHHWRCWRRGYNQTDLLARPLAHWLGCDYTPLTLQRI
FT                   HATPPQQQLTAAQRRKNVRGIFRCAESVRGQHIALLDDVVTTGSTLNEIAHLLWAQGIA
FT                   SLQIWSVCRTL"
FT   CDS_pept        140331..141107
FT                   /transl_table=11
FT                   /gene="bioH"
FT                   /locus_tag="YPO0129"
FT                   /product="putative biotin biosynthesis protein"
FT                   /note="Similar to Escherichia coli protein BioH, implicated
FT                   in biotin biosynthesis, SW:BIOH_ECOLI (P13001) (256 aa)
FT                   fasta scores: E(): 0, 64.6% id in 254 aa"
FT                   /db_xref="GOA:Q74Y45"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR010076"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q74Y45"
FT                   /protein_id="CAL18815.1"
FT                   /translation="MKQLYWYTCGEGDCDLVLLHGWGLNSGVWHCIIDRLAPHFRLHLV
FT                   DLPGYGRSQDYGAMSLADMAERVAQQAPKQALWLGWSMGGLVASQIALSQPECVRGLIT
FT                   VSSSPCFTARDEWPGIKPEVLAGFQHQLSDDFHRTVERFLALQTLGTESSRQDARLLKS
FT                   VVLQHQMPDVEVLTGGLAILRTADLRTALAGFTLPFMRVYGHLDSLVPRKVASLLDSAW
FT                   PQTQSVVMQGAAHAPFISHPNDFAKLILNFAEENKK"
FT   misc_feature    140448..141089
FT                   /note="Pfam match to entry PF00561 abhydrolase, alpha/beta
FT                   hydrolase fold, score 109.70, E-value 5.4e-29"
FT                   /inference="protein motif:PF00561"
FT   CDS_pept        141277..141546
FT                   /transl_table=11
FT                   /locus_tag="YPO0130"
FT                   /product="putative exported protein"
FT                   /note="Similar to Escherichia coli hypothetical protein
FT                   precursor YhcN SW:YHCN_ECOLI (P46477) (87 aa) fasta scores:
FT                   E(): 3.6e-08, 46.1% id in 89 aa"
FT                   /db_xref="InterPro:IPR010854"
FT                   /db_xref="InterPro:IPR025543"
FT                   /db_xref="InterPro:IPR036275"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384LB15"
FT                   /protein_id="CAL18816.1"
FT                   /translation="MKLLKNMAVALVISGLSFAAIAAKEITKQEAEANNYEKIGTVSTT
FT                   GEATSPMDVKKALSKLADEKGGKYYVIIAEREKGKFDADAEVYK"
FT   CDS_pept        complement(141684..141941)
FT                   /transl_table=11
FT                   /locus_tag="YPO0131"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Escherichia coli hypothetical protein
FT                   YhgG SW:YHGG_ECOLI (P46845) (78 aa) fasta scores: E():
FT                   3.9e-13, 56.3% id in 71 aa"
FT                   /db_xref="GOA:Q7CFX5"
FT                   /db_xref="InterPro:IPR015102"
FT                   /db_xref="InterPro:IPR023732"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7CFX5"
FT                   /protein_id="CAL18817.1"
FT                   /translation="MASLLQLRDAIALNGSAEASQLSRQLAIPLPLVNAMLEKLTAMGK
FT                   IERIELDHSGCLTGSCKSCPEGHQHCNTVIYQLKEPHAHQ"
FT   CDS_pept        complement(141977..144292)
FT                   /transl_table=11
FT                   /gene="feoB"
FT                   /locus_tag="YPO0132"
FT                   /product="ferrous iron transport protein B"
FT                   /note="Similar to Escherichia coli ferrous iron transport
FT                   protein B, FeoB SW:FEOB_ECOLI (P33650) (773 aa) fasta
FT                   scores: E(): 0, 74.4% id in 774 aa"
FT                   /db_xref="GOA:A0A0H2W2F3"
FT                   /db_xref="InterPro:IPR003373"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR011640"
FT                   /db_xref="InterPro:IPR011642"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030389"
FT                   /db_xref="InterPro:IPR041069"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2W2F3"
FT                   /inference="protein motif:TMHMM:2.0"
FT                   /protein_id="CAL18818.1"
FT                   /translation="MKALTIGLIGNPNAGKTTLFNQLTGARQRVGNWAGVTVERKEGHF
FT                   NTAQHQVTLVDLPGTYSLTTISEQTSLDEQIACHYILSGEADLLINVIDAVNLERNLYL
FT                   TLQLLELGIPCIVALNMLDIAESQHIEIDINTLSKKLGCPVIPLVSTRGRGIDELKNSI
FT                   DQFQPATCRTLVSYPPILLSEVDKLVAAMSDALPMQQRRWLALQILEGDIYSLNRAGVA
FT                   PSMVEQARQQLREQQHEDPALIIADARYQSIAHLCEAVGNSQQAEPNRLTQALDSVILN
FT                   RWLGVPIFLFVMYLMFVLAINIGGALQPIFDIGSAAIFIQGLQWVGHTLHFPPWLTIFL
FT                   AQGVGGGINTVLPLVPQIGMMYLFLSFLEDSGYMARAAFVMDRLMQALGLPGKSFVPLI
FT                   VGFGCNVPSIMGARTLDAQRERLITIMMAPFMSCGARLAIFAVFAAAFFGQDGASIVFS
FT                   LYLLGIAVAILTGLVLKYTIMRGEASPFVMELPVYHVPHLKSLLLQTWQRLKGFVLRAG
FT                   KVIVIASIFIGGLNSFSFNGKPVDSINDSALASVSKVLTPLLMPMGIHADNWQATVGLV
FT                   TGAMAKEVVVGTLNTLYTAEQINNDPFDAENFNLLDELAGAVDETWQGLKDTFSLSVLA
FT                   NPIEASKGDGEMTTGSMGMMSSKFGSSISAYSYLIFVLLYVPCVSVMGAIARETSRGWM
FT                   TFSILWGLNVAYSLATLFYQAATFRDHPQESLSIIVLVIVVNALILFGLRRARSRVTVR
FT                   LQNSEPANCCRSSGSNCH"
FT   misc_feature    complement(142064..142117)
FT                   /gene="feoB"
FT                   /locus_tag="YPO0132"
FT                   /note="one of 10 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    complement(142145..144271)
FT                   /note="Pfam match to entry PF02421 FeoB, , score
FT                   1238.20,E-value 0"
FT                   /inference="protein motif:PF02421"
FT   misc_feature    complement(142148..142213)
FT                   /gene="feoB"
FT                   /locus_tag="YPO0132"
FT                   /note="one of 10 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    complement(142235..142300)
FT                   /gene="feoB"
FT                   /locus_tag="YPO0132"
FT                   /note="one of 10 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    complement(142694..142759)
FT                   /gene="feoB"
FT                   /locus_tag="YPO0132"
FT                   /note="one of 10 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    complement(142865..142930)
FT                   /gene="feoB"
FT                   /locus_tag="YPO0132"
FT                   /note="one of 10 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    complement(142961..143026)
FT                   /gene="feoB"
FT                   /locus_tag="YPO0132"
FT                   /note="one of 10 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    complement(143066..143131)
FT                   /gene="feoB"
FT                   /locus_tag="YPO0132"
FT                   /note="one of 10 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    complement(143111..143134)
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:ProSite:PS00017"
FT   misc_feature    complement(143192..143257)
FT                   /gene="feoB"
FT                   /locus_tag="YPO0132"
FT                   /note="one of 10 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    complement(143279..143344)
FT                   /gene="feoB"
FT                   /locus_tag="YPO0132"
FT                   /note="one of 10 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    complement(143390..143455)
FT                   /gene="feoB"
FT                   /locus_tag="YPO0132"
FT                   /note="one of 10 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    complement(144242..144265)
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:ProSite:PS00017"
FT   CDS_pept        complement(144384..144611)
FT                   /transl_table=11
FT                   /gene="feoA"
FT                   /locus_tag="YPO0133"
FT                   /product="hypothetical ferrous iron transport protein A"
FT                   /note="Similar to Escherichia coli ferrous iron transport
FT                   protein A, the function of which is not known, FeoA
FT                   SW:FEOA_ECOLI (P33649) (75 aa) fasta scores: E():
FT                   5.8e-19,77.5% id in 71 aa"
FT                   /db_xref="GOA:A0A384KPW0"
FT                   /db_xref="InterPro:IPR007167"
FT                   /db_xref="InterPro:IPR008988"
FT                   /db_xref="InterPro:IPR038157"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384KPW0"
FT                   /protein_id="CAL18819.1"
FT                   /translation="MHLIPQRSYKIIGFSPEISPAYRQKLLSLGMLPGSSFNVVRLAPL
FT                   GDPIQIETRRVSLVVRKKDLDLLTLDLQPQ"
FT   CDS_pept        complement(145135..147510)
FT                   /transl_table=11
FT                   /locus_tag="YPO0134"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Escherichia coli protein YhgF
FT                   SW:YHGF_ECOLI (P46837) (773 aa) fasta scores: E(): 0, 82.7%
FT                   id in 791 aa. Also similar to a transcriptional accessory
FT                   protein from Bordetella pertussis, the exact function of
FT                   which is not known: Tex protein SW:TEX_BORPE (Q45388) (791
FT                   aa) fasta scores: E(): 0, 58.6% id in 783 aa"
FT                   /db_xref="GOA:A0A384LBS1"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR006641"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR018974"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR023319"
FT                   /db_xref="InterPro:IPR023323"
FT                   /db_xref="InterPro:IPR032639"
FT                   /db_xref="InterPro:IPR037027"
FT                   /db_xref="InterPro:IPR041692"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384LBS1"
FT                   /protein_id="CAL18820.1"
FT                   /translation="MNEPLSRIIASELQARPEQVISAIRLLDEGNTVPFISRYRKEVTG
FT                   GLDDIQLRQLESRLGYLRELEDRRQTILKSIEDQGKLTDQLAGAINATLSKTELEDLYL
FT                   PYKPKRRTRGQIAIEAGLEPLAERLWQDPQQDPEHTALAYVDADKGVADTKAALDGARY
FT                   ILMERFAEDATLLAKVRQYLWKNAHLVSKVVEGKEQEGAKFRDYFDHHEPIAQVPSHRA
FT                   LAMFRGRNEGVLQLALDPDPQFDEPPRESQGEQIIINHLDLRLNNAPADGWRKAVVNWT
FT                   WRIKVLLHLETELMSTLRERAEDEAINVFARNMQDLLMAAPAGMRATMGLDPGLRTGVK
FT                   VAVVDATGKLVAFDTIYPHTGQAAKAAAVVAALCIKHQVELVAIGNGTASRETERFFVE
FT                   LQQQYPAVTAQKVIVSEAGASVYSASELASQEFPDLDVSIRGAVSIARRLQDPLAELVK
FT                   IDPKSIGVGQYQHDVSQSQLAKKLDAVVEDCVNAVGVDLNTASVPLLTRVAGLTRMMAQ
FT                   NIVNWRDENGRFRNREQLLKVSRLGPKAFEQCAGFLRINHGDNPLDASTVHPEAYPVVE
FT                   RILAATEQALQDLMGNANALRNLNARDFTTERFGVPTVTDILRELEKPGRDPRSEFKTA
FT                   TFAEGVETLNDLTPGMILEGAVTNVTNFGAFVDIGVHQDGLVHISSLADKFVDDPHKVV
FT                   KAGDIVKVKVMEVDLQRKRIALTMRLDEQPGETHSRRSNNGTGSERTNNDNRGVNRPHN
FT                   DAKGHNAPNRAPAKGRSDSSSAGNSAMSDALAAAFKKR"
FT   misc_feature    complement(145354..145575)
FT                   /note="Pfam match to entry PF00575 S1, S1 RNA binding
FT                   domain, score 100.10, E-value 4.5e-26"
FT                   /inference="protein motif:PF00575"
FT   CDS_pept        148044..148559
FT                   /transl_table=11
FT                   /gene="greB"
FT                   /locus_tag="YPO0135"
FT                   /product="transcription elongation factor"
FT                   /note="Similar to Haemophilus influenzae transcription
FT                   elongation factor GreB SW:GREB_HAEIN (P43882) (158 aa)
FT                   fasta scores: E(): 0, 74.4% id in 156 aa"
FT                   /db_xref="GOA:Q8ZJH2"
FT                   /db_xref="InterPro:IPR001437"
FT                   /db_xref="InterPro:IPR006358"
FT                   /db_xref="InterPro:IPR018151"
FT                   /db_xref="InterPro:IPR022691"
FT                   /db_xref="InterPro:IPR023459"
FT                   /db_xref="InterPro:IPR028624"
FT                   /db_xref="InterPro:IPR036805"
FT                   /db_xref="InterPro:IPR036953"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZJH2"
FT                   /protein_id="CAL18821.1"
FT                   /translation="MAKSNYITREGWQALDRELHYLWREERPVVTQAVSEAAAMGDRSE
FT                   NAEYIYGKKRLREIDRRVRFLAKRLEVLKIVDPDPRQEGKVFFGAWVRVENEQEEQRIF
FT                   RLVGPDEFDPAKKWISIDSPVARALIGKQVDDEVTVQTPNGEATYWILEIRYRPFDEDR
FT                   PFNEDIDN"
FT   misc_feature    148047..148514
FT                   /note="Pfam match to entry PF01272 GreA_GreB, Prokaryotic
FT                   transcription elongation factor, GreA/GreB, score
FT                   288.70,E-value 7.2e-83"
FT                   /inference="protein motif:PF01272"
FT   misc_feature    148065..148190
FT                   /note="PS00829 Prokaryotic transcription elongation factors
FT                   signature 1."
FT                   /inference="protein motif:ProSite:PS00829"
FT   misc_feature    148401..148451
FT                   /note="PS00830 Prokaryotic transcription elongation factors
FT                   signature 2."
FT                   /inference="protein motif:ProSite:PS00830"
FT   CDS_pept        148695..149414
FT                   /transl_table=11
FT                   /gene="kmt"
FT                   /gene_synonym="ompB"
FT                   /gene_synonym="ompR"
FT                   /locus_tag="YPO0136"
FT                   /product="transcriptional regulatory protein"
FT                   /note="Similar to Escherichia coli transcriptional
FT                   regulatory protein OmpR SW:OMPR_ECOLI (P03025) (239 aa)
FT                   fasta scores: E(): 0, 98.7% id in 239 aa and to Yersinia
FT                   enterocolitica OmpR TR:P74982 (EMBL:Y08950) (239 aa) fasta
FT                   scores: E(): 0, 98.7% id in 239 aa"
FT                   /db_xref="GOA:A0A384LC72"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384LC72"
FT                   /inference="similar to sequence:INSDC:Y08950"
FT                   /protein_id="CAL18822.1"
FT                   /translation="MQENHKILVVDDDMRLRALLERYLTEQGFQVRSVANAEQMDRLLT
FT                   RESFHLMVLDLMLPGEDGLSICRRLRSQSNPMPIIMVTAKGEEVDRIVGLEIGADDYIP
FT                   KPFNPRELLARIRAVLRRQANELPGAPSQEEAIIAFGKFKLNLGTREMFREDEPMPLTS
FT                   GEFAVLKALVSHPREPLSRDKLMNLARGREYSAMERSIDVQISRLRRMVEEDPAHPRYI
FT                   QTVWGLGYVFVPDGNKA"
FT   misc_feature    148707..149042
FT                   /note="Pfam match to entry PF00072 response_reg, Response
FT                   regulator receiver domain, score 145.90, E-value 7.1e-40"
FT                   /inference="protein motif:PF00072"
FT   misc_feature    149163..149381
FT                   /note="Pfam match to entry PF00486
FT                   trans_reg_C,Transcriptional regulatory protein, C terminal,
FT                   score 126.80, E-value 1.2e-36"
FT                   /inference="protein motif:PF00486"
FT   CDS_pept        149411..150763
FT                   /transl_table=11
FT                   /gene="envZ"
FT                   /gene_synonym="ompB"
FT                   /gene_synonym="perA"
FT                   /gene_synonym="tpo"
FT                   /locus_tag="YPO0137"
FT                   /product="osmolarity sensor protein"
FT                   /EC_number="2.7.3.-"
FT                   /note="Similar to Escherichia coli osmolarity sensor
FT                   protein EnvZ SW:ENVZ_ECOLI (P02933) (450 aa) fasta scores:
FT                   E(): 0, 86.6% id in 440 aa, and to Yersinia enterocolitica
FT                   EnvZ TR:O06468 (EMBL:Y08950) (450 aa) fasta scores: E():
FT                   0,93.8% id in 450 aa"
FT                   /db_xref="GOA:A0A384LJN3"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384LJN3"
FT                   /inference="protein motif:TMHMM:2.0"
FT                   /inference="similar to sequence:INSDC:Y08950"
FT                   /protein_id="CAL18823.1"
FT                   /translation="MKWWRFSPRSSFARTLLLIVTLLFVSLVTTYLVVLNFAILPSLQQ
FT                   FNKVLAYEVRMLMTDRLQLEDGTLLEVPPAFRREIYRELGISLYTNAAAEESGLRWAQH
FT                   YKFLSDQMAQQLGGPTDVRVEVNKNSPVVWLKTWLSPDIWVRVPLTEIHQGDFSPLFRY
FT                   TLAIMLLAVGGAWLFIRIQNRPLVELEHAALQVGKGNIPPPLREYGASEVRSVTRAFNQ
FT                   MAAGVKLLSDDRTLLMAGVSHDLRTPLTRIRLATEMMSEDDAYLSESINKDIEECNAII
FT                   EQFIDYLRTGQEMPTEPSDLNSVLGEVIAAESGYERVIETDLAEGEVLVDIHPLSIKRA
FT                   LTNMVVNAARYGNGWIKVSSGKELQRAWFQVEDDGPGIKPEDLKHLLQPFVRGDSARST
FT                   SGTGLGLAIVQRIIDAHAGSLEIGTSKRGGLRIRAYIPLPLDVKPKPPAVA"
FT   misc_feature    149447..149494
FT                   /note="PS00038 Myc-type, 'helix-loop-helix' dimerization
FT                   domain signature."
FT                   /inference="protein motif:ProSite:PS00038"
FT   misc_feature    149453..149521
FT                   /gene="envZ"
FT                   /gene_synonym="ompB"
FT                   /gene_synonym="perA"
FT                   /gene_synonym="tpo"
FT                   /locus_tag="YPO0137"
FT                   /note="one of 2 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    149888..150097
FT                   /note="Pfam match to entry PF00672 DUF5, HAMP domain, score
FT                   52.10, E-value 1.2e-11"
FT                   /inference="protein motif:PF00672"
FT   misc_feature    149888..149947
FT                   /gene="envZ"
FT                   /gene_synonym="ompB"
FT                   /gene_synonym="perA"
FT                   /gene_synonym="tpo"
FT                   /locus_tag="YPO0137"
FT                   /note="one of 2 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    150137..150721
FT                   /note="Pfam match to entry PF00512 signal, Histidine
FT                   kinase, score 192.80, E-value 5.3e-54"
FT                   /inference="protein motif:PF00512"
FT   CDS_pept        complement(150898..152517)
FT                   /transl_table=11
FT                   /gene="pck"
FT                   /gene_synonym="pckA"
FT                   /locus_tag="YPO0138"
FT                   /product="phosphoenolpyruvate carboxykinase [ATP]"
FT                   /EC_number="4.1.1.49"
FT                   /note="Similar to Escherichia coli phosphoenolpyruvate
FT                   carboxykinase [ATP], PckA SW:PPCK_ECOLI (P22259) (540 aa)
FT                   fasta scores: E(): 0, 87.9% id in 535 aa"
FT                   /db_xref="GOA:Q8ZJG9"
FT                   /db_xref="InterPro:IPR001272"
FT                   /db_xref="InterPro:IPR008210"
FT                   /db_xref="InterPro:IPR013035"
FT                   /db_xref="InterPro:IPR015994"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZJG9"
FT                   /protein_id="CAL18824.1"
FT                   /translation="MSVKGITPQELAAYGIHNVSEIVYNPSYDLLFEEETKPTLEGYER
FT                   GTLTTTGAIAVDTGIFTGRSPKDKYIVRDAITQDTVWWADQGKGKNDNKPLSQEIWNHL
FT                   KGLVTEQLSGKRLFVVDTFCGANADTRLQVRFITEVAWQAHFVKNMFIRPSDEELARFE
FT                   PDFIVMNGAKCTNPQWKEQGLNSENFVAFNLTERMQLIGGTWYGGEMKKGMFSMMNYLL
FT                   PLKGIASMHCSANVGEKGDVAIFFGLSGTGKTTLSTDPKRKLIGDDEHGWDDDGVFNFE
FT                   GGCYAKTIKLSEEAEPDIYHAIKRDALLENVVVLADGTVDFNDGSKTENTRVSYPIYHI
FT                   DNIVKPVSKAGHATKVIFLTADAFGVLPPVSRLTANQTQYHFLSGFTAKLAGTERGVTE
FT                   PTPTFSACFGAAFLSLHPTQYAEVLVKRMQAVGAQAYLVNTGWNGTGKRISIKDTRAII
FT                   DAILNGEIDKAETFTLPIFDLAVPMALPGVNPDILDPRDTYADKAQWQEKAEDLAKRFA
FT                   TNFDKYTDTPAGAALVSAGPKI"
FT   misc_feature    complement(151042..152466)
FT                   /note="Pfam match to entry PF01293
FT                   PEPCK_ATP,Phosphoenolpyruvate carboxykinase, score 1212.90,
FT                   E-value 0"
FT                   /inference="protein motif:PF01293"
FT   misc_feature    complement(151681..151728)
FT                   /note="PS00532 Phosphoenolpyruvate carboxykinase (ATP)
FT                   signature."
FT                   /inference="protein motif:ProSite:PS00532"
FT   misc_feature    complement(151756..151779)
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:ProSite:PS00017"
FT   CDS_pept        complement(152714..153595)
FT                   /transl_table=11
FT                   /gene="hslO"
FT                   /locus_tag="YPO0139"
FT                   /product="heat-shock chaperonin"
FT                   /note="Similar to Escherichia coli 33 kDa chaperonin HslO
FT                   SW:HSLO_ECOLI (P45803) (292 aa) fasta scores: E(): 0, 71.7%
FT                   id in 293 aa"
FT                   /db_xref="GOA:Q8ZJG8"
FT                   /db_xref="InterPro:IPR000397"
FT                   /db_xref="InterPro:IPR016153"
FT                   /db_xref="InterPro:IPR016154"
FT                   /db_xref="InterPro:IPR023212"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZJG8"
FT                   /protein_id="CAL18825.1"
FT                   /translation="MSNHDQLHRYLFANHAVRGELVSVNETYQQVLANHDYPPAVQKLL
FT                   GEMLVATSLLTATLKFDGDITVQLQGGDGPLTLAVINGNNRQEMRGVARVKGEISDDST
FT                   LQEMVGNGYLVITITPAQGERYQGVVALEGETIAACLENYFMQSEQLPTRLFIRTGHVA
FT                   DKAAAGGMLLQVLPAQERNEDEFDHLAQLTATIKAEELFTLPANEVLYRLYHQEEVTLY
FT                   EPQNVSFRCTCSRQRCADALVTLADDDVTEMLEQDGNIDMHCEYCGNHYLFDAVDIATL
FT                   KNGNSASSEQIH"
FT   misc_feature    complement(152753..153583)
FT                   /note="Pfam match to entry PF01430 HSP33, Hsp33
FT                   protein,score 487.10, E-value 1.4e-142"
FT                   /inference="protein motif:PF01430"
FT   CDS_pept        complement(153758..154165)
FT                   /transl_table=11
FT                   /gene="hslR"
FT                   /locus_tag="YPO0140"
FT                   /product="heat shock protein 15"
FT                   /note="Similar to Escherichia coli heat shock protein 15
FT                   HslR SW:HSLR_ECOLI (P45802) (133 aa) fasta scores: E():
FT                   0,73.3% id in 135 aa"
FT                   /db_xref="GOA:A0A384L7J2"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR025708"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384L7J2"
FT                   /protein_id="CAL18826.1"
FT                   /translation="MKDKISPAESVRLDKWLWAARFYKTRAIARDMVDGGKVHYNGQRS
FT                   KPSKLVELHAEIRLRQGNDERTVRVLALHSQRRGAEEAQTLYEETEASIANREKVAQAR
FT                   KLNALTMPHPDRRPDKKERRNLIKFKQGEPE"
FT   misc_feature    complement(153995..154135)
FT                   /note="Pfam match to entry PF01479 S4, S4 domain, score
FT                   54.00, E-value 3.2e-12"
FT                   /inference="protein motif:PF01479"
FT   CDS_pept        complement(154194..154874)
FT                   /transl_table=11
FT                   /locus_tag="YPO0141"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Escherichia coli hypothetical protein
FT                   YrfG SW:YRFG_ECOLI (P45801) (222 aa) fasta scores: E():
FT                   0,67.0% id in 221 aa"
FT                   /db_xref="GOA:A0A384L9U0"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384L9U0"
FT                   /protein_id="CAL18827.1"
FT                   /translation="MPPDFNWQEIDTVLLDMDGTLLDLAFDSHFWLKLVPETLSQRRGI
FT                   PLEQAHKIIHDEYNAVQHTLNWYCFDYWRERLDLDIYAMTTDIGSRARLRQDTVPFLSG
FT                   LRQHGLQTILLTNAHPHSLAVKIEHTALDQHLDLLLSTHTFGYPKEDQRLWQAVTQHTG
FT                   LNPARTLFVDDSEAILDAAQTFGIRYCLGVENPDSSCADKTFHRHPAINDYRKLLPALQ
FT                   LRCE"
FT   misc_feature    complement(154290..154847)
FT                   /note="Pfam match to entry PF00702 Hydrolase, haloacid
FT                   dehalogenase-like hydrolase, score 93.60, E-value 4e-24"
FT                   /inference="protein motif:PF00702"
FT   CDS_pept        complement(155018..157165)
FT                   /transl_table=11
FT                   /locus_tag="YPO0142"
FT                   /product="putative membrane protein"
FT                   /note="Similar to Escherichia coli hypothetical 79.5 kDa
FT                   protein in mrcA-pckA intergenic region YrfF SW:YRFF_ECOLI
FT                   (P45800) (711 aa) fasta scores: E(): 0, 53.6% id in 715 aa
FT                   and to Proteus mirabilis UmoB TR:O86988 (EMBL:U66822) (702
FT                   aa) fasta scores: E(): 0, 43.4% id in 719 aa"
FT                   /db_xref="GOA:P58722"
FT                   /db_xref="InterPro:IPR010771"
FT                   /db_xref="UniProtKB/Swiss-Prot:P58722"
FT                   /inference="protein motif:TMHMM:2.0"
FT                   /inference="similar to sequence:INSDC:U66822"
FT                   /protein_id="CAL18828.1"
FT                   /translation="MSTIVLILALLLTSLIAVGLLWWLRFRRPHPITAALPFVKLTHRK
FT                   LTPEERVSIENYLRNQQNKHGFNTQPAFDSHALAASTSSTPMLVLTPQSDNVYSVTRAI
FT                   TRYGVASDEPNKWRYYLDSIEVHLPSAWEQYITQDNDVELIQTQTIPLVISLNGHTLNN
FT                   HQSENTYQPILPSVSKNASIRKEDSEHIELLNIRKETPEEYALHGPNGLKEACAICIAL
FT                   LLLFFALSGPTVTLPWLVIVAVSLTCWACWYLFRPLSEKDLREVHCLNGTPKRWGLFGE
FT                   SNQGQINNISLGIVDLIYPAHWGPYFVHDLGKKTHIDIYLNRQVVRQGAFLSLHDEMKM
FT                   FPLQRWGKNLTLIVGSLLVLVLLLIYVPLGLPLKLSVAWLQGAQSQQVTSVAALDKMPL
FT                   RIGDMLKAQGNGMCYVPPNIQNTRGFVFTPFDCSGIYWNTASPLPQPESETIEKAAALV
FT                   ETINKQLHPQGSDASVNPKLATAIEKSGMILLDDFSDIVLKTQALCSENTDCIRLKNAL
FT                   VNLGNAKNWSALVKRAQSGNLEGMNVLLRPISADVLENLINTAASSFVYRETHLATEAL
FT                   NSPPPGGFLITSDEGKQLVNHPAPTLPLFDYSALEQWRELQRLSALLLDTPFKAEGIIT
FT                   NITTDANGTRHIALHSEPDIVTLGRYLATSLLLLVLIFCLVVNMVLLIQRAMKNRRRMD
FT                   NIQRYYDDCFNQTLTPPPFLR"
FT   misc_feature    complement(155117..155182)
FT                   /locus_tag="YPO0142"
FT                   /note="one of 5 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    complement(156053..156118)
FT                   /locus_tag="YPO0142"
FT                   /note="one of 5 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    complement(156401..156466)
FT                   /locus_tag="YPO0142"
FT                   /note="one of 5 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    complement(156482..156547)
FT                   /locus_tag="YPO0142"
FT                   /note="one of 5 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    complement(157088..157153)
FT                   /locus_tag="YPO0142"
FT                   /note="one of 5 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        157445..157639
FT                   /transl_table=11
FT                   /locus_tag="YPO0143"
FT                   /product="hypothetical protein"
FT                   /note="Doubtful CDS with no significant database hits"
FT                   /db_xref="UniProtKB/TrEMBL:Q74Y35"
FT                   /protein_id="CAL18829.1"
FT                   /translation="MLKTSKLYLTGIAIKVLINAQCDQVLIYPLSLTLQGCWLRVLTRI
FT                   TDLSQLIGIRVLAAYLQSQ"
FT   CDS_pept        157752..158297
FT                   /transl_table=11
FT                   /locus_tag="YPO0144"
FT                   /product="putative hydrolase"
FT                   /note="Similar to Escherichia coli ADP compounds hydrolase
FT                   NudE SW:NUDE_ECOLI (P45799) (186 aa) fasta scores: E():
FT                   0,74.7% id in 178 aa"
FT                   /db_xref="GOA:A0A384KTV7"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384KTV7"
FT                   /protein_id="CAL18830.1"
FT                   /translation="MKHLQKPKILKIETVACSRLFNVEAVELEFSNGVQRIYERMRPSN
FT                   REAVMIVPVIGNDLLLIREYAVGIEEYELGFPKGLIDPGEGVLEAANRELMEEVGYGAE
FT                   RFDFLAKLTMAPSYFSSKMNIVIAHGLYPQSLEGDEPEPLPQVRWPIANMMALLNEADF
FT                   REARNVSALFLAHTFLNQ"
FT   misc_feature    157884..158279
FT                   /note="Pfam match to entry PF00293 mutT, Bacterial mutT
FT                   protein, score 61.90, E-value 1.4e-14"
FT                   /inference="protein motif:PF00293"
FT   misc_feature    157986..158045
FT                   /note="PS00893 mutT domain signature."
FT                   /inference="protein motif:ProSite:PS00893"
FT   CDS_pept        complement(158433..160988)
FT                   /transl_table=11
FT                   /gene="b3396"
FT                   /gene_synonym="mrcA"
FT                   /gene_synonym="ponA"
FT                   /locus_tag="YPO0145"
FT                   /product="penicillin-binding protein"
FT                   /EC_number="2.4.2.-"
FT                   /note="Similar to Escherichia coli penicillin-binding
FT                   protein 1A MrcA SW:PBPA_ECOLI (P02918) (850 aa) fasta
FT                   scores: E(): 0, 77.8% id in 851 aa"
FT                   /db_xref="GOA:A0A384KM08"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR031376"
FT                   /db_xref="InterPro:IPR036950"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384KM08"
FT                   /protein_id="CAL18831.1"
FT                   /translation="MKFVKYFLILAVCCILLGAASIFGLYKYIEPQLPDVATLKDIRLQ
FT                   TPMQVYSAEGELIAQFGEKRRIPLTLNQIPPEMVHAFIATEDSRFYDHHGVDPVGILRA
FT                   VSIAMLSGRASQGASTITQQLARNFFLSPERTLMRKIKEAFLAIRIEQMLTKDEILELY
FT                   LNKIYLGYRAYGVGAAAQVYFGKEVHELTLSQIAMIAGLPKAPSTFNPLYSHDRAVARR
FT                   NVVLLRMLDEKYITQAQYDQARSEELVANYHVPQIAFSAPYLAEMVRQEMIKRYGENAY
FT                   TDGYQVYTTITRKLQLAAVDSLRANVLAYDMRHGYRGPSNVLWKVGESAWSREQIIDSL
FT                   KALPVYGPLLPAVVTEADAAQATAMLADGSNVTLPMVGIRWARPFKSDNAQGPVPKKAT
FT                   DVVQPGQQIWVRKVDDNWWLAQVPDVNSALVSIDPNNGAIKALVGGFDFNQSKFNRATQ
FT                   ALRQVGSNIKPFLYTAAMDKGLTLATILNDLPITRWDSGAGTDWRPKNSPPTYDGPIRL
FT                   RQGLGQSKNVVMVRAMRAMGVDYAAEYLQRFGFPAQNIVHSESLALGSASFTPLQLVRG
FT                   YAVLANGGYLVDPYFITKITDDVGNVLFETKPKVVCDNCNLPVIYGDTQRSVVLSDDNI
FT                   ENVATSQNQNASNVPMPELEQVTPAQTTLNSEQQYAPHVISTPLAFLMRDALNSNIFGE
FT                   PGWMGTGWRAGRDLKRKDIGGKTGTTNSSKDAWFSGYGPDTVTSVWIGFDDHRRNLGRS
FT                   TASGAIPDQISGAEGGAKTAQPAWNDFMKVALEGLPEKQVPPPPGIVSVVIDKQTGKLS
FT                   NGGPGSRSEYFIDGTQPTEHTVHEVGTTLMDNGQTHELF"
FT   misc_feature    complement(158652..159782)
FT                   /note="Pfam match to entry PF00905
FT                   Transpeptidase,Penicillin binding protein transpeptidase
FT                   domain, score 42.00, E-value 4.6e-09"
FT                   /inference="protein motif:PF00905"
FT   misc_feature    complement(160341..160847)
FT                   /note="Pfam match to entry PF00912
FT                   Transglycosyl,Transglycosylase, score 372.80, E-value
FT                   3.5e-108"
FT                   /inference="protein motif:PF00912"
FT   CDS_pept        161063..162004
FT                   /transl_table=11
FT                   /locus_tag="YPO0146"
FT                   /product="hypothetical protein"
FT                   /note="Weakly similar to Escherichia coli hypothetical
FT                   protein YrfD SW:YRFD_ECOLI (P45753) (259 aa) fasta scores:
FT                   E(): 9.6e-09, 25.1% id in 291 aa"
FT                   /db_xref="InterPro:IPR005883"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384KHE2"
FT                   /protein_id="CAL18832.1"
FT                   /translation="MDTFFYSVSTWRSIKMYSQYWQVGLDIQMEAIRALAVIRRRNGWQ
FT                   LRYWWHKILPSGVLREGILHQPDILSEQLKLLRKQLPRHISLRIALPAQRILQHTIHVP
FT                   DRRLREPERDGFIKASASRLFPVNSQALALDYCRETVASSELLITAARQSEVQQWQACL
FT                   EQAGLSSQVIDIAPCALRYMATATGLSGPYWLVHRLANEWLWVSSSDMPFHSGVVAIET
FT                   ECRTQENDIRLLSALLAQLNMRGAGEDGAPLPVYYSSVVKESLPENTRSWSPLTAFAHY
FT                   QPPLPALPAAFTLAGGLAVRAADSLSAAGAGY"
FT   CDS_pept        162004..162609
FT                   /transl_table=11
FT                   /locus_tag="YPO0147"
FT                   /product="putative membrane protein"
FT                   /note="Similar to Haemophilus influenzae competence protein
FT                   B ComB SW:COMB_HAEIN (P31769) (168 aa) fasta scores: E():
FT                   0.018, 26.6% id in 169 aa and to Escherichia coli
FT                   hypothetical protein YrfC SW:YRFC_ECOLI (P45752) (179 aa)
FT                   fasta scores: E(): 2.7e-07, 25.7% id in 179 aa"
FT                   /db_xref="InterPro:IPR007813"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384KK04"
FT                   /protein_id="CAL18833.1"
FT                   /translation="MYQVNFLPWRIARQQARYRFWRNTMLIQGIGLALYLVVVLMQARS
FT                   EHKHRQGTAAALSQQQAALSQRQQQVQQAMAQLQRIKQHIQRYHQAHQPARGYSILLQQ
FT                   LSQQIPERCWLMALRQQGDVLSFEVISRDYATINAFLAMLGRQPLLVNVSLQGITQQDE
FT                   GGFRFVVHASWRDENHHVEGHHAEGHDIDGHHVAGDYE"
FT   misc_feature    162061..162129
FT                   /note="1 probable transmembrane helix predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        162602..163183
FT                   /transl_table=11
FT                   /locus_tag="YPO0148"
FT                   /product="putative membrane protein"
FT                   /note="No significant database hits"
FT                   /db_xref="GOA:A0A384KTJ8"
FT                   /db_xref="InterPro:IPR006052"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384KTJ8"
FT                   /protein_id="CAL18834.1"
FT                   /translation="MNKSLQRCMDRPGWQLCLWQWFFLSLLGVIAYGGLLRPTWQQRSE
FT                   AIAEVTKLQQHVEQQVSALAQLPSQVLIRQQINTLLSEKAWWQKPEILLAHQVGETIMP
FT                   FGGQVIRWQRYSGSEEAVVENAIAFRRWEATLRVSFYGLYHLFGQLSEIRSPVLVKVIS
FT                   LIGDGNALTVKLILTEYLTDDLGDFDVQDK"
FT   misc_feature    162638..162706
FT                   /note="1 probable transmembrane helix predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        163209..163577
FT                   /transl_table=11
FT                   /locus_tag="YPO0149"
FT                   /product="putative membrane protein"
FT                   /note="Doubtful CDS, no significant database hits"
FT                   /db_xref="InterPro:IPR019684"
FT                   /db_xref="UniProtKB/TrEMBL:Q0WKF3"
FT                   /protein_id="CAL18835.1"
FT                   /translation="MLAMGLAATRLLVIGLLPSSIFASPHLANIERDPFQAVLATSCDS
FT                   ERERLTGWKLHGVVSGGGYQSAWIQRPDATWQRLTLGMRLVSEWQVTQISAQWVDFQYE
FT                   NPETPCSGLSVTFSLFQQ"
FT   misc_feature    163983..165122
FT                   /note="Pfam match to entry PF00263
FT                   Bac_GSPproteins,Bacterial type II secretion system protein,
FT                   score 224.00,E-value 2.1e-63"
FT                   /inference="protein motif:PF00263"
FT   CDS_pept        164004..165128
FT                   /transl_table=11
FT                   /locus_tag="YPO0150"
FT                   /product="putative membrane transport protein"
FT                   /note="Similar to Haemophilus influenzae competence protein
FT                   E precursor ComE or HI0435 SW:COME_HAEIN (P31772) (445 aa)
FT                   fasta scores: E(): 0, 42.1% id in 387 aa, and to
FT                   Escherichia coli protein transport protein hofQ precursor
FT                   SW:HOFQ_ECOLI (P34749) (412 aa) fasta scores: E(): 0, 48.6%
FT                   id in 381 aa. Note the differing N-terminal region and the
FT                   low G+C content of the upstream DNA region."
FT                   /db_xref="GOA:Q0WKF2"
FT                   /db_xref="InterPro:IPR001775"
FT                   /db_xref="InterPro:IPR004846"
FT                   /db_xref="InterPro:IPR005644"
FT                   /db_xref="InterPro:IPR013355"
FT                   /db_xref="InterPro:IPR038591"
FT                   /db_xref="UniProtKB/TrEMBL:Q0WKF2"
FT                   /protein_id="CAL18836.1"
FT                   /translation="MQALADYRQLNLITTTGVGGNLSLRLIEVPWEQALAIILRMGRLK
FT                   AEREGTVMMVFTEQEIQERQQRTKQQAAPEALANLTLALQYANAEQVADSLDPLQGGLL
FT                   SPLGSVVADKRTNTLLIRDTPASLALLKNWLIEMDLPLQQVQLSAHIVTISSEDLQELG
FT                   VRWGMGEGKGNTALRINDFNVNLPLPNSAASVGFHVARIGGRLLELELSALEQENQVDI
FT                   IASPRLITSHQQTASIKQGSDIPYTVSRGKKEAAAIEFKEAVLGMEVTPKILRNGKIIL
FT                   DLKISQNMPGITIKRGESEMLLIDKQEIKTQVTVNDGETIVLGGIFQQKKRQSVNKVPL
FT                   LADIPLLGAMFRQDTQQQSRRELVIFITPKLISA"
FT   CDS_pept        165477..165998
FT                   /transl_table=11
FT                   /gene="aroK"
FT                   /locus_tag="YPO0151"
FT                   /product="shikimate kinase I"
FT                   /EC_number="2.7.1.71"
FT                   /note="Similar to Escherichia coli shikimate kinase I AroK
FT                   SW:AROK_ECOLI (P24167) (172 aa) fasta scores: E(): 0, 95.3%
FT                   id in 172 aa"
FT                   /db_xref="GOA:Q8ZJF7"
FT                   /db_xref="InterPro:IPR000623"
FT                   /db_xref="InterPro:IPR023000"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031322"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZJF7"
FT                   /protein_id="CAL18837.1"
FT                   /translation="MAEKRNIFLVGPMGAGKSTIGRQLAQQLNMEFFDSDQEIERRTGA
FT                   DVGWVFDVEGEEGFRDREEKVINELTEKQGIVLATGGGSVKSRETRNRLSARGVVVYLE
FT                   TTIEKQLARTQRDKKRPLLQVDEPPREVLEALAKERNPLYEEIADVTIRTDDQSAKVVA
FT                   NQIINMLESN"
FT   misc_feature    165489..165986
FT                   /note="Pfam match to entry PF01202 SKI, Shikimate
FT                   kinase,score 302.50, E-value 5.2e-87"
FT                   /inference="protein motif:PF01202"
FT   misc_feature    165507..165530
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:ProSite:PS00017"
FT   misc_feature    165654..165731
FT                   /note="PS01128 Shikimate kinase signature."
FT                   /inference="protein motif:ProSite:PS01128"
FT   CDS_pept        166055..167143
FT                   /transl_table=11
FT                   /gene="aroB"
FT                   /locus_tag="YPO0152"
FT                   /product="3-dehydroquinate synthase"
FT                   /EC_number="4.2.3.4"
FT                   /note="Similar to Escherichia coli 3-dehydroquinate
FT                   synthase AroB SW:AROB_ECOLI (P07639) (362 aa) fasta scores:
FT                   E(): 0, 81.4% id in 361 aa"
FT                   /db_xref="GOA:Q8ZJF6"
FT                   /db_xref="InterPro:IPR016037"
FT                   /db_xref="InterPro:IPR030960"
FT                   /db_xref="InterPro:IPR030963"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZJF6"
FT                   /protein_id="CAL18838.1"
FT                   /translation="MEKITVTLGERSYPITIAAGLFNDPASFKPLKAGDQVMLVTNQTL
FT                   APLYLDSLRAVLEHGGIKVDQVILPDGEQYKSLSVMEQVFSALLEKPHGRDTTLVALGG
FT                   GVVGDLTGFAAACYQRGVRFIQVPTTLLSQVDSSVGGKTAVNHPLGKNMIGAFYQPASV
FT                   VVDLNCLKTLPPRELASGLAEVIKYGIILDAAFFDWLENNIDALLALDMSALAYCIRRC
FT                   CELKADVVAADEREESGARALLNLGHTYGHAIEAEMGYGVWLHGEAVAAGMVMAAQTSR
FT                   RLGQLSVSDVERIKKLLLRAGLPVCGPKEMAPESYLPHMMRDKKVLAGELRLVLPTAIG
FT                   KSEIRGGVAHDMVLASIADCRP"
FT   misc_feature    166100..167128
FT                   /note="Pfam match to entry PF01761
FT                   DHQ_synthase,3-dehydroquinate synthase, score 668.40,
FT                   E-value 3.6e-197"
FT                   /inference="protein motif:PF01761"
FT   CDS_pept        167397..168386
FT                   /transl_table=11
FT                   /locus_tag="YPO0153"
FT                   /product="conserved hypothetical membrane protein"
FT                   /note="Similar to Escherichia coli DamX protein an
FT                   inhibitor of cell-division, mode of action
FT                   unknown,SW:DAMX_ECOLI (P11557) (427 aa) fasta scores: E():
FT                   8.5e-18,41.6% id in 361 aa"
FT                   /db_xref="GOA:A0A384K813"
FT                   /db_xref="InterPro:IPR007730"
FT                   /db_xref="InterPro:IPR032899"
FT                   /db_xref="InterPro:IPR036680"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384K813"
FT                   /protein_id="CAL18839.1"
FT                   /translation="MDDLKLDDDLKPDSSDRRPTRSRKSPTGPKLAVSRQHMMIGIGIL
FT                   VLLLIIIAIGSALKAPTEHEASQQNPNVNAARDINLSDSSSLTSGNNSQPSIANNTSDG
FT                   HDASGVKNTAPPQDISAPPISPTPTEAAIPPSANSTTQRIELPGNMSDALSQTQGQVDT
FT                   LSQNISDAHTSTLPTAAATVAPSKGAKVPATRETITQPVQKQATKQPAVNHKNTATVAV
FT                   PPATSGTPKSGAASSRALSSAPSSHYTLQLSSASRSDTLNAYAKQQNLTDYHVYETKRD
FT                   GKPWYILVSGNYASSAEAKKAITTLPADVQAKKPWVKPVQQVQQDLKK"
FT   misc_feature    167502..167570
FT                   /note="1 probable transmembrane helix predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        168470..169285
FT                   /transl_table=11
FT                   /gene="dam"
FT                   /locus_tag="YPO0154"
FT                   /product="DNA adenine methylase"
FT                   /EC_number="2.1.1.72"
FT                   /note="Similar to Serratia marcescens DNA adenine methylase
FT                   Dam SW:DMA_SERMA (P45454) (270 aa) fasta scores: E():
FT                   0,84.8% id in 270 aa, and to Yersinia pseudotuberculosis
FT                   DNA adenine methylase Dam TR:AAG23175 (EMBL:AF274318) (271
FT                   aa) fasta scores: E(): 0, 100.0% id in 271 aa"
FT                   /db_xref="GOA:A0A384LMM2"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR012263"
FT                   /db_xref="InterPro:IPR012327"
FT                   /db_xref="InterPro:IPR023095"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384LMM2"
FT                   /inference="similar to sequence:INSDC:AF274318"
FT                   /protein_id="CAL18840.1"
FT                   /translation="MKKNRAFLKWAGGKYPLVDDIRRHLPAGDCLIEPFVGAGSVFLNT
FT                   EFESYILADINNDLINLYNIVKLRTDDFVRDARVLFTGDFNHSELFYQLRQEFNASTDA
FT                   YRRALLFLYLNRHCYNGLCRYNLSGEFNVPFGRYKKPYFPEAELYWFAEKSQNAVFVCE
FT                   HYQETLLKAVQGAVVYCDPPYAPLSATANFTAYHTNNFGIADQQNLARLAYQLSTESKV
FT                   PVLISNHDTELTRNWYHQAASLHVVTARRTISRNILGRSKVNELLALYS"
FT   misc_feature    168497..169228
FT                   /note="Pfam match to entry PF02086 MethyltransfD12, D12
FT                   class N6 adenine-specific DNA methyltransferase, score
FT                   339.30, E-value 4.2e-98"
FT                   /inference="protein motif:PF02086"
FT   misc_feature    169001..169021
FT                   /note="PS00092 N-6 Adenine-specific DNA methylases
FT                   signature."
FT                   /inference="protein motif:ProSite:PS00092"
FT   CDS_pept        169588..170265
FT                   /transl_table=11
FT                   /gene="rpe"
FT                   /locus_tag="YPO0155"
FT                   /product="ribulose-phosphate 3-epimerase"
FT                   /EC_number="5.1.3.1"
FT                   /note="Similar to Escherichia coli ribulose-phosphate
FT                   3-epimerase Rpe SW:RPE_ECOLI (P32661) (225 aa) fasta
FT                   scores: E(): 0, 88.6% id in 220 aa"
FT                   /db_xref="GOA:A0A384LEX0"
FT                   /db_xref="InterPro:IPR000056"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR026019"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384LEX0"
FT                   /protein_id="CAL18841.1"
FT                   /translation="MKKYLIAPSILSADFARLGEDTAKVLAAGADIVHFDVMDNHYVPN
FT                   LTIGPMVCKALRDYGITAPIDVHLMVKPVDRIVPDFAKAGATYITFHPEASEHVDRTLQ
FT                   LIKESGCKAGLVFNPATPLSYLDYVMDKLDVILLMSVNPGFGGQSFIPETLNKLRQVRK
FT                   LIDDSGYDIRLEVDGGVKVENIRQIAAAGADMFVAGSAIFNQPDYAAVIDAMRNELAMA
FT                   ANG"
FT   misc_feature    169600..170205
FT                   /note="Pfam match to entry PF00834
FT                   Ribul_P_3_epim,Ribulose-phosphate 3 epimerase family, score
FT                   476.40,E-value 2.3e-139"
FT                   /inference="protein motif:PF00834"
FT   misc_feature    169684..169728
FT                   /note="PS01085 Ribulose-phosphate 3-epimerase family
FT                   signature 1."
FT                   /inference="protein motif:ProSite:PS01085"
FT   misc_feature    169993..170061
FT                   /note="PS01086 Ribulose-phosphate 3-epimerase family
FT                   signature 2."
FT                   /inference="protein motif:ProSite:PS01086"
FT   CDS_pept        170258..170956
FT                   /transl_table=11
FT                   /gene="gph"
FT                   /locus_tag="YPO0156"
FT                   /product="phosphoglycolate phosphatase"
FT                   /EC_number="3.1.3.18"
FT                   /note="Similar to Escherichia coli phosphoglycolate
FT                   phosphatase Gph SW:GPH_ECOLI (P32662) (252 aa) fasta
FT                   scores: E(): 0, 60.5% id in 248 aa"
FT                   /db_xref="GOA:Q8ZJF3"
FT                   /db_xref="InterPro:IPR006346"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR037512"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZJF3"
FT                   /protein_id="CAL18842.1"
FT                   /translation="MVKFKAIRGVAFDLDGTLVDSAPGLARAIDMALAHQGLPAAGEAL
FT                   VSTWIGNGADVLVERALHWAGREHNAQLVAQTRELFDHYYAKTVEQGSQLFPQVKATLA
FT                   QLAANGLPIGLITNKPTPFVAPLLTSLGISDYFSVIIGGDDVVVKKPHPAPLYLLLGKL
FT                   GLHAREMLFVGDSRNDIMAAQAAGCPCIGLTYGYNYGEAIATSHPDCVLAHFADLLPAI
FT                   GLPSLKDQEV"
FT   misc_feature    170276..170845
FT                   /note="Pfam match to entry PF00702 Hydrolase, haloacid
FT                   dehalogenase-like hydrolase, score 178.70, E-value 9.5e-50"
FT                   /inference="protein motif:PF00702"
FT   CDS_pept        170958..171998
FT                   /transl_table=11
FT                   /gene="trpS"
FT                   /locus_tag="YPO0157"
FT                   /product="tryptophanyl-tRNA synthetase"
FT                   /EC_number="6.1.1.2"
FT                   /note="Similar to Escherichia coli tryptophanyl-tRNA
FT                   synthetase TrpS SW:SYW_ECOLI (P00954) (334 aa) fasta
FT                   scores: E(): 0, 85.2% id in 332 aa"
FT                   /db_xref="GOA:Q8ZJF2"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002305"
FT                   /db_xref="InterPro:IPR002306"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR024109"
FT                   /db_xref="PDB:3N9I"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZJF2"
FT                   /protein_id="CAL18843.1"
FT                   /translation="MSEPMVLSKPTVSSKPIVFSGAQPSGELTIGNYMGALRQWVQMQD
FT                   DYDCIYCIVDLHAITARQDPALLRKRTLDTLALYLACGIDPKKSTIFVQSHVPEHSQLS
FT                   WALNCYTYFGELSRMTQFKDKSARYAENINAGLFDYPVLMAADILLYQTNQVPVGEDQK
FT                   QHLELSRDIASRFNNLYGDIFKIPEPFIPKAGARVMSLQDPTKKMSKSDDNRNNVIELL
FT                   EDPKSVVKKIKRAMTDSDEPALIRYDVEKKAGVSNLLDILSGVTGQSIPELEAQFTGQM
FT                   YGHLKGAVADAVSGMLSELQERYRTYREDEALLQDVMREGAAKARARAQVTLAKVYEAI
FT                   GFVAQP"
FT   misc_feature    171009..171677
FT                   /note="Pfam match to entry PF00579 tRNA-synt_1b, tRNA
FT                   synthetases class I (W and Y), score 351.80, E-value
FT                   7.5e-102"
FT                   /inference="protein motif:PF00579"
FT   misc_feature    171027..171056
FT                   /note="PS00178 Aminoacyl-transfer RNA synthetases class-I
FT                   signature."
FT                   /inference="protein motif:ProSite:PS00178"
FT   repeat_region   172072..172158
FT                   /note="5 x 18bp repeats"
FT   CDS_pept        complement(172153..173565)
FT                   /transl_table=11
FT                   /gene="cysG"
FT                   /locus_tag="YPO0158"
FT                   /product="siroheme synthase"
FT                   /EC_number="2.1.1.107"
FT                   /note="Similar to Escherichia coli siroheme synthase
FT                   involved in porphyrin biosynthesis, CysG SW:CYSG_ECOLI
FT                   (P11098) (457 aa) fasta scores: E(): 0, 72.6% id in 456 aa"
FT                   /db_xref="GOA:Q74Y23"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR003043"
FT                   /db_xref="InterPro:IPR006366"
FT                   /db_xref="InterPro:IPR006367"
FT                   /db_xref="InterPro:IPR012409"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR019478"
FT                   /db_xref="InterPro:IPR028281"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR037115"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q74Y23"
FT                   /protein_id="CAL18844.1"
FT                   /translation="MDYFPIFCQLQHKACLLVGGGEIAERKARLLLDAGALVTVNACEF
FT                   TPQFHHWADQGQLSLISGEFVPELLADKWLVIAATDQLSVNALVYQSANQQRIFCNVVD
FT                   DPKRTSFIMPSIIDRSPIMIAVSSGGKAPVLARLLREKLEALLPQHLGQLAGNLRQRVK
FT                   QHFTVMTERRRFWEKLLTHDRLAQSLANNDHVQADQHVEQLFSAPLTDRGEVVLVGAGP
FT                   GDAGLLTLKGLQQIQQADVVVYDRLVSDEVMNLVRRDAERIFVGKQSGHHCVPQEQINQ
FT                   ILLQQAQSGKRVVRLKGGDPFIFGRGGEELEELAGYGIPFSVVPGITAASGCSAYSGIP
FT                   LTHRDHAQSVRLVTGHAKKEGQLDWANLAAEKQTLVFYMGLSQAGEIQQQLIQHGMPAT
FT                   TQVALVENGTSRHQRVVSGELSQLALLSQQVSSPSLIIVGSVVSLREKLNWFSSRHHDD
FT                   QPKVTECVAHVG"
FT   misc_feature    complement(172294..172926)
FT                   /note="Pfam match to entry PF00590
FT                   TP_methylase,Tetrapyrrole (Corrin/Porphyrin) Methylases.,
FT                   score 315.40,E-value 6.5e-91"
FT                   /inference="protein motif:PF00590"
FT   misc_feature    complement(172588..172689)
FT                   /note="PS00840 Uroporphyrin-III C-methyltransferase
FT                   signature 2."
FT                   /inference="protein motif:ProSite:PS00840"
FT   misc_feature    complement(172870..172914)
FT                   /note="PS00839 Uroporphyrin-III C-methyltransferase
FT                   signature 1."
FT                   /inference="protein motif:ProSite:PS00839"
FT   CDS_pept        complement(173653..174459)
FT                   /transl_table=11
FT                   /gene="nirC"
FT                   /locus_tag="YPO0159"
FT                   /product="putative nitrite transporter"
FT                   /note="Similar to Escherichia coli putative nitrite
FT                   transporter NirC SW:NIRC_ECOLI (P11097) (268 aa) fasta
FT                   scores: E(): 0, 82.7% id in 266 aa"
FT                   /db_xref="GOA:A0A384KWQ4"
FT                   /db_xref="InterPro:IPR000292"
FT                   /db_xref="InterPro:IPR023271"
FT                   /db_xref="InterPro:IPR024002"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384KWQ4"
FT                   /inference="protein motif:TMHMM:2.0"
FT                   /protein_id="CAL18845.1"
FT                   /translation="MYTDTINKCAANAARIVKLAKESPLGFWIGSAMAGAYVGLGIILI
FT                   FTLGNLIDPALRPLVMGATFGLALTLVIIAGSELFTGHTMFLTFGVKAGTIKSSQMWAV
FT                   LPQTWLGNLLGSVFVALLYYYGGGNLLSVDTSLVHTAALAKTTAPAMTLFFKGVLCNWL
FT                   VCLAIWMAIRVEGAAKFIAIWWCLLAFIASGYEHSVANMTLLALSWFGHHSEAYTLSGI
FT                   GHNLLWVTLGNTLSGAVFMGLGYWYATPRAQRPQPATINAPHSAKS"
FT   misc_feature    complement(173698..174459)
FT                   /note="Pfam match to entry PF01226
FT                   Form_Nir_trans,Formate/nitrite transporter, score 425.90,
FT                   E-value 3.6e-124"
FT                   /inference="protein motif:PF01226"
FT   misc_feature    complement(173716..173781)
FT                   /gene="nirC"
FT                   /locus_tag="YPO0159"
FT                   /note="one of 6 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    complement(173842..173907)
FT                   /gene="nirC"
FT                   /locus_tag="YPO0159"
FT                   /note="one of 6 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    complement(173944..174009)
FT                   /gene="nirC"
FT                   /locus_tag="YPO0159"
FT                   /note="one of 6 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    complement(173959..173991)
FT                   /note="PS01006 Formate and nitrite transporters signature
FT                   2."
FT                   /inference="protein motif:ProSite:PS01006"
FT   misc_feature    complement(174088..174153)
FT                   /gene="nirC"
FT                   /locus_tag="YPO0159"
FT                   /note="one of 6 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    complement(174214..174243)
FT                   /note="PS01005 Formate and nitrite transporters signature
FT                   1."
FT                   /inference="protein motif:ProSite:PS01005"
FT   misc_feature    complement(174217..174282)
FT                   /gene="nirC"
FT                   /locus_tag="YPO0159"
FT                   /note="one of 6 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    complement(174313..174378)
FT                   /gene="nirC"
FT                   /locus_tag="YPO0159"
FT                   /note="one of 6 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        complement(174662..174988)
FT                   /transl_table=11
FT                   /gene="nirD"
FT                   /locus_tag="YPO0160"
FT                   /product="nitrite reductase [NAD"
FT                   /EC_number="1.7.1.4"
FT                   /note="Similar to Escherichia coli nitrite reductase NirD
FT                   SW:NIRD_ECOLI (P23675) (108 aa) fasta scores: E():
FT                   1.6e-32,69.8% id in 106 aa"
FT                   /db_xref="GOA:A0A384KYU1"
FT                   /db_xref="InterPro:IPR012748"
FT                   /db_xref="InterPro:IPR017881"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384KYU1"
FT                   /protein_id="CAL18846.1"
FT                   /translation="MSQWIPLCPLNDILPGSGVCGLIKQQQVAVFRPYADEQVFAISNI
FT                   DPFAQASVLSRGLIAEHQGELWVASPLKKQHFRLRDGFCLEDEDRSVTHYDVRVRDGMV
FT                   QVNA"
FT   CDS_pept        complement(174985..177531)
FT                   /transl_table=11
FT                   /gene="nirB"
FT                   /locus_tag="YPO0161"
FT                   /product="nitrite reductase"
FT                   /EC_number="1.7.1.4"
FT                   /note="Similar to Escherichia coli nitrite reductase NirB
FT                   SW:NIRB_ECOLI (P08201) (847 aa) fasta scores: E(): 0, 82.7%
FT                   id in 849 aa"
FT                   /db_xref="GOA:A0A384LAN6"
FT                   /db_xref="InterPro:IPR005117"
FT                   /db_xref="InterPro:IPR006066"
FT                   /db_xref="InterPro:IPR006067"
FT                   /db_xref="InterPro:IPR007419"
FT                   /db_xref="InterPro:IPR012744"
FT                   /db_xref="InterPro:IPR017121"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036136"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR041575"
FT                   /db_xref="InterPro:IPR041854"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384LAN6"
FT                   /protein_id="CAL18847.1"
FT                   /translation="MSKIKIAIIGNGMVGHRFIEDLLDKADKDQFDITVFCEEPRIAYD
FT                   RVHLSSYFSHHTAEELSLVREGFYEKQGVKVLVGERAITINRAEKVIHSNSGRSLYYDK
FT                   LVMATGSYPWIPPIKGSEGQDCFVYRTIEDLNAIEACTRRSKRGAVIGGGLLGLEAAGA
FT                   LKSLGVETHVIEFAPVLMAEQLDPMGGDQLRQKIERMGVRVHTGKNTQEIVHSGQNSRK
FT                   TMLFADGTQLEVDFIVFSTGIRPQDKLANQCGLATARRGGIAINDYCQTSDPDVYAIGE
FT                   CASWQERTFGLVAPGYKMAQVAADHLLGRENAFLGADMSAKLKLLGVDVGGIGDAHGRT
FT                   EGARSYVYLDESKEIYKRLVVSADNKTLLGAVLVGDTTDYGNLLQLALNNITLPENPDS
FT                   LILPAHAGNKPTIGVDSLPDSAQICSCFDVTKGDIIRAIGQGCQTVAALKSATKAGTGC
FT                   GGCIPLVTQVLNAELSKQGIEVNNHLCEHFAYSRQELYHLIRVEGIKTFTELREKYGKG
FT                   YGCEVCKPTVGSLLASCWNEYVLEPQHTPLQDTNDNFLGNIQKDGTYSIIPRSPGGEIT
FT                   PDGLLVVGQIAKEYNLYTKLTGSQRIGMFGAQKDDLPAIWARLIDAGFETGHAYAKALR
FT                   MAKTCVGSTWCRFGVGDSVGFGVALEHRYKGIRAPHKIKFGISGCTRECAEAQGKDVGI
FT                   IATENGWNLYVCGNGGMKPRHADLLAADLDEETLMRYLDRFMMFYIRTADKLQRTSVWL
FT                   ESLEGGIRYLQLVILEDKLGINDQLEAEIARLRDKVACEWKATVENPAAQVRFAHFINS
FT                   SLRDPNVQVVREREQHRPARPDERIPVRVLELEDNA"
FT   misc_feature    complement(175435..175629)
FT                   /note="Pfam match to entry PF01077 NIR_SIR, Nitrite and
FT                   sulphite reductase 4Fe-4S domain, score 97.40, E-value
FT                   2.8e-25"
FT                   /inference="protein motif:PF01077"
FT   misc_feature    complement(175450..175500)
FT                   /note="PS00365 Nitrite and sulfite reductases
FT                   iron-sulfur/siroheme-binding site."
FT                   /inference="protein motif:ProSite:PS00365"
FT   misc_feature    complement(175648..175683)
FT                   /note="PS00136 Serine proteases, subtilase family, aspartic
FT                   acid active site."
FT                   /inference="protein motif:ProSite:PS00136"
FT   misc_feature    complement(176686..177516)
FT                   /note="Pfam match to entry PF00070 pyr_redox, Pyridine
FT                   nucleotide-disulphide oxidoreductase, score 259.00, E-value
FT                   9.6e-76"
FT                   /inference="protein motif:PF00070"
FT   CDS_pept        177841..179151
FT                   /transl_table=11
FT                   /gene="codA"
FT                   /locus_tag="YPO0162"
FT                   /product="cytosine deaminase"
FT                   /EC_number="3.5.4.1"
FT                   /note="Similar to Escherichia coli cytosine deaminase CodA
FT                   SW:CODA_ECOLI (P25524) (426 aa) fasta scores: E(): 0, 80.5%
FT                   id in 425 aa"
FT                   /db_xref="GOA:A0A384LDU9"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR013108"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384LDU9"
FT                   /protein_id="CAL18848.1"
FT                   /translation="MEALMAGQSVPNYSLTTVNNVRRIGLAGLWQITIAEGKISLIQPQ
FT                   PEQSLTGQGVLDAQGGLALPPFIEPHIHLDTTQTAGQPSWNQSGTLFEGIERWAERKAR
FT                   LTREDVKQRAWQTLKWQIANGIQHVRTHVDVSDPHLTALSAMLEVKEEVSPWVDMQIVA
FT                   FPQEGILSYPDGAALLEEALRLGADAVGAIPHFEFTREYGVESLHIAFALAQKYQRLVD
FT                   VHCDETDDEQSRFIETVAALALRENMGARVTASHTTAMHSYNGAYTSRLFRLLKLSGIN
FT                   FVANPLVNIHLQGRFDTYPKRRGITRVKEMLAAEINVCFGHDDVFDPWYPLGTANMLQV
FT                   LHMGLHICQLMGYEQINDGLNLITTHSAKTLNLADYGLQPGNRANLIILPAENGFDALR
FT                   RQVPVSYSIRHGVVIAKTQPAESRIYLGQEEIVDFRR"
FT   CDS_pept        complement(179236..180420)
FT                   /transl_table=11
FT                   /locus_tag="YPO0163"
FT                   /product="conserved integral membrane protein"
FT                   /note="Similar to Escherichia coli hypothetical 43.2 kDa
FT                   protein in ppiA-nirB intergenic region YhfC SW:YHFC_ECOLI
FT                   (P21229) (393 aa) fasta scores: E(): 0, 74.8% id in 393 aa"
FT                   /db_xref="GOA:Q8ZJE6"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR023528"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZJE6"
FT                   /inference="protein motif:TMHMM:2.0"
FT                   /protein_id="CAL18849.1"
FT                   /translation="MNNSNRIRLTWISYLSYALTGALVIVTGIVMGNIAEYFNLPIASM
FT                   SNTFTFLNAGILISIFLNAWLMEIIPLKRQLVFGFILMLIAIAGLMVGHNLMIFSISMF
FT                   IFGVVSGITMSIGTFLVTHMYEGRQRGSRLLFTDSFFSMAGMIFPIAAAMLLARHIEWY
FT                   WVYACIGLLYVGIFVLTLCSEFPVLGHKATDQSKPVVKEKWGVGVLFLAIAALCYILGQ
FT                   LGFIQWVPEYATKTFNMNISQAGQLVSNFWISYMIGMWIFSFILRFFDLQRIVTVLAAM
FT                   ATLAMYLFVSTDNPAYLSYYILALGFVSSAIYTTLITLGSLQTKVSSPKLVNFILTCGT
FT                   VGTMLTFVVTGPIVANNGVHAALETANGLYLAVFILCLALGFFTKHRSHGHVTH"
FT   misc_feature    complement(179272..179337)
FT                   /locus_tag="YPO0163"
FT                   /note="one of 12 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    complement(179353..179418)
FT                   /locus_tag="YPO0163"
FT                   /note="one of 12 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    complement(179455..179520)
FT                   /locus_tag="YPO0163"
FT                   /note="one of 12 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    complement(179551..179601)
FT                   /locus_tag="YPO0163"
FT                   /note="one of 12 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    complement(179623..179688)
FT                   /locus_tag="YPO0163"
FT                   /note="one of 12 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    complement(179734..179799)
FT                   /locus_tag="YPO0163"
FT                   /note="one of 12 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    complement(179875..179940)
FT                   /locus_tag="YPO0163"
FT                   /note="one of 12 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    complement(179953..180018)
FT                   /locus_tag="YPO0163"
FT                   /note="one of 12 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    complement(180058..180114)
FT                   /locus_tag="YPO0163"
FT                   /note="one of 12 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    complement(180127..180192)
FT                   /locus_tag="YPO0163"
FT                   /note="one of 12 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    complement(180220..180285)
FT                   /locus_tag="YPO0163"
FT                   /note="one of 12 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    complement(180316..180381)
FT                   /locus_tag="YPO0163"
FT                   /note="one of 12 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        180906..182966
FT                   /transl_table=11
FT                   /locus_tag="YPO0164"
FT                   /product="putative membrane receptor protein"
FT                   /note="Similar to Pseudomonas stutzeri outer membrane
FT                   protein NosA TR:Q00620 (EMBL:M60717) (683 aa) fasta scores:
FT                   E(): 0, 56.9% id in 640 aa and to Yersinia enterocolitica
FT                   hemin receptor precursor HemR SW:HEMR_YEREN (P31499) (687
FT                   aa) fasta scores: E(): 1.8e-06, 22.7% id in 677 aa"
FT                   /db_xref="GOA:A0A384LDE1"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR010100"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039426"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384LDE1"
FT                   /inference="similar to sequence:INSDC:M60717"
FT                   /protein_id="CAL18850.1"
FT                   /translation="MISGKNKVCKKKLLACAVTSAISAFASNAIASNAIADTTSLAAMN
FT                   RSAINISSTHNSNKKLNDADVITVTAPLYSPLVVVTSPKVPRQPVPASDGTDYLRTIPG
FT                   FSLVRNGGTNGDVVFRGMFGSRLKILTDGAEILGTCPSRMDAPTSYISPESFDLLTVVK
FT                   GPQSVLWGPGVSAGTILFERERPHFDQSGVKGNASVLAGSNGRWDKNLDASLGNEQGYL
FT                   RMMGNQSRAADYKDGNNVRVPSQWDKWNADMALGWTPDTDTLLELSVGKGNGEARYGGR
FT                   GMDGSQFLRESLAARVEKSNIGEVLDKIEAKINYTYVDHIMDNKTLRTPPMMAMSSNLD
FT                   RRMLGGRVMGTWLWQDLKLDAGTDMQTNTHRKNKQGNWDKNARFMNNGVFGELTWAASE
FT                   QNKLISGARLDRHQVTNYTRAGEPTRSATLPAAFMRVEHNLANAPVMLYAGLGHTERFP
FT                   DYWELFSPKFGPAGSTSAFEGVKSEKTTQIDIGGQYSGEQFRGWLSAYIGRVNDFILFK
FT                   YDPKNLRISQADNINATIMGGEMGMEYALTPYWKADASLAYAWGENTRDNRPLPQIPPL
FT                   EARLGLTFEAGDWSSSALWRLVNSQHRVAINEGNVVGKDFSSSAGFGVLSANVAYKVNK
FT                   QVKLSSGIDNLLNKAYSEHLNLAGNSGFGYSVNTPLNEPGRTLWAKLNLTF"
FT   misc_feature    180942..181010
FT                   /note="1 probable transmembrane helix predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    182607..182963
FT                   /note="Pfam match to entry PF00593 TonB_boxC, TonB
FT                   dependent receptor C-terminal region, score 80.80, E-value
FT                   4.3e-21"
FT                   /inference="protein motif:PF00593"
FT   CDS_pept        complement(183067..184053)
FT                   /transl_table=11
FT                   /locus_tag="YPO0165"
FT                   /product="LacI-family transcriptional regulator"
FT                   /note="Similar to Vibrio cholerae transcriptional
FT                   regulator, LacI family VC1286 TR:Q9KSH0 (EMBL:AE004208)
FT                   (340 aa) fasta scores: E(): 0, 47.4% id in 331 aa"
FT                   /db_xref="GOA:A0A0H2W080"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2W080"
FT                   /inference="similar to sequence:INSDC:AE004208"
FT                   /protein_id="CAL18851.1"
FT                   /translation="MVTLEDVAVLAGVSRATVSRVVNGDTNVKALTREKVEQAVAVLGY
FT                   TPHPAARALASSQSNTLGLVTTSYRGGFFGALMDFVQTETESQGKQLLVTQGRDNADKE
FT                   WLAIQRLYNLRCDGLILHVRFLSDERLRQLAAANRPFVLLDRLVPDLEARCVTFDHHHA
FT                   SQMATQVLIDAGHRDIACISGSSQRQSSVLRIQGFLDAMQLAGLEPVACLEGVYDLESG
FT                   YLRADEILKQPRLPTAIYCCNEEMAIGALLAINKHGLQVPQDISLICYDSGERAPFVCP
FT                   ALTSVHFPIVEMAQYATQLLIDPLIPAVNFPPAIIMRDSVMPPKTAC"
FT   misc_feature    complement(183163..183882)
FT                   /note="Pfam match to entry PF00532
FT                   Peripla_BP_like,Periplasmic binding proteins and sugar
FT                   binding domain of the LacI family., score 121.10, E-value
FT                   2.1e-32"
FT                   /inference="protein motif:PF00532"
FT   misc_feature    complement(183973..184053)
FT                   /note="Pfam match to entry PF00356 lacI, Bacterial
FT                   regulatory proteins, lacI family, score 41.50, E-value
FT                   2.9e-10"
FT                   /inference="protein motif:PF00356"
FT   misc_feature    complement(183985..184050)
FT                   /note="Predicted helix-turn-helix motif with score 2027
FT                   (+6.09 SD) at aa 2-23, sequence VTLEDVAVLAGVSRATVSRVVN"
FT   misc_feature    complement(183988..184044)
FT                   /note="PS00356 Bacterial regulatory proteins, lacI family
FT                   signature."
FT                   /inference="protein motif:ProSite:PS00356"
FT   CDS_pept        complement(184302..185615)
FT                   /transl_table=11
FT                   /locus_tag="YPO0166"
FT                   /product="putative glycosyl hydrolase"
FT                   /note="Similar to Escherichia coli
FT                   6-phospho-beta-glucosidase CelF SW:CELF_ECOLI (P17411) (449
FT                   aa) fasta scores: E(): 0, 43.2% id in 440 aa and to Vibrio
FT                   cholerae 6-phospho-beta-glucosidase VC1284 TR:Q9KSH2
FT                   (EMBL:AE004207) (440 aa) fasta scores: E(): 0, 55.9% id in
FT                   433 aa"
FT                   /db_xref="GOA:A0A384K9D9"
FT                   /db_xref="InterPro:IPR001088"
FT                   /db_xref="InterPro:IPR015955"
FT                   /db_xref="InterPro:IPR019802"
FT                   /db_xref="InterPro:IPR022616"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384K9D9"
FT                   /inference="similar to sequence:INSDC:AE004207"
FT                   /protein_id="CAL18852.1"
FT                   /translation="MSTFKITIIGGGSSYTPELVDGLIQRIEQLPVTELALVDVEQGRQ
FT                   KVEIIAALTQRMLARHGLEQVKVSVHYSLDEAIRGARFVLTQFRVGQLPARAADERLGL
FT                   KYNLLGQETTGIGGFAKALRTIPVMLDIAANVERLAPDAWIINFTNPAGIVTEAVSRYT
FT                   KAKIIGLCNVPISMHHMIAKLLQAPYEDLQLRFAGLNHMVWVHEVLQRGKYVTADVLKM
FT                   LCDGASLSMNNIKEAPWPPEFLQAMGAIPCPYHRYFYQTQDMLAEEMAAAAERGTRAEQ
FT                   VMQVEKELFALYADPHLDTKPEQLSFRGGSFYSEVALELIRAIHNNLGTQLVVNTTNRG
FT                   AIRGLSDDSVVETNCIIDAKGAHPLTFGPLPVSMHGLTQQVKAYERLTIDAAVHGDRRS
FT                   ALLALVTNPLIANASIAQPLLEEVLQVNKPYLPQFSGL"
FT   misc_feature    complement(184386..185603)
FT                   /note="Pfam match to entry PF02056 Glyco_hydro_4, Family 4
FT                   glycosyl hydrolase, score 434.90, E-value 7.2e-127"
FT                   /inference="protein motif:PF02056"
FT   misc_feature    complement(185103..185195)
FT                   /note="PS01324 Glycosyl hydrolases family 4 signature."
FT                   /inference="protein motif:ProSite:PS01324"
FT   CDS_pept        186131..186700
FT                   /transl_table=11
FT                   /gene="ppiA"
FT                   /gene_synonym="rot"
FT                   /gene_synonym="rotA"
FT                   /locus_tag="YPO0167"
FT                   /product="peptidyl-prolyl cis-trans isomerase A"
FT                   /EC_number="5.2.1.8"
FT                   /note="Similar to Escherichia coli peptidyl-prolyl
FT                   cis-trans isomerase A precursor PpiA SW:PPIA_ECOLI (P20752)
FT                   (190 aa) fasta scores: E(): 0, 79.5% id in 190 aa"
FT                   /db_xref="GOA:A0A384KIT0"
FT                   /db_xref="InterPro:IPR002130"
FT                   /db_xref="InterPro:IPR020892"
FT                   /db_xref="InterPro:IPR024936"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384KIT0"
FT                   /protein_id="CAL18853.1"
FT                   /translation="MFKRTLVTFIALCSLSAVAPAALAAGEPHVLLTTSAGNIELELNS
FT                   QKAPISTQNFVDYVNNGYYNNTIFHRVIPGFMIQGGGFTADFKEKTPKTPIKNEADNGL
FT                   RNLRGTISMARTADKDSATSQFFLNVADNAFLDHGQRDFGYAVFGKVVKGMDVVEKISQ
FT                   VQTENVGPYQNVPVKPITILSAKVLP"
FT   misc_feature    186209..186697
FT                   /note="Pfam match to entry PF00160
FT                   pro_isomerase,Cyclophilin type peptidyl-prolyl cis-trans
FT                   isomerase, score 243.30, E-value 7.2e-70"
FT                   /inference="protein motif:PF00160"
FT   misc_feature    186320..186373
FT                   /note="PS00170 Cyclophilin-type peptidyl-prolyl cis-trans
FT                   isomerase signature."
FT                   /inference="protein motif:ProSite:PS00170"
FT   CDS_pept        187026..188567
FT                   /transl_table=11
FT                   /locus_tag="YPO0168"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Escherichia coli hypothetical protein
FT                   YjgR SW:YJGR_ECOLI (P39342) (500 aa) fasta scores: E():
FT                   0,67.4% id in 513 aa"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033186"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384K924"
FT                   /protein_id="CAL18854.1"
FT                   /translation="MSNTLLIGKALVTEKTQPASRDLVILSALANRHGLITGATGTGKT
FT                   VTLQKMAEQFSRIGVPVFLADVKGDLSGIGAEGVNSEKLQARLAAIDVTDWQPQACPIV
FT                   PWDIFAEKGHPIRATISDLGPLLLGRLLDLNDVQSGVLQLVFKIADDNGLLLLDMKDLR
FT                   AIVQYVGDNAKQFRTQYGNITSASIGAIQRGLLTLEEQGANQFFGEPMLDIHDLMQTDS
FT                   HGQGVINLLAADRLINQPKLYAIFLLWLLAELFEQLPEVGDVEKPKLVFFFDEAHLLFT
FT                   DAPAALVDKVEQVVRLIRSKGVGIYFVTQNPLDIPDKILGQLGNRVQHALRAFTPRDQK
FT                   AVKAAAQTMRPNPAFSAEQVITELGVGEALISFLDEKGRPNVVERAMVIAPQSKMGALD
FT                   AAARNHAINHSPLYGRYEEMIDRESAYEKLSAGGFSTMGRAAEGEPSVPQQPTNQQGSG
FT                   GGLMGGLNDLLFGSSGPRGGKRDGIVQTAAKSMARDLGRQILRGVLGSITGGRKR"
FT   misc_feature    187137..187160
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:ProSite:PS00017"
FT   CDS_pept        188810..189385
FT                   /transl_table=11
FT                   /gene="pabA"
FT                   /locus_tag="YPO0169"
FT                   /product="para-aminobenzoate synthase glutamine
FT                   amidotransferase component II"
FT                   /EC_number="4.1.3.-"
FT                   /note="Similar to para-aminobenzoate synthase glutamine
FT                   amidotransferase components II from several including:
FT                   Serratia marcescens SW:PABA_SERMA (P06195) (191 aa) fasta
FT                   scores: E(): 0, 84.7% id in 189 aa and to Escherichia coli
FT                   SW:PABA_ECOLI (P00903) (187 aa) fasta scores: E(): 0, 74.1%
FT                   id in 189 aa"
FT                   /db_xref="GOA:Q0WKD3"
FT                   /db_xref="InterPro:IPR006221"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:Q0WKD3"
FT                   /protein_id="CAL18855.1"
FT                   /translation="MLLLIDNYDSFTYNLYQYFCELGTEVMVKRNDELQLTDIEQLAPS
FT                   HVVISPGPCTPNEAGISLAVIRHFADKLPILGVCLGHQALGQAFGARVVRARQVMHGKT
FT                   SAICHSGQGVFRGLNQPLTVTRYHSLVIATDSLPGRFELTAWTERGGEMDEIMGIRHRT
FT                   LPLEGVQFHPESILSEQGHQLLDNFLKN"
FT   misc_feature    188816..189382
FT                   /note="Pfam match to entry PF00117 GATase, Glutamine
FT                   amidotransferase class-I, score 284.60, E-value 1.2e-81"
FT                   /inference="protein motif:PF00117"
FT   misc_feature    189029..189064
FT                   /note="PS00442 Glutamine amidotransferases class-I active
FT                   site."
FT                   /inference="protein motif:ProSite:PS00442"
FT   CDS_pept        join(189518..190051,192005..192694)
FT                   /pseudo
FT                   /transl_table=11
FT                   /gene="argD"
FT                   /locus_tag="YPO0170"
FT                   /product="acetylornithine aminotransferase (pseudogene)"
FT                   /EC_number="2.6.1.11"
FT                   /note="Similar to Escherichia coli acetylornithine
FT                   aminotransferase ArgD SW:ARGD_ECOLI (P18335) (405 aa) fasta
FT                   scores: E(): 0, 77.2% id in 403 aa. This CDS is interrupted
FT                   by a IS100 element."
FT                   /db_xref="PSEUDO:CAL18856.1"
FT   misc_feature    189611..190048
FT                   /note="Pfam match to entry PF00202
FT                   aminotran_3,Aminotransferases class-III
FT                   pyridoxal-phosphate, score 231.80, E-value 4.7e-80"
FT                   /inference="protein motif:PF00202"
FT   repeat_region   190051..192004
FT                   /note="insertion sequence:IS100"
FT   repeat_region   190051..190078
FT                   /rpt_type=INVERTED
FT                   /note="IS100 inverted repeat"
FT   CDS_pept        190137..191159
FT                   /transl_table=11
FT                   /gene="y1093"
FT                   /gene_synonym="ypmt1"
FT                   /locus_tag="YPO0171"
FT                   /product="transposase for insertion sequence IS100"
FT                   /note="Similar to Escherichia coli transposase for
FT                   insertion sequence element IS21 IstA SW:ISTA_ECOLI (P15025)
FT                   (390 aa) fasta scores: E(): 3e-27, 33.1% id in 329 aa.
FT                   Identical to the previously sequenced Yersinia
FT                   pestis,Yersinia pseudotuberculosis, and Escherichia coli
FT                   pesticin plasmid insertion sequence transposase Y1055
FT                   TR:P74993 (EMBL:U59875) (340 aa) fasta scores: E(): 0,
FT                   100.0% id in 340 aa"
FT                   /db_xref="GOA:Q7ARN5"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR006120"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR017894"
FT                   /db_xref="UniProtKB/TrEMBL:Q7ARN5"
FT                   /inference="similar to sequence:INSDC:U59875"
FT                   /protein_id="CAL18857.1"
FT                   /translation="MVTFETVMEIKILHKQGMSSRAIARELGISRNTVKRYLQAKSEPP
FT                   KYTPRPAVASLLDEYRDYIRQRIADAHPYKIPATVIAREIRDQGYRGGMTILRAFIRSL
FT                   SVPQEQEPAVRFETEPGRQMQVDWGTMRNGRSPLHVFVAVLGYSRMLYIEFTDNMRYDT
FT                   LETCHRNAFRFFGGVPREVLYDNMKTVVLQRDAYQTGQHRFHPSLWQFGKEMGFSPRLC
FT                   RPFRAQTKGKVERMVQYTRNSFYIPLMTRLRPMGITVDVETANRHGLRWLHDVANQRKH
FT                   ETIQARPCDRWLEEQQSMLALPPEKKEYDVHLDENLVNFDKHPLHHPLSIYDSFCRGVA
FT                   "
FT   misc_feature    190161..190244
FT                   /note="Pfam match to entry PF00239
FT                   recombinase,Site-specific recombinases, score 25.70,
FT                   E-value 4.7e-06"
FT                   /inference="protein motif:PF00239"
FT   misc_feature    190188..190253
FT                   /note="Predicted helix-turn-helix motif with score 2147
FT                   (+6.50 SD) at aa 18-39, sequence MSSRAIARELGISRNTVKRYLQ"
FT   misc_feature    190482..191015
FT                   /note="Pfam match to entry PF00665 rve, Integrase core
FT                   domain, score 81.90, E-value 1.6e-22"
FT                   /inference="protein motif:PF00665"
FT   CDS_pept        191156..191938
FT                   /transl_table=11
FT                   /gene="ypmt1.57c"
FT                   /locus_tag="YPO0172"
FT                   /product="insertion sequence IS100, ATP-binding protein"
FT                   /note="Similar to Escherichia coli insertion sequence IS21
FT                   putative ATP-binding protein, IstB SW:ISTB_ECOLI (P15026)
FT                   (265 aa) fasta scores: E(): 0, 47.4% id in 249 aa. Also
FT                   almost identical to Yersinia pestis and Escherichia coli
FT                   putative IS100 transposase ypmt1.57c TR:Q9R3L5
FT                   (EMBL:AL117211) (260 aa) fasta scores: E(): 0, 99.6% id in
FT                   260 aa."
FT                   /db_xref="GOA:Q7ARK4"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR002611"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028350"
FT                   /db_xref="UniProtKB/TrEMBL:Q7ARK4"
FT                   /inference="similar to sequence:INSDC:AL117211"
FT                   /protein_id="CAL18858.1"
FT                   /translation="MMMELQHQRLMALAGQLQLESLISAAPALSQQAVDQEWSYMDFLE
FT                   HLLHEEKLARHQRKQAMYTRMAAFPAVKTFEEYDFTFATGAPQKQLQSLRSLSFIERNE
FT                   NIVLLGPSGVGKTHLAIAMGYEAVRAGIKVRFTTAADLLLQLSTAQRQGRYKTTLQRGV
FT                   MAPRLLIIDEIGYLPFSQEEAKLFFQVIAKRYEKSAMILTSNLPFGQWDQTFAGDAALT
FT                   SAMLDRILHHSHVVQIKGESYRLRQKRKAGVIAEANPE"
FT   misc_feature    191324..191863
FT                   /note="Pfam match to entry PF01695 IstB, IstB-like ATP
FT                   binding protein, score 367.20, E-value 1.7e-106"
FT                   /inference="protein motif:PF01695"
FT   misc_feature    191483..191506
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:ProSite:PS00017"
FT   repeat_region   complement(191977..192004)
FT                   /rpt_type=INVERTED
FT                   /note="IS100 inverted repeat"
FT   misc_feature    192005..192619
FT                   /note="Pfam match to entry PF00202
FT                   aminotran_3,Aminotransferases class-III
FT                   pyridoxal-phosphate, score 306.00, E-value 6.9e-106"
FT                   /inference="protein motif:PF00202"
FT   misc_feature    192140..192253
FT                   /note="PS00600 Aminotransferases class-III
FT                   pyridoxal-phosphate attachment site."
FT                   /inference="protein motif:ProSite:PS00600"
FT   CDS_pept        complement(192920..195040)
FT                   /transl_table=11
FT                   /locus_tag="YPO0174"
FT                   /product="putative membrane protein"
FT                   /note="Similar to Escherichia coli hypothetical 79.5 kDa
FT                   protein in crp-argD intergenic region YhfK SW:YHFK_ECOLI
FT                   (P45537) (696 aa) fasta scores: E(): 0, 56.4% id in 707 aa"
FT                   /db_xref="InterPro:IPR010020"
FT                   /db_xref="InterPro:IPR032692"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384KL53"
FT                   /inference="protein motif:TMHMM:2.0"
FT                   /protein_id="CAL18859.1"
FT                   /translation="MKWQRLIYHPEVNYALRQTLVLCLPAALGFAIGDLRLGLMFSLIP
FT                   ACCNIASLDTPHQHFFRRLIIGGVLFTLSSFLTQQLLLWHIPLPVIMLGLALIVGVSGT
FT                   ISPLNGRLLPAALIAAIFSLSMVGRAPIWQAPLLCAVGTLWYGVFNWLWFRLCKDQPIR
FT                   EPLSQLYHLLADYCDAKYSRLTQHLEPEKAIPPLLDRQQGMMDKVNQLYQQFNLLHNTT
FT                   KKEQKRLLGLFQMALDLQEHITAALNQPEEMQDLIKKTPIEAVTQSNAQIISAQMRAIA
FT                   DDILYHRRTVEHFTAGVPLAELETIAQQNPDNPVAQFCYYHISHITQILSDRRPLYNRD
FT                   LMSSQLSQPFWPALVSYLSFKSSALRDAARIGVTLAVGSYIGVLINLPKPYWILLTIML
FT                   VMQNGYNATRVRIHHRALGTLVGLILAAGLLHLQMTEITTLGIMLLITLLSYLVQRKNY
FT                   GLAVVGRTITAVYILQLLTGEGANFLVPRLLDTLIGCALALGSALWLWPQWQSGLLRKN
FT                   AHQALEAYQTILRLLLTPHPDITQLDYERFNVNKASNTVLSSLNQAMQEPGFNSKYLAD
FT                   MRLWATHSELIVCHINEMTTLIRENPLTEVDSPSTGGHTLMSTKLAASYLQLCEMAIQL
FT                   CQQRLESDNLEDNDSVVQIPDMAPDTQASELERNLRRVLSHLNVMHTVSAMAWQQQPHH
FT                   GIWRSRKLRDNT"
FT   misc_feature    complement(193520..193576)
FT                   /locus_tag="YPO0174"
FT                   /note="one of 8 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    complement(193607..193663)
FT                   /locus_tag="YPO0174"
FT                   /note="one of 8 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    complement(193685..193750)
FT                   /locus_tag="YPO0174"
FT                   /note="one of 8 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    complement(193862..193927)
FT                   /locus_tag="YPO0174"
FT                   /note="one of 8 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    complement(194579..194644)
FT                   /locus_tag="YPO0174"
FT                   /note="one of 8 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    complement(194660..194716)
FT                   /locus_tag="YPO0174"
FT                   /note="one of 8 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    complement(194732..194797)
FT                   /locus_tag="YPO0174"
FT                   /note="one of 8 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    complement(194945..195001)
FT                   /locus_tag="YPO0174"
FT                   /note="one of 8 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        complement(195126..195758)
FT                   /transl_table=11
FT                   /gene="cap"
FT                   /gene_synonym="crp"
FT                   /gene_synonym="csm"
FT                   /locus_tag="YPO0175"
FT                   /product="cAMP-regulatory protein"
FT                   /note="Similar to Escherichia coli and Shigella flexneri
FT                   catabolite gene activator Crp SW:CRP_ECOLI (P03020) (210
FT                   aa) fasta scores: E(): 0, 98.6% id in 210 aa"
FT                   /db_xref="GOA:A0A384L3J4"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR012318"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018335"
FT                   /db_xref="InterPro:IPR018488"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="PDB:6DT4"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384L3J4"
FT                   /protein_id="CAL18860.1"
FT                   /translation="MVLGKPQTDPTLEWFLSHCHIHKYPSKSTLIHQGEKAETLYYIVK
FT                   GSVAVLIKDEEGKEMILSYLNQGDFIGELGLFEEGQERSAWVRAKTACEVAEISYKKFR
FT                   QLIQVNPDILMRLSSQMANRLQITSEKVGNLAFLDVTGRIAQTLLNLAKQPDAMTHPDG
FT                   MQIKITRQEIGQIVGCSRETVGRILKMLEDQNLISAHGKTIVVYGTR"
FT   misc_feature    complement(195168..195263)
FT                   /note="Pfam match to entry PF00325 crp, Bacterial
FT                   regulatory proteins, crp family, score 59.30, E-value
FT                   3.7e-18"
FT                   /inference="protein motif:PF00325"
FT   misc_feature    complement(195186..195257)
FT                   /note="PS00042 Bacterial regulatory proteins, crp family
FT                   signature."
FT                   /inference="protein motif:ProSite:PS00042"
FT   misc_feature    complement(195192..195257)
FT                   /note="Predicted helix-turn-helix motif with score 2127
FT                   (+6.43 SD) at aa 168-189, sequence ITRQEIGQIVGCSRETVGRILK"
FT   misc_feature    complement(195423..195707)
FT                   /note="Pfam match to entry PF00027 cNMP_binding, Cyclic
FT                   nucleotide-binding domain, score 122.70, E-value 7e-33"
FT                   /inference="protein motif:PF00027"
FT   misc_feature    complement(195492..195548)
FT                   /note="PS00889 Cyclic nucleotide-binding domain signature
FT                   2."
FT                   /inference="protein motif:ProSite:PS00889"
FT   misc_feature    complement(195621..195671)
FT                   /note="PS00888 Cyclic nucleotide-binding domain signature
FT                   1."
FT                   /inference="protein motif:ProSite:PS00888"
FT   CDS_pept        196094..196501
FT                   /transl_table=11
FT                   /locus_tag="YPO0176"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Escherichia coli hypothetical protein
FT                   YhfA SW:YHFA_ECOLI (P24246) (134 aa) fasta scores: E():
FT                   0,86.3% id in 131 aa"
FT                   /db_xref="InterPro:IPR003718"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR036102"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384KG01"
FT                   /protein_id="CAL18861.1"
FT                   /translation="MQARVKWVEGLTFLGESASGHQVLMDGNSGDKAPSPMEMLLMSAG
FT                   GCSAIDVVSILQKGRNNVRDCEVKLTSERREEAPRLFTQINLHFIVSGKGLTDKVVERA
FT                   VDLSAEKYCSVALMLGKAATITHSFEVREVA"
FT   CDS_pept        196573..197004
FT                   /transl_table=11
FT                   /locus_tag="YPO0177"
FT                   /product="putative membrane protein"
FT                   /note="No significant database hits. CDS DNA has a low G+C
FT                   content (34%)."
FT                   /db_xref="InterPro:IPR010665"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384LN94"
FT                   /inference="protein motif:TMHMM:2.0"
FT                   /protein_id="CAL18862.1"
FT                   /translation="MKYLILGGYTVVANKNKISVACGAISLFVVASFSLFFSLTHYFNF
FT                   FKMNDEVHFSWAVSLLLSGSPLLFYLSVVSGGYIIGYEKIYNDRVGKILAYIAVLGMVF
FT                   SLFFSFYVDSSLKEAGYLKCERKSFIAPNKYVIDLKLCR"
FT   misc_feature    196633..196701
FT                   /locus_tag="YPO0177"
FT                   /note="one of 3 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    196744..196812
FT                   /locus_tag="YPO0177"
FT                   /note="one of 3 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    196849..196908
FT                   /locus_tag="YPO0177"
FT                   /note="one of 3 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        complement(197182..198051)
FT                   /transl_table=11
FT                   /gene="prk"
FT                   /locus_tag="YPO0178"
FT                   /product="phosphoribulokinase 1"
FT                   /EC_number="2.7.1.19"
FT                   /note="Similar to Rhodobacter sphaeroides
FT                   phosphoribulokinase 1 PrkA SW:KPP1_RHOSH (P12033) (290 aa)
FT                   fasta scores: E(): 0, 49.3% id in 290 aa and to Escherichia
FT                   coli probable phosphoribulokinase PrkB SW:KPPR_ECOLI
FT                   (P37307) (289 aa) fasta scores: E(): 0, 86.5% id in 288 aa"
FT                   /db_xref="GOA:A0A384LPI2"
FT                   /db_xref="InterPro:IPR006082"
FT                   /db_xref="InterPro:IPR006083"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384LPI2"
FT                   /protein_id="CAL18863.1"
FT                   /translation="MSTKHPVIAVTGSSGAGTTTTSLAFRKIFQQLDIRAAQIEGDSFH
FT                   RYTRPEMDAAIRKARDQGRHISYFGPEANDFGQLEQSVAEYSKHGTGRSRKYLHTYDEA
FT                   VPYNQIPGTFTPWEPLPEPTDVLFYEGLHGGVVTEHHDVAKHVDLLVGVVPIVNLEWIQ
FT                   KLVRDTGERGHSREAVMDSVVRSMDDYINYITPQFSRTHINFQRVPTVDTSNPFAAKAI
FT                   PSLDESFVVIHFRGLDHIDFPYLLAMLQGSFISNINTLVVPGGKMGLAMELIMAPLVQQ
FT                   LLEGKQIA"
FT   misc_feature    complement(197233..198033)
FT                   /note="Pfam match to entry PF00485 PRK,Phosphoribulokinase,
FT                   score 454.10, E-value 1.2e-132"
FT                   /inference="protein motif:PF00485"
FT   misc_feature    complement(197521..197562)
FT                   /note="PS00567 Phosphoribulokinase signature."
FT                   /inference="protein motif:ProSite:PS00567"
FT   CDS_pept        complement(198200..198436)
FT                   /transl_table=11
FT                   /locus_tag="YPO0179"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Escherichia coli hypothetical protein
FT                   YheU SW:YHEU_ECOLI (P45536) (72 aa) fasta scores: E():
FT                   4.3e-23, 76.1% id in 71 aa"
FT                   /db_xref="InterPro:IPR010648"
FT                   /db_xref="InterPro:IPR036685"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZJD4"
FT                   /protein_id="CAL18864.1"
FT                   /translation="MIIPWQQVDSETLDNLLEAFVLREGTDYGEHERSLTEKVADVRRQ
FT                   LVSGEAVLVWSELHETINIMPRGSFRAGAEEQQ"
FT   CDS_pept        complement(198433..199413)
FT                   /transl_table=11
FT                   /locus_tag="YPO0180"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to many including: Vibrio cholerae
FT                   hypothetical protein VC2610 TR:Q9KNX0 (EMBL:AE004327) (329
FT                   aa) fasta scores: E(): 0, 55.3% id in 320 aa"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR000952"
FT                   /db_xref="InterPro:IPR012020"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384KCH2"
FT                   /inference="similar to sequence:INSDC:AE004327"
FT                   /protein_id="CAL18865.1"
FT                   /translation="MHETFRPLAGASNPHLQTLLPRLVRRHVQLSPYWQRLELPDGDFI
FT                   DLAWSENPELAREKPRVVLFHGLEGNFYSPYAHGLLRAWQAAGWLGVVMHFRGCSGEPN
FT                   RKSRIYHSGETEDANFFLHWLQETYGQVPTAAVGISLGGNMLACYLAKKGKNSGLRAAV
FT                   VVSAPLMLEPCADRMDQGFSRVYQRYLLNQLKLNATRKLLQYPNSLPVNLFQLKKLRRV
FT                   RDFDDAITAKIHGFNDAGDYYRRCSALPLLPQIRVPLLIIHAKDDPFMTAEVIPNIETL
FT                   PDNIDYQLTEHGGHVGFVGGSLKHPQMWLEQRIPAWLSPYLEQQS"
FT   misc_feature    complement(198460..199149)
FT                   /note="Pfam match to entry PF00561 abhydrolase, alpha/beta
FT                   hydrolase fold, score 60.60, E-value 3.4e-14"
FT                   /inference="protein motif:PF00561"
FT   misc_feature    complement(198613..198738)
FT                   /note="PS01133 Uncharacterized protein family UPF0017
FT                   signature."
FT                   /inference="protein motif:ProSite:PS01133"
FT   CDS_pept        199515..200117
FT                   /transl_table=11
FT                   /locus_tag="YPO0181"
FT                   /product="putative ABC-transport protein"
FT                   /note="Similar to many including: Bacillus sp
FT                   sodium-dependent serotonin transporter TR:O82971
FT                   (EMBL:AB015670) (198 aa) fasta scores: E(): 2.4e-13, 34.5%
FT                   id in 197 aa and to Pseudomonas aeruginosa hypothetical
FT                   protein Pa2306 TR:AAG05694 (EMBL:AE004657) (205 aa) fasta
FT                   scores: E(): 1.4e-21, 38.5% id in 195 aa"
FT                   /db_xref="GOA:A0A384L7D6"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384L7D6"
FT                   /inference="protein motif:TMHMM:2.0"
FT                   /inference="similar to sequence:INSDC:AB015670"
FT                   /inference="similar to sequence:INSDC:AE004657"
FT                   /protein_id="CAL18866.1"
FT                   /translation="MELSLFLSMVGFLWVAAITPGPNNMLLTSTGANFGFMRSIWLMLG
FT                   IMLGMQSMLLLVAFGVGSLILIYPSLHLALKILGSLYLLWLAWKIATSAYEKLDTNVAP
FT                   AKPLRLYQGWLLQFLNPKAWLMGLGSVASFSMAGAAYNHSILMISLGMFMVNLVAGIIW
FT                   LGFGTLIGRLLGSRRAWFTFNISMGLLTAACVLLIWH"
FT   misc_feature    199527..199595
FT                   /locus_tag="YPO0181"
FT                   /note="one of 6 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    199632..199700
FT                   /locus_tag="YPO0181"
FT                   /note="one of 6 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    199710..199778
FT                   /locus_tag="YPO0181"
FT                   /note="one of 6 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    199866..199934
FT                   /locus_tag="YPO0181"
FT                   /note="one of 6 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    199947..200015
FT                   /locus_tag="YPO0181"
FT                   /note="one of 6 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    199956..200000
FT                   /note="PS00211 ABC transporters family signature."
FT                   /inference="protein motif:ProSite:PS00211"
FT   misc_feature    200052..200111
FT                   /locus_tag="YPO0181"
FT                   /note="one of 6 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        200320..201381
FT                   /transl_table=11
FT                   /gene="ssiA"
FT                   /gene_synonym="tauA"
FT                   /locus_tag="YPO0182"
FT                   /product="putative taurine-binding periplasmic protein
FT                   precursor"
FT                   /note="Similar to Escherichia coli taurine-binding
FT                   periplasmic protein precursor TauA SW:TAUA_ECOLI (Q47537)
FT                   (320 aa) fasta scores: E(): 0, 74.1% id in 313 aa, and to
FT                   Pseudomonas aeruginosa probable periplasmic taurine-binding
FT                   protein precursor PA3938 TR:AAG07325 (EMBL:AE004811) (337
FT                   aa) fasta scores: E(): 0, 50.2% id in 329 aa"
FT                   /db_xref="GOA:Q0WKC2"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR007210"
FT                   /db_xref="InterPro:IPR010068"
FT                   /db_xref="UniProtKB/TrEMBL:Q0WKC2"
FT                   /inference="similar to sequence:INSDC:AE004811"
FT                   /protein_id="CAL18867.1"
FT                   /translation="MAITFSSATLAASRRSFLQLRTILLASLLPASLLLATSAQAVDVI
FT                   VAYQTSAEPAKVAQADNSFAKLSGANADWRKFDSGSSVVRALASGDVQIGNIGSSPLAV
FT                   AASQNVPIEVFLLASQLGSSEALVVKKEIKTPQDLIGKRIAVPFISTAHYSLLAALKHW
FT                   GIKPGQVTILNLQPPAIAAAWQRGDIDGAYVWAPAVSELAKTGTVLTDSAQVGQWGAPT
FT                   LDVWVVRKDFAKAHPEVVTAFARSALAAQAAYLNNPEQWLQNQAHLAPLSRLSGVPTEQ
FT                   VPALVKGNTYLPVAEQITQLGQPVDQAIRDTAEFLKQQGKIPQVASDYRDFVTDRFVKE
FT                   IQATPQSQATPQS"
FT   CDS_pept        201390..202157
FT                   /transl_table=11
FT                   /gene="ssiB"
FT                   /gene_synonym="tauB"
FT                   /locus_tag="YPO0183"
FT                   /product="putative taurine transport ATP-binding protein"
FT                   /note="Similar to Escherichia coli taurine transport
FT                   ATP-binding protein TauB SW:TAUB_ECOLI (Q47538) (255 aa)
FT                   fasta scores: E(): 0, 68.1% id in 254 aa, and to
FT                   Pseudomonas aeruginosa probable ATP-binding component of
FT                   ABC taurine transporter PA3937 TR:AAG07324 (EMBL:AE004811)
FT                   (263 aa) fasta scores: E(): 0, 50.2% id in 241 aa"
FT                   /db_xref="GOA:Q8ZJD0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR015859"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZJD0"
FT                   /inference="similar to sequence:INSDC:AE004811"
FT                   /protein_id="CAL18868.1"
FT                   /translation="MLNVSGLWAEYQGKPALQDVSLQIASGQLVVVLGPSGCGKTTLLN
FT                   LIAGFMTPSAGVITLDNIPVSGPSAERGVVFQNEGLLPWRDVVSNVEFGLQLAGMSKEQ
FT                   RRVTALKMLNRVGLAGFEHHFIWQLSGGMRQRVGIARALAVDPRLLLLDEPFGALDAFT
FT                   REQMQELLLTIWRDTGKQILLITHDIEEAVFLASELLLLSPGPGQVVERLSLNFGQRYA
FT                   EGEPCRAIKSDPEFIARREDVLGKVFQQREVLI"
FT   misc_feature    201468..202004
FT                   /note="Pfam match to entry PF00005 ABC_tran, ABC
FT                   transporter, score 207.20, E-value 2.4e-58"
FT                   /inference="protein motif:PF00005"
FT   misc_feature    201489..201512
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:ProSite:PS00017"
FT   misc_feature    201774..201818
FT                   /note="PS00211 ABC transporters family signature."
FT                   /inference="protein motif:ProSite:PS00211"
FT   CDS_pept        202154..203008
FT                   /transl_table=11
FT                   /gene="ssiC"
FT                   /gene_synonym="tauC"
FT                   /locus_tag="YPO0184"
FT                   /product="putative taurine transport system permease
FT                   protein"
FT                   /note="Similar to Escherichia coli taurine transport system
FT                   permease protein TauC SW:TAUC_ECOLI (Q47539) (275 aa) fasta
FT                   scores: E(): 0, 75.4% id in 264 aa, and to Pseudomonas
FT                   aeruginosa probable permease of ABC taurine transporter
FT                   PA3936 TR:AAG07323 (EMBL:AE004811) (272 aa) fasta scores:
FT                   E(): 0, 58.8% id in 267 aa"
FT                   /db_xref="GOA:Q0WKC0"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q0WKC0"
FT                   /inference="protein motif:TMHMM:2.0"
FT                   /inference="similar to sequence:INSDC:AE004811"
FT                   /protein_id="CAL18869.1"
FT                   /translation="MSLHSTLRNQAINLPAADAPKKTPRRLPANQTLWISIATLASVVA
FT                   LWWAVTALQLIGPLFLPAPQQVLHQLWTIASPQGFMDATLWQHLAASLGRIFVALLAAV
FT                   VLGVPTGIAMGLNSNVRGVLDPLIEIYRPVPPLAYLPLMVIWFGIGETSKILLIYLAIF
FT                   APVTLAAVAGVRSVAHVRVRAARALGASRWQVLWFVVLPSALPEILTGIRIGLGVGWST
FT                   LVAAELIAATRGLGFMVQSAGEFLATDVVIAGISVIAIIAFGMELSLRAIQRRLTPWYG
FT                   EQQ"
FT   misc_feature    202250..202318
FT                   /gene="ssiC"
FT                   /gene_synonym="tauC"
FT                   /locus_tag="YPO0184"
FT                   /note="one of 6 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    202433..202501
FT                   /gene="ssiC"
FT                   /gene_synonym="tauC"
FT                   /locus_tag="YPO0184"
FT                   /note="one of 6 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    202535..202603
FT                   /gene="ssiC"
FT                   /gene_synonym="tauC"
FT                   /locus_tag="YPO0184"
FT                   /note="one of 6 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    202616..202675
FT                   /gene="ssiC"
FT                   /gene_synonym="tauC"
FT                   /locus_tag="YPO0184"
FT                   /note="one of 6 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    202670..202885
FT                   /note="Pfam match to entry PF00528
FT                   BPD_transp,Binding-protein-dependent transport systems
FT                   inner membrane component, score 46.00, E-value 8.3e-10"
FT                   /inference="protein motif:PF00528"
FT   misc_feature    202673..202759
FT                   /note="PS00402 Binding-protein-dependent transport systems
FT                   inner membrane comp. sign."
FT                   /inference="protein motif:ProSite:PS00402"
FT   misc_feature    202736..202804
FT                   /gene="ssiC"
FT                   /gene_synonym="tauC"
FT                   /locus_tag="YPO0184"
FT                   /note="one of 6 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    202886..202954
FT                   /gene="ssiC"
FT                   /gene_synonym="tauC"
FT                   /locus_tag="YPO0184"
FT                   /note="one of 6 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        203005..203853
FT                   /transl_table=11
FT                   /gene="ssiD"
FT                   /gene_synonym="tauD"
FT                   /locus_tag="YPO0185"
FT                   /product="putative taurine dioxygenase"
FT                   /note="Similar to Escherichia coli
FT                   alpha-ketoglutarate-dependent taurine dioxygenase TauD
FT                   SW:TAUD_ECOLI (P37610) (282 aa) fasta scores: E(): 0, 76.1%
FT                   id in 280 aa, and to Pseudomonas aeruginosa taurine
FT                   dioxygenase TauD TR:AAG07322 (EMBL:AE004811) (277 aa) fasta
FT                   scores: E(): 0, 60.6% id in 274 aa"
FT                   /db_xref="GOA:A0A384KWR4"
FT                   /db_xref="InterPro:IPR003819"
FT                   /db_xref="InterPro:IPR042098"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384KWR4"
FT                   /inference="similar to sequence:INSDC:AE004811"
FT                   /protein_id="CAL18870.1"
FT                   /translation="MNERLIVTPLGPHIGALVENINIAHPLGDSQFEQLYHVLLKHQVL
FT                   FFRNQPITPLQQRDLAGRFGDLHIHPVYPHTQECEEIIVLDTADDNPPDNDNWHTDVTF
FT                   IETPPLGAILAAKQLPTTGGDTLWSSGIAAYDALSAPFKQLLAGLQAEHDFTKSFPEHK
FT                   HRTTPEEHQRWLQGKEKNPPLLHPVIRTHPVSGRQALFVNEGFTTRIIGLSDKESEALL
FT                   GFLFAHTTKPEFQVRWRWQQDDVAIWDNRVTQHYANADYLPQRRVMHRATILGDRPVFR
FT                   P"
FT   CDS_pept        complement(203866..204846)
FT                   /transl_table=11
FT                   /locus_tag="YPO0186"
FT                   /product="putative sugar transferase"
FT                   /note="Similar to Serratia marcescens putative heptosyl III
FT                   transferase WaaQ TR:Q9X979 (EMBL:U52844) (337 aa) fasta
FT                   scores: E(): 5.4e-13, 27.1% id in 343 aa and to Salmonella
FT                   typhimurium lipopolysaccharide core biosynthesis protein
FT                   WaaQ TR:O68270 (EMBL:AF026386) (344 aa) fasta scores: E():
FT                   5.1e-09, 26.2% id in 302 aa"
FT                   /db_xref="GOA:Q0WKB8"
FT                   /db_xref="InterPro:IPR002201"
FT                   /db_xref="UniProtKB/TrEMBL:Q0WKB8"
FT                   /inference="similar to sequence:INSDC:U52844"
FT                   /inference="similar to sequence:INSDC:AF026386"
FT                   /protein_id="CAL18871.1"
FT                   /translation="MQRILVIRIDFLGDMVCTTALLHALKQRWPAAEIHVLANKYNQSV
FT                   LARNPDVSAVHTYVYSKQCERNQRPGRLMALFDRLALIWRLRRLGFDLLLIPNGGMNKN
FT                   SIQFAKQLNVADRRWHTAETEFDDRNPEHVATRPIRHEALSGFALMPELGRVDIETLKL
FT                   HVYPEPQLQAKWQADLGGKDRPRVGLFISNKSAQRRWSWDKWRQLALKLNAQAELLIFH
FT                   DPAEQPSEQQLAGLTARCLSTPSTDDLMAAMSQLDLVISADSAPVHIGSALQIPVVALF
FT                   ESRPEKYLRWYPLGVRHVLVHAGPQVEDIHVDAVESAARSLLTTD"
FT   misc_feature    complement(203890..204612)
FT                   /note="Pfam match to entry PF01075
FT                   Heptosyltranf,Heptosyltransferase, score -30.10, E-value
FT                   0.00075"
FT                   /inference="protein motif:PF01075"
FT   CDS_pept        complement(204939..205928)
FT                   /transl_table=11
FT                   /locus_tag="YPO0187"
FT                   /product="putative glycosyl transferase"
FT                   /note="Similar to many transferases e.g. Klebsiella
FT                   pneumoniae glycosyl transferase TR:Q9XC92 (EMBL:AF146532)
FT                   (329 aa) fasta scores: E(): 2.1e-27, 29.4% id in 313 aa"
FT                   /db_xref="GOA:A0A384KQ63"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384KQ63"
FT                   /inference="similar to sequence:INSDC:AF146532"
FT                   /protein_id="CAL18872.1"
FT                   /translation="MNSVDISVIVPVYNCANYLTDLLDSLRSQTGVSLEIIAVNDGSTD
FT                   HSLALLEQVAHIDSRLVIINQQNQGLSEARNVGIAKAKGNWVAFADGDDWLAPHALSTW
FT                   LQQVKQQKLDVLIGNGYQFSSNPERKPVTPLLGQQPWGATLNGQQWIILSVKQKEWPHY
FT                   AWLQLIRRDVISTHQLQFIRDMLHEDILWTTQLALVAQRIGFCATPFYGYRTNPDSITN
FT                   SPSMQALLRRANSYVDIINALVKIAASTKPPVRDALLSHANQESGHLLGLLRKKLPASP
FT                   QRTALAIRFITLGLRPALFRGVTNLHELWRAIRCSFLMGSYARQKRAE"
FT   misc_feature    complement(205401..205910)
FT                   /note="Pfam match to entry PF00535 Glycos_transf_2,Glycosyl
FT                   transferases, score 66.70, E-value 5e-16"
FT                   /inference="protein motif:PF00535"
FT   CDS_pept        complement(206063..207981)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="YPO0188"
FT                   /product="binding protein dependent ABC-transport protein
FT                   (pseudogene)"
FT                   /note="Similar to Escherichia coli O157:H7 putative
FT                   ATP-binding component of a transport system YheS
FT                   TR:AAG58460 (EMBL:AE005558) (637 aa) fasta scores: E():
FT                   0,80.9% id in 634 aa Note this CDS contains a possible
FT                   frameshift mutation following codon 177. The sequence has
FT                   been checked and is believed to be correct"
FT                   /inference="similar to sequence:INSDC:AE005558"
FT   misc_feature    complement(206477..206974)
FT                   /note="Pfam match to entry PF00005 ABC_tran, ABC
FT                   transporter, score 143.00, E-value 5.3e-39"
FT                   /inference="protein motif:PF00005"
FT   misc_feature    complement(206651..206695)
FT                   /note="PS00211 ABC transporters family signature."
FT                   /inference="protein motif:ProSite:PS00211"
FT   misc_feature    complement(206930..206953)
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:ProSite:PS00017"
FT   misc_feature    complement(207424..207903)
FT                   /note="Pfam match to entry PF00005 ABC_tran, ABC
FT                   transporter, score 45.40, E-value 1.2e-09"
FT                   /inference="protein motif:PF00005"
FT   misc_feature    complement(207490..207534)
FT                   /note="PS00211 ABC transporters family signature."
FT                   /inference="protein motif:ProSite:PS00211"
FT   misc_feature    complement(207859..207882)
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:ProSite:PS00017"
FT   CDS_pept        208229..208780
FT                   /transl_table=11
FT                   /locus_tag="YPO0190"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Escherichia coli putative NAD(P)H
FT                   oxidoreductase, YheR SW:YHER_ECOLI (P45534) (184 aa) fasta
FT                   scores: E(): 0, 75.3% id in 182 aa"
FT                   /db_xref="GOA:Q8ZJC5"
FT                   /db_xref="InterPro:IPR003680"
FT                   /db_xref="InterPro:IPR023947"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZJC5"
FT                   /protein_id="CAL18874.1"
FT                   /translation="MMLQPPKVLLLYAHPESQDSVANRVLLQPVQQLEHVTVHDLYAHY
FT                   PDFFIDIHHEQQLLRDHQVIVFQHPLYTYSCPALLKEWLDRVLARGFANGVGGHALTGK
FT                   HWRSVITTGEQEGTYRIGGYNRYPMEDILRPFELTAAMCHMHWINPMIIYWARRQKPET
FT                   LASHAQAYVQWLQSPLTRGL"
FT   CDS_pept        208784..210592
FT                   /transl_table=11
FT                   /gene="kefB"
FT                   /gene_synonym="trkB"
FT                   /locus_tag="YPO0191"
FT                   /product="probable potassium-efflux system protein"
FT                   /note="Similar to Escherichia coli glutathione-regulated
FT                   potassium-efflux system protein KefB SW:KEFB_ECOLI (P45522)
FT                   (601 aa) fasta scores: E(): 0, 77.9% id in 602 aa"
FT                   /db_xref="GOA:Q8ZJC4"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR004771"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR020884"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZJC4"
FT                   /inference="protein motif:TMHMM:2.0"
FT                   /protein_id="CAL18875.1"
FT                   /translation="MEGTGLLTAVLVFLFAAVVAVPIAQRLGIGAVLGYLIAGIAIGPW
FT                   GLGFIRDVDEILHFSELGVVFLMFIIGLELNPAKLWQLRRSIFGVGAGQVVITAAVLGA
FT                   LLYFTQFAWQAAVIGGVGLAMSSTAMALQLMREKGMNRNEGGQLGFSVLLFQDMAVIPA
FT                   LALIPILAGNEGGANDWVKIGLKIAAFAGMLIGGRYLLRPLFRYIVASGVREVFTAAAL
FT                   LVVLGSALFMDALGLSMALGTFIAGILLAESEFQHELEIAIEPFKGLLLGLFFISVGMA
FT                   LDLGVLFTHLLDVLLGVLALVFIKSAILYGLARVFGLRRSVRLQFAGVLSQGGEFAFVL
FT                   FSAAFSQRVLNAEQLALLLVVVTLSMMTTPLLMQVIDRILVRRYNAQEESDEKPFVEDN
FT                   DPQVIIVGFGRFGQVIGRLLMANKMRITVLERDVSAVSMMRKYGYKVYYGDATELELLR
FT                   AAGAEKAKAIVITCNEPEDTMALVHLCQQHFPNLHILARARGRVEAHELLQNGVKDFTR
FT                   ETFSSALELGRKTLLELGMHPHQAYRAQQHFRRLDMRMLRELMPQHHGDVAQISRIKEA
FT                   RRELEDIFQREMLHESRQLDGWDEYE"
FT   misc_feature    208796..208855
FT                   /gene="kefB"
FT                   /gene_synonym="trkB"
FT                   /locus_tag="YPO0191"
FT                   /note="one of 12 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    208868..208936
FT                   /gene="kefB"
FT                   /gene_synonym="trkB"
FT                   /locus_tag="YPO0191"
FT                   /note="one of 12 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    208949..209002
FT                   /gene="kefB"
FT                   /gene_synonym="trkB"
FT                   /locus_tag="YPO0191"
FT                   /note="one of 12 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    209039..209107
FT                   /gene="kefB"
FT                   /gene_synonym="trkB"
FT                   /locus_tag="YPO0191"
FT                   /note="one of 12 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    209120..209188
FT                   /gene="kefB"
FT                   /gene_synonym="trkB"
FT                   /locus_tag="YPO0191"
FT                   /note="one of 12 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    209225..209293
FT                   /gene="kefB"
FT                   /gene_synonym="trkB"
FT                   /locus_tag="YPO0191"
FT                   /note="one of 12 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    209321..209386
FT                   /gene="kefB"
FT                   /gene_synonym="trkB"
FT                   /locus_tag="YPO0191"
FT                   /note="one of 12 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    209405..209473
FT                   /gene="kefB"
FT                   /gene_synonym="trkB"
FT                   /locus_tag="YPO0191"
FT                   /note="one of 12 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    209483..209551
FT                   /gene="kefB"
FT                   /gene_synonym="trkB"
FT                   /locus_tag="YPO0191"
FT                   /note="one of 12 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    209588..209656
FT                   /gene="kefB"
FT                   /gene_synonym="trkB"
FT                   /locus_tag="YPO0191"
FT                   /note="one of 12 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    209669..209737
FT                   /gene="kefB"
FT                   /gene_synonym="trkB"
FT                   /locus_tag="YPO0191"
FT                   /note="one of 12 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    209846..209914
FT                   /gene="kefB"
FT                   /gene_synonym="trkB"
FT                   /locus_tag="YPO0191"
FT                   /note="one of 12 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    209987..210349
FT                   /note="Pfam match to entry PF02254 KTN, KTN NAD-binding
FT                   domain, score 52.30, E-value 1e-11"
FT                   /inference="protein motif:PF02254"
FT   CDS_pept        210608..210829
FT                   /transl_table=11
FT                   /locus_tag="YPO0192"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to several hypothetical proteins e.g.
FT                   Escherichia coli hypothetical protein YheV SW:YHEV_ECOLI
FT                   (P56622) (66 aa) fasta scores: E(): 8e-17, 60.3% id in 63
FT                   aa"
FT                   /db_xref="InterPro:IPR012658"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384KZS9"
FT                   /protein_id="CAL18876.1"
FT                   /translation="MTITLNKTVTRKRFIAGAVCPQCNALDTLALWREDQVEVVECVKC
FT                   GHHQRQTDEQVNKHVRPHEQVIGIFPPE"
FT   CDS_pept        210924..211511
FT                   /transl_table=11
FT                   /gene="slyD"
FT                   /locus_tag="YPO0193"
FT                   /product="peptidyl-prolyl cis-trans isomerase"
FT                   /EC_number="5.2.1.8"
FT                   /note="Similar to Escherichia coli peptidyl-prolyl
FT                   cis-trans isomerase SlyD SW:SLYD_ECOLI (P30856) (196 aa)
FT                   fasta scores: E(): 0, 83.4% id in 199 aa"
FT                   /db_xref="GOA:Q7CFU4"
FT                   /db_xref="InterPro:IPR001179"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7CFU4"
FT                   /protein_id="CAL18877.1"
FT                   /translation="MKVTKDLVVSLAYQVRTEDGVLVDESPVSAPLDYLHGHGSLIAGL
FT                   ENALEGHEAGDSFDVRVNADEGYGSYDENLVQRVPKDVFMGVDELEVGMRFLADTDQGP
FT                   VPVEITAVEDEHVVVDGNHMLAGQDLNFHVEVVAVREATEEELQHGHVHGEHDHHHEHG
FT                   DGCCGGHGHDDHEHEHEHGKGGCGKSGGCGCH"
FT   misc_feature    210954..211001
FT                   /note="PS00453 FKBP-type peptidyl-prolyl cis-trans
FT                   isomerase signature 1."
FT                   /inference="protein motif:ProSite:PS00453"
FT   misc_feature    211032..211334
FT                   /note="Pfam match to entry PF00254 FKBP, FKBP-type
FT                   peptidyl-prolyl cis-trans isomerases, score 35.50, E-value
FT                   1.3e-09"
FT                   /inference="protein motif:PF00254"
FT   misc_feature    211044..211130
FT                   /note="PS00454 FKBP-type peptidyl-prolyl cis-trans
FT                   isomerase signature 2."
FT                   /inference="protein motif:ProSite:PS00454"
FT   misc_feature    211467..211490
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:ProSite:PS00017"
FT   CDS_pept        complement(211732..211965)
FT                   /transl_table=11
FT                   /locus_tag="YPO0194"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Escherichia coli SlyX protein of unknown
FT                   function SW:SLYX_ECOLI (P30857) (72 aa) fasta scores: E():
FT                   1.6e-15, 69.4% id in 72 aa"
FT                   /db_xref="InterPro:IPR007236"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZJC1"
FT                   /protein_id="CAL18878.1"
FT                   /translation="MRGNTMEQSLLEQRLEMLESRLAFQEVTIEELNLIVTEHQMEMTK
FT                   LREHLRLLTDKLRESQSSMLASPSEETPPPHY"
FT   CDS_pept        212265..213065
FT                   /transl_table=11
FT                   /gene="fkpA"
FT                   /locus_tag="YPO0195"
FT                   /product="peptidyl-prolyl cis-trans isomerase"
FT                   /EC_number="5.2.1.8"
FT                   /note="Similar to Escherichia coli FkbP-type
FT                   peptidyl-prolyl cis-trans isomerase SW:FKBA_ECOLI (P45523)
FT                   (270 aa) fasta scores: E(): 0, 76.0% id in 267 aa"
FT                   /db_xref="GOA:A0A384LGW3"
FT                   /db_xref="InterPro:IPR000774"
FT                   /db_xref="InterPro:IPR001179"
FT                   /db_xref="InterPro:IPR036944"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384LGW3"
FT                   /protein_id="CAL18879.1"
FT                   /translation="MKSLFKVTLLATAMTLTLNTSTVFAADATSPVVTNSAFKNNDQQS
FT                   AYALGASLGRYMDNSLKEQEKLGIKLDKDQLIAGVQDAFANKSKLTDEEIEKTLQNFEA
FT                   RVKASAQAKMEQDAKENADKGAKYRDTFAKEKGVKKTASGLLYKVENAGTGDAPKDSDT
FT                   VVVNYKGTLADGTEFDNSYKRGEPLSFRLDGVIPGWTEGLKQIKKGGKITLVIPPELAY
FT                   GKAGVPGIPANSTLIFDVELLDVKAAAKADAQEQQPAVDTKAKK"
FT   misc_feature    212331..212711
FT                   /note="Pfam match to entry PF01346 FKBP_N, Domain amino
FT                   terminal to FKBP-type peptidyl-prolyl isomerase, score
FT                   176.10, E-value 5.7e-49"
FT                   /inference="protein motif:PF01346"
FT   misc_feature    212721..212993
FT                   /note="Pfam match to entry PF00254 FKBP, FKBP-type
FT                   peptidyl-prolyl cis-trans isomerases, score 155.00, E-value
FT                   7e-46"
FT                   /inference="protein motif:PF00254"
FT   misc_feature    212847..212933
FT                   /note="PS00454 FKBP-type peptidyl-prolyl cis-trans
FT                   isomerase signature 2."
FT                   /inference="protein motif:ProSite:PS00454"
FT   CDS_pept        213307..214041
FT                   /transl_table=11
FT                   /locus_tag="YPO0196"
FT                   /product="putative DNA-binding protein"
FT                   /note="Similar to Escherichia coli hypothetical protein
FT                   YheO SW:YHEO_ECOLI (P45533) (240 aa) fasta scores: E():
FT                   0,86.7% id in 240 aa, and to Vibrio cholerae hypothetical
FT                   protein VC0355 vc0355 TR:Q9KV03 (EMBL:AE004124) (240 aa)
FT                   fasta scores: E(): 0, 66.2% id in 234 aa"
FT                   /db_xref="GOA:A0A384KTE5"
FT                   /db_xref="InterPro:IPR013559"
FT                   /db_xref="InterPro:IPR039445"
FT                   /db_xref="InterPro:IPR039446"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384KTE5"
FT                   /inference="similar to sequence:INSDC:AE004124"
FT                   /protein_id="CAL18880.1"
FT                   /translation="MVSSMSNSLLCSETSELDLLDERPFSQTDHEILKSYEVVVDGLAM
FT                   LIGGHCEIVLHSLEDLKNSAVRIANGEHTGRQIGSPITDLALRMLHDMAGADSSVSKAY
FT                   FTRAKSGVLMKSVTIAIRNRDQRVIGLLCINMNLDVPFSQIIQTFMPPETQEVPSSVNF
FT                   ASSVDDLVAQTLEFTIEEVNADRNVSNNAKNRQVVLNLYEKGIFDIKDAINQVAERLNI
FT                   SKHTVYLYIRQFKSGDLVGHER"
FT   misc_feature    213937..214002
FT                   /note="Predicted helix-turn-helix motif with score 1342
FT                   (+3.76 SD) at aa 211-232, sequence DAINQVAERLNISKHTVYLYIR"
FT   CDS_pept        214041..214436
FT                   /transl_table=11
FT                   /locus_tag="YPO0197"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Escherichia coli hypothetical protein
FT                   YheN SW:YHEN_ECOLI (P45532) (128 aa) fasta scores: E():
FT                   0,73.4% id in 128 aa"
FT                   /db_xref="GOA:Q8ZJB8"
FT                   /db_xref="InterPro:IPR003787"
FT                   /db_xref="InterPro:IPR017463"
FT                   /db_xref="InterPro:IPR027396"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZJB8"
FT                   /protein_id="CAL18881.1"
FT                   /translation="MSALKYCLLVTGPAYGTQQASSAYQFAQAVVGAGHHLVSIFFYRE
FT                   GVLNANQLTAPASDEFDLVRAWQQLAAEQAVTLNVCVAAALRRGITDQHEAEQLNLAAA
FT                   NLQPGFTLSGLGALAEATLTCDRMVQF"
FT   CDS_pept        214436..214801
FT                   /transl_table=11
FT                   /locus_tag="YPO0198"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Escherichia coli hypothetical protein
FT                   YheM SW:YHEM_ECOLI (P45531) (119 aa) fasta scores: E():
FT                   7.4e-29, 59.3% id in 118 aa and to Chromatium vinosum
FT                   hypothetical protein, possibly involved in the
FT                   intracellular sulfur oxidation, DsrF SW:DSRF_CHRVI (O87897)
FT                   (136 aa) fasta scores: E(): 1.1e-05, 31.5% id in 89 aa"
FT                   /db_xref="GOA:Q8ZJB7"
FT                   /db_xref="InterPro:IPR003787"
FT                   /db_xref="InterPro:IPR017462"
FT                   /db_xref="InterPro:IPR027396"
FT                   /db_xref="InterPro:IPR037450"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZJB7"
FT                   /protein_id="CAL18882.1"
FT                   /translation="MARKRIAFIFTQGPHGSSAGREGLDALLATSALSEDIGVFFISDG
FT                   VLQLLPQQQPEKILARNYIATFGVLPLYDVENCYLCERSLQQRGLSKMADWILDVTVLS
FT                   PADLRRELGTYDVVLTF"
FT   CDS_pept        214821..215108
FT                   /transl_table=11
FT                   /locus_tag="YPO0199"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Escherichia coli hypothetical protein
FT                   SW:YHEL_ECOLI (P45530) (95 aa) fasta scores: E():
FT                   2.4e-16,50.5% id in 95 aa, and to Chromatium vinosum DsrH
FT                   TR:O87898 (EMBL:U84760) (102 aa) fasta scores: E():
FT                   7.2e-05, 33.7% id in 101 aa"
FT                   /db_xref="GOA:Q8ZJB6"
FT                   /db_xref="InterPro:IPR007215"
FT                   /db_xref="InterPro:IPR023526"
FT                   /db_xref="InterPro:IPR027396"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZJB6"
FT                   /inference="similar to sequence:INSDC:U84760"
FT                   /protein_id="CAL18883.1"
FT                   /translation="MLYTVSHSPYHCDLSALLRLATSEDDILLLQDGVIAALKESETLK
FT                   LLLNNPASLFVLEDDVIARGLVGQISDNATLISYTHFVDLTLRHQQQLAW"
FT   CDS_pept        215246..215620
FT                   /transl_table=11
FT                   /gene="rpsl"
FT                   /gene_synonym="strA"
FT                   /locus_tag="YPO0200"
FT                   /product="30S ribosomal protein S12"
FT                   /note="Similar to Escherichia coli, and Salmonella
FT                   typhimurium 30S ribosomal protein S12 RpsL SW:RS12_ECOLI
FT                   (P02367) (123 aa) fasta scores: E(): 0, 95.9% id in 123 aa"
FT                   /db_xref="GOA:Q8ZJB5"
FT                   /db_xref="InterPro:IPR005679"
FT                   /db_xref="InterPro:IPR006032"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZJB5"
FT                   /protein_id="CAL18884.1"
FT                   /translation="MATINQLVRKPRSMKVAKSNVPALEACPQKRGVCTRVYTTTPKKP
FT                   NSALRKVCRVRLTNGFEVTSYIGGEGHNLQEHSVILIRGGRVKDLPGVRYHTVRGALDC
FT                   SGVKDRKQSRSKYGVKKPKA"
FT   misc_feature    215246..215614
FT                   /note="Pfam match to entry PF00164 Ribosomal_S12, Ribosomal
FT                   protein S12, score 275.30, E-value 7.9e-79"
FT                   /inference="protein motif:PF00164"
FT   misc_feature    215372..215395
FT                   /note="PS00055 Ribosomal protein S12 signature."
FT                   /inference="protein motif:ProSite:PS00055"
FT   CDS_pept        215717..216187
FT                   /transl_table=11
FT                   /gene="rpsG"
FT                   /locus_tag="YPO0201"
FT                   /product="30S ribosomal protein S7"
FT                   /note="Similar to Salmonella typhimurium 30S ribosomal
FT                   protein S7 RpsG SW:RS7_SALTY (P26230) (155 aa) fasta
FT                   scores: E(): 0, 94.8% id in 155 aa"
FT                   /db_xref="GOA:Q8ZJB4"
FT                   /db_xref="InterPro:IPR000235"
FT                   /db_xref="InterPro:IPR005717"
FT                   /db_xref="InterPro:IPR020606"
FT                   /db_xref="InterPro:IPR023798"
FT                   /db_xref="InterPro:IPR036823"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZJB4"
FT                   /protein_id="CAL18885.1"
FT                   /translation="MPRRRVIGQRKILPDPKFGSELLAKFVNILMVDGKKSTAEAIVYT
FT                   ALETLAQRSGKDFLEAFEVALDNVRPTVEVKSRRVGGSTYQVPVEVRPVRRNALAMRWI
FT                   VDAARKRGDKSMALRLANELSDAAENKGSAVKKREDVHRMAEANKAFAHYRW"
FT   misc_feature    215720..216184
FT                   /note="Pfam match to entry PF00177 Ribosomal_S7, Ribosomal
FT                   protein S7p/S5e, score 328.40, E-value 8e-95"
FT                   /inference="protein motif:PF00177"
FT   misc_feature    215774..215854
FT                   /note="PS00052 Ribosomal protein S7 signature."
FT                   /inference="protein motif:ProSite:PS00052"
FT   CDS_pept        216281..218389
FT                   /transl_table=11
FT                   /gene="far"
FT                   /gene_synonym="fus"
FT                   /gene_synonym="fusA"
FT                   /locus_tag="YPO0202"
FT                   /product="elongation factor G"
FT                   /note="Similar to Escherichia coli elongation factor G FusA
FT                   SW:EFG_ECOLI (P02996) (703 aa) fasta scores: E(): 0, 86.9%
FT                   id in 703 aa"
FT                   /db_xref="GOA:Q8ZJB3"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004540"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR005517"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009022"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035649"
FT                   /db_xref="InterPro:IPR041095"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZJB3"
FT                   /protein_id="CAL18886.1"
FT                   /translation="MARKTPIERYRNIGISAHIDAGKTTTTERILFYTGVNHKIGEVHD
FT                   GAATMDWMEQEQERGITITSAATTCFWSGMAKQFEPHHVNIIDTPGHVDFTIEVERSMR
FT                   VLDGAVMVYCAVGGVQPQSETVWRQANKYKVPRIAFVNKMDRMGANFLRVVGQLKSRLG
FT                   ANPVPLQLAIGAEEKFTGIIDLVKMKAINWNEADQGVTFEYEEIPADMAELAAEWHQNL
FT                   VESAAEASDELMDKYLGGEELTEEEIKKALRQRVLKSEIILVTCGSAFKNKGVQAMLDA
FT                   VIEYLPAPTDVESINGILDDGKDTPAVRHSDDKEPFSALAFKIATDPFVGNLTFFRVYS
FT                   GIVNSGDTVLNSVKSQRERLGRIVQMHANKREEIKEVHAGDIAAAIGLKDVTTGDTLCD
FT                   PNNPIILERMEFPEPVISVAVEPKTKADQEKMGMALGRLAKEDPSFRVWTDEESGQTII
FT                   AGMGELHLDILVDRMRREFNVEANVGKPQVAYRETIRETVKDVEGKHAKQSGGRGQYGH
FT                   VVIDMSPLPPGGVGYEFVNEIVGGSIPKEFIPAVDKGIQEQLKSGPLAGYPVVDVKVRL
FT                   HYGSYHDVDSSELAFKLAGSIAFKEGFKRAKPVLLEPIMKVEVETPEDYMGDVMGDLNR
FT                   RRGIIEGMEDTATGKTVRVKVPLSEMFGYATDLRSQTQGRASYSMEFLEYAEAPSNVAK
FT                   AVIEARGK"
FT   misc_feature    216302..217759
FT                   /note="Pfam match to entry PF00009 GTP_EFTU, Elongation
FT                   factor Tu family, score 516.00, E-value 2.6e-152"
FT                   /inference="protein motif:PF00009"
FT   misc_feature    216329..216352
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:ProSite:PS00017"
FT   misc_feature    216431..216478
FT                   /note="PS00301 GTP-binding elongation factors signature."
FT                   /inference="protein motif:ProSite:PS00301"
FT   misc_feature    217838..218356
FT                   /note="Pfam match to entry PF00679 EFG_C, Elongation factor
FT                   G C-terminus, score 380.60, E-value 1.6e-110"
FT                   /inference="protein motif:PF00679"
FT   CDS_pept        218462..219646
FT                   /transl_table=11
FT                   /gene="tufA"
FT                   /gene_synonym="tufB"
FT                   /locus_tag="YPO0203"
FT                   /product="elongation factor Tu"
FT                   /note="Similar to Escherichia coli elongation factor Tu
FT                   SW:EFTU_ECOLI (P02990) (393 aa) fasta scores: E(): 0, 95.2%
FT                   id in 393 aa"
FT                   /db_xref="GOA:Q8ZJB2"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004160"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004541"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR033720"
FT                   /db_xref="InterPro:IPR041709"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZJB2"
FT                   /protein_id="CAL18887.1"
FT                   /translation="MSKEKFERTKPHVNVGTIGHVDHGKTTLTAAITTVLAKTYGGSAR
FT                   AFDQIDNAPEEKARGITINTSHVEYDTPARHYAHVDCPGHADYVKNMITGAAQMDGAIL
FT                   VVAATDGPMPQTREHILLGRQVGVPYIIVFMNKCDMVDDEELLELVEMEVRELLSAYDF
FT                   PGDDLPVVRGSALKALEGEAEWEAKIIELAGYLDSYIPEPERAIDKPFLLPIEDVFSIS
FT                   GRGTVVTGRVERGIVKVGEEVEIVGIKDTVKSTCTGVEMFRKLLDEGRAGENVGVLLRG
FT                   IKREDIERGQVLAKPGSIKPHTTFESEVYILSKDEGGRHTPFFKGYRPQFYFRTTDVTG
FT                   TIELPEGVEMVMPGDNINMIVTLIHPIAMDDGLRFAIREGGRTVGAGVVAKVIA"
FT   misc_feature    218489..219583
FT                   /note="Pfam match to entry PF00009 GTP_EFTU, Elongation
FT                   factor Tu family, score 487.00, E-value 9.9e-144"
FT                   /inference="protein motif:PF00009"
FT   misc_feature    218516..218539
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:ProSite:PS00017"
FT   misc_feature    218612..218659
FT                   /note="PS00301 GTP-binding elongation factors signature."
FT                   /inference="protein motif:ProSite:PS00301"
FT   repeat_region   219704..220415
FT                   /note="Contains a 'G' at nucleotide position 315"
FT                   /note="IS200-like insertion sequence:IS1541"
FT   CDS_pept        219849..220307
FT                   /transl_table=11
FT                   /gene="tnp"
FT                   /locus_tag="YPO0204"
FT                   /product="transposase for the IS1541 insertion element"
FT                   /note="Similar to Salmonella typhimurium, and Salmonella
FT                   typhi transposase for insertion sequence IS200 TnpA
FT                   SW:T200_SALTY (Q57334) (152 aa) fasta scores: E(): 0, 94.1%
FT                   id in 152 aa. Also identical to the Yersinia
FT                   pseudotuberculosis IS1541 element transposase Tnp TR:Q9X9F5
FT                   (EMBL:AJ238014) (152 aa) fasta scores: E(): 0, 100.0% id in
FT                   152 aa"
FT                   /db_xref="GOA:Q74YM6"
FT                   /db_xref="InterPro:IPR002686"
FT                   /db_xref="InterPro:IPR036515"
FT                   /db_xref="UniProtKB/TrEMBL:Q74YM6"
FT                   /inference="similar to sequence:INSDC:AJ238014"
FT                   /protein_id="CAL18888.1"
FT                   /translation="MRDEKSLAHTRWNCKYHIVFAPKYRRQVFYREKRRAIGSILRKLC
FT                   EWKNVNILEAECCVDHIHMLLEIPPKMSVSGFMGYLKGKSSLMLYEQFGDLKFKYRNRE
FT                   FWCRGYYVDTVGKNTARIQEYIKHQLEEDKMGEQLSIPYPGSPFTGRK"
FT   misc_feature    219903..220214
FT                   /note="Pfam match to entry PF01797
FT                   Transposase_17,Transposase IS200 like, score 236.10,
FT                   E-value 5.1e-67"
FT                   /inference="protein motif:PF01797"
FT   CDS_pept        220495..220689
FT                   /transl_table=11
FT                   /gene="bfd"
FT                   /locus_tag="YPO0205"
FT                   /product="putative bacterioferritin-associated ferredoxin"
FT                   /note="Similar to Serratia marcescens
FT                   bacterioferritin-associated ferredoxin Bfd SW:BFD_SERMA
FT                   (O68934) (64 aa) fasta scores: E(): 1.2e-19, 73.4% id in 64
FT                   aa, and to Salmonella typhimurium
FT                   bacterioferritin-associated ferredoxin Bfd SW:BFD_SALTY
FT                   (O68925) (64 aa) fasta scores: E(): 5.5e-16, 56.2% id in 64
FT                   aa"
FT                   /db_xref="InterPro:IPR007419"
FT                   /db_xref="InterPro:IPR041854"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384L2H3"
FT                   /protein_id="CAL18889.1"
FT                   /translation="MYVCLCNAVSDKVIRKAVRQHQPHTVKQLRQLVPIGSDCGKCIRQ
FT                   AREILIEELANIPEMNDVA"
FT   CDS_pept        220768..221241
FT                   /transl_table=11
FT                   /gene="bfr"
FT                   /locus_tag="YPO0206"
FT                   /product="bacterioferritin"
FT                   /note="Similar to Serratia marcescens bacterioferritin Bfr
FT                   SW:BFR_SERMA (O68935) (159 aa) fasta scores: E(): 0, 89.6%
FT                   id in 154 aa, and to Escherichia coli bacterioferritin Bfr
FT                   SW:BFR_ECOLI (P11056) (158 aa) fasta scores: E(): 0, 79.6%
FT                   id in 157 aa"
FT                   /db_xref="GOA:A0A384KLG6"
FT                   /db_xref="InterPro:IPR002024"
FT                   /db_xref="InterPro:IPR008331"
FT                   /db_xref="InterPro:IPR009040"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384KLG6"
FT                   /protein_id="CAL18890.1"
FT                   /translation="MKGDKKIIAHLNKLLGNELVAINQYFLHARMFKNWGLMRLNDKEY
FT                   HESIDEMKHADKYIERILFLEGIPNLQELGKLNIGEDVEEMLKSDLALELSGATDLREG
FT                   IAYADSIHDYVSRDLLKEILVDEEEHIDWLETELSLIDRLGIQSYSQAQLAKD"
FT   misc_feature    220768..221229
FT                   /note="Pfam match to entry PF01334
FT                   Bacteriofer,Bacterioferritin, score 343.70, E-value 2e-99"
FT                   /inference="protein motif:PF01334"
FT   CDS_pept        221655..221966
FT                   /transl_table=11
FT                   /gene="nusE"
FT                   /gene_synonym="rpsJ"
FT                   /locus_tag="YPO0209"
FT                   /product="30S ribosomal protein S10"
FT                   /note="Similar to Escherichia coli 30S ribosomal protein
FT                   S10 RpsJ SW:RS10_ECOLI (P02364) (103 aa) fasta scores: E():
FT                   0, 98.1% id in 103 aa"
FT                   /db_xref="GOA:P67906"
FT                   /db_xref="InterPro:IPR001848"
FT                   /db_xref="InterPro:IPR018268"
FT                   /db_xref="InterPro:IPR027486"
FT                   /db_xref="InterPro:IPR036838"
FT                   /db_xref="UniProtKB/Swiss-Prot:P67906"
FT                   /protein_id="CAL18891.1"
FT                   /translation="MQNQRIRIRLKAFDHRLIDQSTAEIVETAKRTGAQVRGPIPLPTR
FT                   KERFTVLISPHVNKDARDQYEIRTHKRLVDIVEPTEKTVDALMRLDLAAGVDVQISLG"
FT   misc_feature    221667..221954
FT                   /note="Pfam match to entry PF00338 Ribosomal_S10, Ribosomal
FT                   protein S10p/S20e, score 210.60, E-value 2.4e-59"
FT                   /inference="protein motif:PF00338"
FT   misc_feature    221739..221786
FT                   /note="PS00361 Ribosomal protein S10 signature."
FT                   /inference="protein motif:ProSite:PS00361"
FT   CDS_pept        221999..222628
FT                   /transl_table=11
FT                   /gene="rplC"
FT                   /locus_tag="YPO0210"
FT                   /product="50S ribosomal protein L3"
FT                   /note="Similar to Escherichia coli 50S ribosomal protein L3
FT                   RplC SW:RL3_ECOLI (P02386) (209 aa) fasta scores: E():
FT                   0,93.8% id in 209 aa"
FT                   /db_xref="GOA:Q8ZJA9"
FT                   /db_xref="InterPro:IPR000597"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR019926"
FT                   /db_xref="InterPro:IPR019927"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZJA9"
FT                   /protein_id="CAL18892.1"
FT                   /translation="MIGLVGKKVGMTRIFTEDGVSIPVTVIEIEANRVTQVKSLENDGY
FT                   RAVQVTTGAKKANRVTKPEAGHFAKAGVEAGRGLWEFRLPEGQEFTAGQEISVEIFADV
FT                   KKVDVTGTSKGKGFAGTVKRWNFRTQDATHGNSLSHRVPGSIGQNQTPGKVFKGKKMAG
FT                   HMGDERVTVQSLDVVRVDAERNLLLVKGAVPGATGGNLIVKPAVKA"
FT   misc_feature    222020..222610
FT                   /note="Pfam match to entry PF00297 Ribosomal_L3, Ribosomal
FT                   protein L3, score 345.90, E-value 4.5e-100"
FT                   /inference="protein motif:PF00297"
FT   misc_feature    222299..222370
FT                   /note="PS00474 Ribosomal protein L3 signature."
FT                   /inference="protein motif:ProSite:PS00474"
FT   CDS_pept        222645..223250
FT                   /transl_table=11
FT                   /gene="eryA"
FT                   /gene_synonym="rplD"
FT                   /locus_tag="YPO0211"
FT                   /product="50S ribosomal protein L4"
FT                   /note="Similar to Escherichia coli 50S ribosomal protein L4
FT                   RplD SW:RL4_ECOLI (P02388) (201 aa) fasta scores: E():
FT                   0,94.5% id in 201 aa and to Yersinia pseudotuberculosis 50S
FT                   ribosomal protein L4 RplD SW:RL4_YERPS (P11253) (201 aa)
FT                   fasta scores: E(): 0, 100.0% id in 201 aa"
FT                   /db_xref="GOA:P60730"
FT                   /db_xref="InterPro:IPR002136"
FT                   /db_xref="InterPro:IPR013005"
FT                   /db_xref="InterPro:IPR023574"
FT                   /db_xref="UniProtKB/Swiss-Prot:P60730"
FT                   /protein_id="CAL18893.1"
FT                   /translation="MELVMKDAPGALTVSETTFGRDFNEALVHQVVVAYAAGARQGTRA
FT                   QKTRAEVTGSGKKPWRQKGTGRARAGSVKSPIWRSGGVTFAAKPQDHSQKVNKKMYRGA
FT                   LKSILSELVRQDRLIIVEKFSVEAPKTKLLAQKLKDMALEDVLIVTGELDENLFLAARN
FT                   LYKVDVRDVAGIDPVSLIAFDKVVMTADAVKQVEEMLA"
FT   misc_feature    222675..223241
FT                   /note="Pfam match to entry PF00573 Ribosomal_L4, Ribosomal
FT                   protein L4/L1 family, score 199.40, E-value 5.4e-56"
FT                   /inference="protein motif:PF00573"
FT   CDS_pept        223247..223549
FT                   /transl_table=11
FT                   /gene="rplW"
FT                   /locus_tag="YPO0212"
FT                   /product="50S ribosomal protein L23"
FT                   /note="Similar to Escherichia coli 50S ribosomal protein
FT                   L23 RplW SW:RL23_ECOLI (P02424) (100 aa) fasta scores: E():
FT                   0, 92.0% id in 100 aa and to Yersinia pseudotuberculosis
FT                   50S ribosomal protein L23 RplW SW:RL23_YERPS (P11254) (100
FT                   aa) fasta scores: E(): 0, 100.0% id in 100 aa"
FT                   /db_xref="GOA:P69963"
FT                   /db_xref="InterPro:IPR001014"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR012678"
FT                   /db_xref="InterPro:IPR013025"
FT                   /db_xref="UniProtKB/Swiss-Prot:P69963"
FT                   /protein_id="CAL18894.1"
FT                   /translation="MIREERLLKVLRSPHVSEKASAAMEKNNTIVLKVAKDATKAEIKA
FT                   AVQKLFEVEVEDVNTLLVKGKSKRHGQRVGRRSDWKKAYVTLKEGQNLDFIGGAE"
FT   misc_feature    223247..223444
FT                   /note="PS00430 TonB-dependent receptor proteins signature
FT                   1."
FT                   /inference="protein motif:ProSite:PS00430"
FT   misc_feature    223268..223543
FT                   /note="Pfam match to entry PF00276 Ribosomal_L23, Ribosomal
FT                   protein L23, score 147.60, E-value 1.1e-42"
FT                   /inference="protein motif:PF00276"
FT   misc_feature    223487..223534
FT                   /note="PS00050 Ribosomal protein L23 signature."
FT                   /inference="protein motif:ProSite:PS00050"
FT   CDS_pept        223566..224390
FT                   /transl_table=11
FT                   /gene="rplB"
FT                   /locus_tag="YPO0213"
FT                   /product="50S ribosomal protein l2"
FT                   /note="Similar to Escherichia coli 50S ribosomal protein l2
FT                   RplB SW:RL2_ECOLI (P02387) (272 aa) fasta scores: E():
FT                   0,96.0% id in 272 aa and identical to Yersinia
FT                   pseudotuberculosis 50S ribosomal protein l2 RplB
FT                   SW:RL2_YERPS (P11255) (274 aa) fasta scores: E(): 0, 100.0%
FT                   id in 274 aa"
FT                   /db_xref="GOA:P60436"
FT                   /db_xref="InterPro:IPR002171"
FT                   /db_xref="InterPro:IPR005880"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR014726"
FT                   /db_xref="InterPro:IPR022666"
FT                   /db_xref="InterPro:IPR022669"
FT                   /db_xref="InterPro:IPR022671"
FT                   /db_xref="UniProtKB/Swiss-Prot:P60436"
FT                   /protein_id="CAL18895.1"
FT                   /translation="MAIVKCKPTSPGRRHVVKVVNPELHKGKPYAPLLEKLSKSGGRNN
FT                   NGRITTRHIGGGHKQHYRLVDFKRNKDGIPAVVERLEYDPNRSANIALVLYKDGERRYI
FT                   LAPKGLKAGDQIQSGVDAAIKAGNTLPMRNIPVGSTVHNVEMKPGKGGQLARSAGAYVQ
FT                   IVARDGSYVTLRLRSGEMRKVQADCRATLGEVGNAEHMLRVLGKAGASRWRGIRPTVRG
FT                   TAMNPVDHPHGGGEGRNFGKHPVTPWGVQTKGKKTRSNKRTDKFIVRRRSKK"
FT   misc_feature    223689..224384
FT                   /note="Pfam match to entry PF00181 Ribosomal_L2, Ribosomal
FT                   Proteins L2, score 475.80, E-value 3.5e-139"
FT                   /inference="protein motif:PF00181"
FT   misc_feature    224217..224252
FT                   /note="PS00467 Ribosomal protein L2 signature."
FT                   /inference="protein motif:ProSite:PS00467"
FT   CDS_pept        224405..224683
FT                   /transl_table=11
FT                   /gene="rpsS"
FT                   /locus_tag="YPO0214"
FT                   /product="30S ribosomal protein S19"
FT                   /note="Similar to Escherichia coli 30S ribosomal protein
FT                   S19 RpsS SW:RS19_ECOLI (P02375) (91 aa) fasta scores: E():
FT                   0, 95.6% id in 91 aa"
FT                   /db_xref="GOA:Q8ZJA8"
FT                   /db_xref="InterPro:IPR002222"
FT                   /db_xref="InterPro:IPR005732"
FT                   /db_xref="InterPro:IPR020934"
FT                   /db_xref="InterPro:IPR023575"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZJA8"
FT                   /protein_id="CAL18896.1"
FT                   /translation="MPRSLKKGPFIDLHLLKKVEKAVESGDKKPIRTWSRRSTVFPNMI
FT                   GLTIAVHNGRQHVPVFVSDEMVGHKLGEFAPTRTYRGHAADKKAKKR"
FT   misc_feature    224411..224653
FT                   /note="Pfam match to entry PF00203 Ribosomal_S19, Ribosomal
FT                   protein S19, score 187.20, E-value 1e-53"
FT                   /inference="protein motif:PF00203"
FT   misc_feature    224561..224635
FT                   /note="PS00323 Ribosomal protein S19 signature."
FT                   /inference="protein motif:ProSite:PS00323"
FT   CDS_pept        224698..225030
FT                   /transl_table=11
FT                   /gene="eryB"
FT                   /gene_synonym="rplV"
FT                   /locus_tag="YPO0215"
FT                   /product="50S ribosomal protein L22"
FT                   /note="Similar to Escherichia coli 50S ribosomal protein
FT                   L22 RplV SW:RL22_ECOLI (P02423) (110 aa) fasta scores: E():
FT                   0, 97.3% id in 110 aa"
FT                   /db_xref="GOA:Q8ZJA7"
FT                   /db_xref="InterPro:IPR001063"
FT                   /db_xref="InterPro:IPR005727"
FT                   /db_xref="InterPro:IPR018260"
FT                   /db_xref="InterPro:IPR036394"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZJA7"
FT                   /protein_id="CAL18897.1"
FT                   /translation="METIAKHRHARSSAQKVRLVADLIRGKKVSQALETLTYTNKKAAG
FT                   LVKKVLESAIANAEHNDGADIDDLKVTKIFVDEGPSMKRIMPRAKGRADRILKRTSHIT
FT                   VVVSDR"
FT   misc_feature    224710..225024
FT                   /note="Pfam match to entry PF00237 Ribosomal_L22, Ribosomal
FT                   protein L22p/L17e, score 204.30, E-value 1.8e-57"
FT                   /inference="protein motif:PF00237"
FT   misc_feature    224944..225018
FT                   /note="PS00464 Ribosomal protein L22 signature."
FT                   /inference="protein motif:ProSite:PS00464"
FT   CDS_pept        225048..225746
FT                   /transl_table=11
FT                   /gene="rpsC"
FT                   /locus_tag="YPO0216"
FT                   /product="30S ribosomal protein S3"
FT                   /note="Similar to Escherichia coli 30S ribosomal protein S3
FT                   RpsC SW:RS3_ECOLI (P02352) (232 aa) fasta scores: E():
FT                   0,98.3% id in 232 aa"
FT                   /db_xref="GOA:Q8ZJA6"
FT                   /db_xref="InterPro:IPR001351"
FT                   /db_xref="InterPro:IPR004044"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR005704"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR018280"
FT                   /db_xref="InterPro:IPR036419"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZJA6"
FT                   /protein_id="CAL18898.1"
FT                   /translation="MGQKVHPNGIRLGIVKAWNSTWYANTKEFADNLDSDFKVRQFLTK
FT                   ELAKASVSRIVIERPAKSIRVTIHTARPGIVIGKKGEDVEKLRKVVADIAGVPAQINIA
FT                   EVRKPELDAKLVADSITSQLERRVMFRRAMKRAVQNAMRLGAKGIKVEVSGRLGGAEIA
FT                   RTEWYREGRVPLHTLRADIDYNTSEAHTTYGVIGVKVWIFKGEILGGMAAVEQPEPAAQ
FT                   PKKQQRKGRK"
FT   misc_feature    225048..225233
FT                   /note="Pfam match to entry PF00417 Ribosomal_S3_N,Ribosomal
FT                   protein S3, N-terminal domain., score 103.10,E-value
FT                   4.6e-32"
FT                   /inference="protein motif:PF00417"
FT   misc_feature    225240..225383
FT                   /note="Pfam match to entry PF00013 KH-domain, KH
FT                   domain,score 35.90, E-value 9.1e-07"
FT                   /inference="protein motif:PF00013"
FT   misc_feature    225402..225653
FT                   /note="Pfam match to entry PF00189 Ribosomal_S3_C,Ribosomal
FT                   protein S3, C-terminal domain., score 189.40,E-value 2e-58"
FT                   /inference="protein motif:PF00189"
FT   misc_feature    225534..225638
FT                   /note="PS00548 Ribosomal protein S3 signature."
FT                   /inference="protein motif:ProSite:PS00548"
FT   CDS_pept        225759..226169
FT                   /transl_table=11
FT                   /gene="rplP"
FT                   /locus_tag="YPO0217"
FT                   /product="50S ribosomal protein L16"
FT                   /note="Similar to Escherichia coli 50S ribosomal protein
FT                   L16 RplP SW:RL16_ECOLI (P02414) (136 aa) fasta scores: E():
FT                   0, 91.9% id in 136 aa"
FT                   /db_xref="GOA:Q8ZJA5"
FT                   /db_xref="InterPro:IPR000114"
FT                   /db_xref="InterPro:IPR016180"
FT                   /db_xref="InterPro:IPR020798"
FT                   /db_xref="InterPro:IPR036920"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZJA5"
FT                   /protein_id="CAL18899.1"
FT                   /translation="MLQPKRTKFRKMHKGRNRGLAQGTDVSFGEFGLKACGRCRLTARQ
FT                   IEAARRAMTRAIKRQGKVWIRVFPDKPITEKPLEVRMGKGKGNVEYWVALIQPGKVLFE
FT                   MAGVPEETAREAFKLAAAKLPVGTTFVTKTVM"
FT   misc_feature    225759..226151
FT                   /note="Pfam match to entry PF00252 Ribosomal_L16, Ribosomal
FT                   protein L16, score 314.50, E-value 4.5e-91"
FT                   /inference="protein motif:PF00252"
FT   misc_feature    225930..225965
FT                   /note="PS00586 Ribosomal protein L16 signature 1."
FT                   /inference="protein motif:ProSite:PS00586"
FT   misc_feature    225999..226034
FT                   /note="PS00701 Ribosomal protein L16 signature 2."
FT                   /inference="protein motif:ProSite:PS00701"
FT   CDS_pept        226169..226360
FT                   /transl_table=11
FT                   /gene="rpmC"
FT                   /locus_tag="YPO0218"
FT                   /product="50S ribosomal protein L29"
FT                   /note="Similar to Escherichia coli 50S ribosomal protein
FT                   L29 RpmC SW:RL29_ECOLI (P02429) (63 aa) fasta scores: E():
FT                   1.3e-20, 93.7% id in 63 aa"
FT                   /db_xref="GOA:Q8ZJA4"
FT                   /db_xref="InterPro:IPR001854"
FT                   /db_xref="InterPro:IPR018254"
FT                   /db_xref="InterPro:IPR036049"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZJA4"
FT                   /protein_id="CAL18900.1"
FT                   /translation="MKAQELREKSVEELNTELLNLLREQFNLRMQAASGQLQQTHLLKQ
FT                   VRRNVARVKTLLTEKAGA"
FT   misc_feature    226175..226357
FT                   /note="Pfam match to entry PF00831 Ribosomal_L29, Ribosomal
FT                   L29 protein, score 97.20, E-value 3.3e-25"
FT                   /inference="protein motif:PF00831"
FT   misc_feature    226283..226327
FT                   /note="PS00579 Ribosomal protein L29 signature."
FT                   /inference="protein motif:ProSite:PS00579"
FT   CDS_pept        226360..226614
FT                   /transl_table=11
FT                   /gene="neaA"
FT                   /gene_synonym="rpsQ"
FT                   /locus_tag="YPO0219"
FT                   /product="30S ribosomal protein S17"
FT                   /note="Similar to Escherichia coli 30S ribosomal protein
FT                   S17 RpsQ SW:RS17_ECOLI (P02373) (83 aa) fasta scores: E():
FT                   0, 94.0% id in 83 aa"
FT                   /db_xref="GOA:Q8ZJA3"
FT                   /db_xref="InterPro:IPR000266"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019979"
FT                   /db_xref="InterPro:IPR019984"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZJA3"
FT                   /protein_id="CAL18901.1"
FT                   /translation="MTDQIRTLQGRVVSDKMEKSMVVAIERVVKHPIYGKFIRRTTKLH
FT                   VHDENNECGIGDVVEIRECRPLSKTKSWTLVRVVEKAIL"
FT   misc_feature    226387..226593
FT                   /note="Pfam match to entry PF00366 Ribosomal_S17, Ribosomal
FT                   protein S17, score 145.50, E-value 5e-42"
FT                   /inference="protein motif:PF00366"
FT   misc_feature    226525..226563
FT                   /note="PS00056 Ribosomal protein S17 signature."
FT                   /inference="protein motif:ProSite:PS00056"
FT   CDS_pept        226795..227166
FT                   /transl_table=11
FT                   /gene="rplN"
FT                   /locus_tag="YPO0220"
FT                   /product="50S ribosomal protein L14"
FT                   /note="Similar to Escherichia coli 50S ribosomal protein
FT                   L14 RplN SW:RL14_ECOLI (P02411) (123 aa) fasta scores: E():
FT                   0, 97.6% id in 123 aa"
FT                   /db_xref="GOA:Q7CFT7"
FT                   /db_xref="InterPro:IPR000218"
FT                   /db_xref="InterPro:IPR005745"
FT                   /db_xref="InterPro:IPR019972"
FT                   /db_xref="InterPro:IPR036853"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7CFT7"
FT                   /protein_id="CAL18902.1"
FT                   /translation="MIQEQTMLNVADNSGARRVMCIKVLGGSHRRYAGIGDIIKITIKE
FT                   AIPRGKVKKGDVLKAVVVRTKKGVRRPDGSVIRFDGNACVILNNNSEQPIGTRIFGPVT
FT                   RELRNEKFMKIISLAPEVL"
FT   misc_feature    226813..227163
FT                   /note="Pfam match to entry PF00238 Ribosomal_L14, Ribosomal
FT                   protein L14p/L23e, score 251.30, E-value 1.4e-71"
FT                   /inference="protein motif:PF00238"
FT   misc_feature    226972..227052
FT                   /note="PS00049 Ribosomal protein L14 signature."
FT                   /inference="protein motif:ProSite:PS00049"
FT   CDS_pept        227177..227491
FT                   /transl_table=11
FT                   /gene="rplX"
FT                   /locus_tag="YPO0221"
FT                   /product="50S ribosomal protein L24"
FT                   /note="Similar to Escherichia coli 50S ribosomal protein
FT                   L24 RplX SW:RL24_ECOLI (P02425) (103 aa) fasta scores: E():
FT                   0, 96.1% id in 103 aa"
FT                   /db_xref="GOA:Q8ZJA1"
FT                   /db_xref="InterPro:IPR003256"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR005825"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR041988"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZJA1"
FT                   /protein_id="CAL18903.1"
FT                   /translation="MAAKIRRDDEVIVLTGKDKGKRGKVKNVLSSGKVIVEGINLVKKH
FT                   QKPVPALNQPGGIVEKEAAIQVSNLALFNATTGKADRVGFRFEDGKKVRFFKSTSETIK
FT                   "
FT   misc_feature    227189..227359
FT                   /note="Pfam match to entry PF00467 Ribosomal_L24, KOW
FT                   motif, score 89.90, E-value 5.1e-23"
FT                   /inference="protein motif:PF00467"
FT   misc_feature    227198..227251
FT                   /note="PS01108 Ribosomal protein L24 signature."
FT                   /inference="protein motif:ProSite:PS01108"
FT   CDS_pept        227506..228045
FT                   /transl_table=11
FT                   /gene="rplE"
FT                   /locus_tag="YPO0222"
FT                   /product="50S ribosomal protein L5"
FT                   /note="Similar to Escherichia coli 50S ribosomal protein L5
FT                   RplE SW:RL5_ECOLI (P02389) (178 aa) fasta scores: E():
FT                   0,95.5% id in 178 aa"
FT                   /db_xref="GOA:Q8ZJA0"
FT                   /db_xref="InterPro:IPR002132"
FT                   /db_xref="InterPro:IPR020930"
FT                   /db_xref="InterPro:IPR022803"
FT                   /db_xref="InterPro:IPR031309"
FT                   /db_xref="InterPro:IPR031310"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZJA0"
FT                   /protein_id="CAL18904.1"
FT                   /translation="MAKLHDYYKDEVVKQLMSQFGYDSVMQVPRVEKITLNMGVGEAIA
FT                   DKKLLDNAAADLAAISGQKPFITKARKSVAGFKIRQGYPIGCKVTLRGERMWEFFERLI
FT                   TIAVPRIRDFRGLSAKSFDGRGNYSMGVREQIIFPEIDYDKVDRVRGLDITITTTAKSD
FT                   DEGRALLAAFKFPFRK"
FT   misc_feature    227575..227745
FT                   /note="Pfam match to entry PF00281 Ribosomal_L5, Ribosomal
FT                   protein L5, score 120.60, E-value 2.9e-32"
FT                   /inference="protein motif:PF00281"
FT   misc_feature    227755..228039
FT                   /note="Pfam match to entry PF00673 Ribosomal_L5_C,ribosomal
FT                   L5P family C-terminus, score 206.60, E-value 3.7e-58"
FT                   /inference="protein motif:PF00673"
FT   CDS_pept        228059..228364
FT                   /transl_table=11
FT                   /gene="rpsN"
FT                   /locus_tag="YPO0222a"
FT                   /product="30S ribosomal protein S14"
FT                   /note="Similar to Escherichia coli 30S ribosomal protein
FT                   S14 RpsN SW:RS14_ECOLI (P02370) (100 aa) fasta scores: E():
FT                   0, 89.0% id in 100 aa"
FT                   /db_xref="GOA:Q8ZJ99"
FT                   /db_xref="InterPro:IPR001209"
FT                   /db_xref="InterPro:IPR018271"
FT                   /db_xref="InterPro:IPR023036"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZJ99"
FT                   /protein_id="CAL18905.1"
FT                   /translation="MAKQSMKAREVVRVKLANKYRAKREELKAIISGVNSSDEDRWDAV
FT                   LKLQSLPRDSSPSRQRNRCNQTGRPHGFLRKFGLSRIKVRETAMRGEIPGLKKASW"
FT   CDS_pept        228398..228790
FT                   /transl_table=11
FT                   /gene="rpsH"
FT                   /locus_tag="YPO0223"
FT                   /product="30S ribosomal protein S8"
FT                   /note="Similar to Escherichia coli 30S ribosomal protein S8
FT                   RpsH SW:RS8_ECOLI (P02361) (129 aa) fasta scores: E():
FT                   0,94.6% id in 129 aa"
FT                   /db_xref="GOA:Q8ZJ98"
FT                   /db_xref="InterPro:IPR000630"
FT                   /db_xref="InterPro:IPR035987"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZJ98"
FT                   /protein_id="CAL18906.1"
FT                   /translation="MSMQDPIADMLTRIRNGQAANKVAVTMPSSKLKVAIANVLKEEGF
FT                   IEDFKIEGDTKPVLELALKYFQGKAVVESIQRISRPGLRIYKKKDELPKVMAGLGIAVI
FT                   STSKGVMTDRAARQAGLGGEIICYVA"
FT   misc_feature    228410..228787
FT                   /note="Pfam match to entry PF00410 Ribosomal_S8, Ribosomal
FT                   protein S8, score 252.10, E-value 2.4e-76"
FT                   /inference="protein motif:PF00410"
FT   misc_feature    228695..228748
FT                   /note="PS00053 Ribosomal protein S8 signature."
FT                   /inference="protein motif:ProSite:PS00053"
FT   CDS_pept        228805..229338
FT                   /transl_table=11
FT                   /gene="rplF"
FT                   /locus_tag="YPO0224"
FT                   /product="50S ribosomal protein L6"
FT                   /note="Similar to Escherichia coli 50S ribosomal protein L6
FT                   RplF SW:RL6_ECOLI (P02390) (176 aa) fasta scores: E():
FT                   0,89.8% id in 176 aa"
FT                   /db_xref="GOA:Q7CFT4"
FT                   /db_xref="InterPro:IPR000702"
FT                   /db_xref="InterPro:IPR002358"
FT                   /db_xref="InterPro:IPR019906"
FT                   /db_xref="InterPro:IPR020040"
FT                   /db_xref="InterPro:IPR036789"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7CFT4"
FT                   /protein_id="CAL18907.1"
FT                   /translation="MSRVAKAPVVIPAGVEVKLNGQVISIKGKNGELTRTVHSAVEVKQ
FT                   EENTLTFAPREGAVDGWAQAGTTRALLNSMVIGVTEGFTKKLQLVGVGYRAAVKGNVVN
FT                   LALGFSHPVDHELPAGITAECPTQTEIVLKGADKQVIGQVAADLRAYRRPEPYKGKGVR
FT                   YADEVVRTKEAKKK"
FT   misc_feature    228835..229335
FT                   /note="Pfam match to entry PF00347 Ribosomal_L6, Ribosomal
FT                   protein L6, score 308.20, E-value 9.8e-89"
FT                   /inference="protein motif:PF00347"
FT   misc_feature    229264..229290
FT                   /note="PS00525 Ribosomal protein L6 signature 1."
FT                   /inference="protein motif:ProSite:PS00525"
FT   CDS_pept        229348..229701
FT                   /transl_table=11
FT                   /gene="rplR"
FT                   /locus_tag="YPO0225"
FT                   /product="50S ribosomal protein L18"
FT                   /note="Similar to Escherichia coli 50S ribosomal protein
FT                   L18 RplR SW:RL18_ECOLI (P02419) (117 aa) fasta scores: E():
FT                   0, 92.3% id in 117 aa"
FT                   /db_xref="GOA:Q8ZJ96"
FT                   /db_xref="InterPro:IPR004389"
FT                   /db_xref="InterPro:IPR005484"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZJ96"
FT                   /protein_id="CAL18908.1"
FT                   /translation="MDKKAARIRRATRARRKLKELGATRLVVHRTPRHIYAQVIAPNGS
FT                   EILVAASTVEKAINEQLKYAGNKDAAAAVGKTIAERALEKGITKVSFDRSGFQYHGRVQ
FT                   ALADAAREAGLQF"
FT   misc_feature    229348..229698
FT                   /note="Pfam match to entry PF00861 Ribosomal_L18p,Ribosomal
FT                   L18p/L5e family, score 183.00, E-value 4.8e-51"
FT                   /inference="protein motif:PF00861"
FT   misc_feature    229555..229578
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:ProSite:PS00017"
FT   CDS_pept        229716..230219
FT                   /transl_table=11
FT                   /gene="rpsE"
FT                   /locus_tag="YPO0226"
FT                   /product="30S ribosomal protein S5"
FT                   /note="Similar to Escherichia coli 30S ribosomal protein S5
FT                   RpsE SW:RS5_ECOLI (P02356) (166 aa) fasta scores: E():
FT                   0,95.8% id in 166 aa"
FT                   /db_xref="GOA:Q8ZJ95"
FT                   /db_xref="InterPro:IPR000851"
FT                   /db_xref="InterPro:IPR005324"
FT                   /db_xref="InterPro:IPR005712"
FT                   /db_xref="InterPro:IPR013810"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018192"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZJ95"
FT                   /protein_id="CAL18909.1"
FT                   /translation="MSHIEKQAGELQEKLIAVNRVSKTVKGGRIFSFTALTVVGDGNGR
FT                   VGFGYGKAREVPAAIQKAMEKARRAMINVALNNGTLQHPVKGAHTGSRVFMQPASEGTG
FT                   IIAGGAMRAVLEVAGVHNVLAKAYGSTNPINVVRATIAALEDMKSPEMVAAKRGKSVEE
FT                   ILGK"
FT   misc_feature    229758..230144
FT                   /note="Pfam match to entry PF00333 Ribosomal_S5, Ribosomal
FT                   protein S5, score 259.00, E-value 6.4e-74"
FT                   /inference="protein motif:PF00333"
FT   misc_feature    229797..229895
FT                   /note="PS00585 Ribosomal protein S5 signature."
FT                   /inference="protein motif:ProSite:PS00585"
FT   CDS_pept        230222..230401
FT                   /transl_table=11
FT                   /gene="rpmD"
FT                   /locus_tag="YPO0227"
FT                   /product="50S ribosomal protein L30"
FT                   /note="Similar to Escherichia coli 50S ribosomal protein
FT                   L30 RpmD SW:RL30_ECOLI (P02430) (58 aa) fasta scores: E():
FT                   1.5e-22, 86.2% id in 58 aa"
FT                   /db_xref="GOA:Q7CFT2"
FT                   /db_xref="InterPro:IPR005996"
FT                   /db_xref="InterPro:IPR016082"
FT                   /db_xref="InterPro:IPR018038"
FT                   /db_xref="InterPro:IPR036919"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7CFT2"
FT                   /protein_id="CAL18910.1"
FT                   /translation="MAKTIKVTQTKSSIGRLPKHKATLIGLGLRRIGHTVEREDTPAVR
FT                   GMVNLVSYMVKVEE"
FT   misc_feature    230228..230386
FT                   /note="Pfam match to entry PF00327 Ribosomal_L30, Ribosomal
FT                   protein L30p/L7e, score 90.50, E-value 5.6e-26"
FT                   /inference="protein motif:PF00327"
FT   misc_feature    230288..230386
FT                   /note="PS00634 Ribosomal protein L30 signature."
FT                   /inference="protein motif:ProSite:PS00634"
FT   CDS_pept        230405..230839
FT                   /transl_table=11
FT                   /gene="rplO"
FT                   /locus_tag="YPO0228"
FT                   /product="50S ribosomal protein L15"
FT                   /note="Similar to Escherichia coli 50S ribosomal protein
FT                   L15 RplO SW:RL15_ECOLI (P02413) (144 aa) fasta scores: E():
FT                   0, 85.4% id in 144 aa"
FT                   /db_xref="GOA:Q8ZJ93"
FT                   /db_xref="InterPro:IPR001196"
FT                   /db_xref="InterPro:IPR005749"
FT                   /db_xref="InterPro:IPR021131"
FT                   /db_xref="InterPro:IPR030878"
FT                   /db_xref="InterPro:IPR036227"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZJ93"
FT                   /protein_id="CAL18911.1"
FT                   /translation="MRLNTLSPAEGAKHAPKRVGRGIGSGLGKTAGRGHKGQNSRSGGG
FT                   VRRGFEGGQMPLYRRLPKFGFTSRKAMITAEVRLSELALVEGDVIDLNTLKAANVVGIQ
FT                   MEFVKVILSGEVNRAVTLRGLRVTKGARAAIEAAGGKIEE"
FT   misc_feature    230405..230707
FT                   /note="Pfam match to entry PF01305 Ribosomal_L15, Ribosomal
FT                   protein L15 amino terminal region, score 219.70, E-value
FT                   4.2e-62"
FT                   /inference="protein motif:PF01305"
FT   misc_feature    230729..230824
FT                   /note="Pfam match to entry PF00256 L15, Ribosomal protein
FT                   L15, score 38.00, E-value 2e-12"
FT                   /inference="protein motif:PF00256"
FT   misc_feature    230729..230821
FT                   /note="PS00475 Ribosomal protein L15 signature."
FT                   /inference="protein motif:ProSite:PS00475"
FT   CDS_pept        230847..232178
FT                   /transl_table=11
FT                   /gene="prlA"
FT                   /gene_synonym="secY"
FT                   /locus_tag="YPO0229"
FT                   /product="preprotein translocase SecY subunit"
FT                   /note="Similar to Escherichia coli preprotein translocase
FT                   SecY subunit SW:SECY_ECOLI (P03844) (443 aa) fasta scores:
FT                   E(): 0, 98.0% id in 443 aa"
FT                   /db_xref="GOA:A0A384K961"
FT                   /db_xref="InterPro:IPR002208"
FT                   /db_xref="InterPro:IPR023201"
FT                   /db_xref="InterPro:IPR026593"
FT                   /db_xref="InterPro:IPR030659"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384K961"
FT                   /inference="protein motif:TMHMM:2.0"
FT                   /protein_id="CAL18912.1"
FT                   /translation="MAKQPGLDFQSAKGGLGELKRRLLFVIGALIVFRIGSFIPIPGID
FT                   ATVLAKLLEQQRGTIIEMFNMFSGGALSRASIFALGIMPYISASIIIQLLTVVHPALAE
FT                   IKKEGEAGRRKISQYTRYGTLVLAIFQSIGIATGLPNMPGMQGLVINPGFAFYFTAVVS
FT                   LVTGTMFLMWLGEQITERGIGNGISIIIFAGIVAGLPPAIAHTIEQARQGDLHFLLLLL
FT                   VAVLVFAVTFFVVFIERGQRRIVVNYAKRQQGRRVYAAQSTHLPLKVNMAGVIPAIFAS
FT                   SIILFPATIASWFGGGTGWNWLTTISMYLQPGQPLYVLLYASAIIFFCFFYTALVFNPR
FT                   ETADNLKKSGAFVPGIRPGEQTAKYIDKVMTRLTLIGAMYITFICLIPEFMRDAMKVPF
FT                   YFGGTSLLIVVVVIMDFMAQVQTLMMSSQYESALKKANLKGYNR"
FT   misc_feature    230910..230978
FT                   /gene="prlA"
FT                   /gene_synonym="secY"
FT                   /locus_tag="YPO0229"
FT                   /note="one of 10 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    231072..232103
FT                   /note="Pfam match to entry PF00344 secY, eubacterial secY
FT                   protein, score 685.90, E-value 2e-202"
FT                   /inference="protein motif:PF00344"
FT   misc_feature    231072..231140
FT                   /gene="prlA"
FT                   /gene_synonym="secY"
FT                   /locus_tag="YPO0229"
FT                   /note="one of 10 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    231072..231131
FT                   /note="PS00755 Protein secY signature 1."
FT                   /inference="protein motif:ProSite:PS00755"
FT   misc_feature    231201..231260
FT                   /gene="prlA"
FT                   /gene_synonym="secY"
FT                   /locus_tag="YPO0229"
FT                   /note="one of 10 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    231303..231371
FT                   /gene="prlA"
FT                   /gene_synonym="secY"
FT                   /locus_tag="YPO0229"
FT                   /note="one of 10 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    231363..231419
FT                   /note="PS00756 Protein secY signature 2."
FT                   /inference="protein motif:ProSite:PS00756"
FT   misc_feature    231390..231458
FT                   /gene="prlA"
FT                   /gene_synonym="secY"
FT                   /locus_tag="YPO0229"
FT                   /note="one of 10 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    231489..231557
FT                   /gene="prlA"
FT                   /gene_synonym="secY"
FT                   /locus_tag="YPO0229"
FT                   /note="one of 10 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    231666..231734
FT                   /gene="prlA"
FT                   /gene_synonym="secY"
FT                   /locus_tag="YPO0229"
FT                   /note="one of 10 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    231792..231860
FT                   /gene="prlA"
FT                   /gene_synonym="secY"
FT                   /locus_tag="YPO0229"
FT                   /note="one of 10 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    231951..232019
FT                   /gene="prlA"
FT                   /gene_synonym="secY"
FT                   /locus_tag="YPO0229"
FT                   /note="one of 10 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    232047..232115
FT                   /gene="prlA"
FT                   /gene_synonym="secY"
FT                   /locus_tag="YPO0229"
FT                   /note="one of 10 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        232212..232328
FT                   /transl_table=11
FT                   /gene="rpmJ"
FT                   /locus_tag="YPO0230"
FT                   /product="50S ribosomal protein L36"
FT                   /note="Similar to Escherichia coli 50S ribosomal protein
FT                   L36 RpmJ SW:RL36_ECOLI (P21194) (38 aa) fasta scores: E():
FT                   2.1e-15, 94.7% id in 38 aa"
FT                   /db_xref="GOA:Q8ZJ91"
FT                   /db_xref="InterPro:IPR000473"
FT                   /db_xref="InterPro:IPR035977"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZJ91"
FT                   /protein_id="CAL18913.1"
FT                   /translation="MKVRASVKKLCRNCKIVKRNGVVRVICSAEPKHKQRQG"
FT   misc_feature    232212..232325
FT                   /note="Pfam match to entry PF00444 Ribosomal_L36, Ribosomal
FT                   protein L36, score 61.00, E-value 4.2e-19"
FT                   /inference="protein motif:PF00444"
FT   misc_feature    232242..232322
FT                   /note="PS00828 Ribosomal protein L36 signature."
FT                   /inference="protein motif:ProSite:PS00828"
FT   CDS_pept        232476..232832
FT                   /transl_table=11
FT                   /gene="rpsM"
FT                   /locus_tag="YPO0231"
FT                   /product="30S ribosomal protein S13"
FT                   /note="Similar to Escherichia coli 30S ribosomal protein
FT                   S13 RpsM SW:RS13_ECOLI (P02369) (117 aa) fasta scores: E():
FT                   0, 85.5% id in 117 aa"
FT                   /db_xref="GOA:Q8ZJ90"
FT                   /db_xref="InterPro:IPR001892"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR018269"
FT                   /db_xref="InterPro:IPR019980"
FT                   /db_xref="InterPro:IPR027437"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZJ90"
FT                   /protein_id="CAL18914.1"
FT                   /translation="MARIAGINIPDQKHTVIALTAIFGIGKTRSQAICVAAGIAEHVKI
FT                   SELSEEQIEKLRDEVAKYVVEGDLRREVTLSIKRLMDLGTYRGLRHRRGLPVRGQRTKT
FT                   NARTRKGPRKPIKK"
FT   misc_feature    232482..232799
FT                   /note="Pfam match to entry PF00416 Ribosomal_S13, Ribosomal
FT                   protein S13/S18, score 205.70, E-value 7.1e-58"
FT                   /inference="protein motif:PF00416"
FT   misc_feature    232734..232775
FT                   /note="PS00646 Ribosomal protein S13 signature."
FT                   /inference="protein motif:ProSite:PS00646"
FT   CDS_pept        232849..233238
FT                   /transl_table=11
FT                   /gene="rpsK"
FT                   /locus_tag="YPO0232"
FT                   /product="30S ribosomal protein S11"
FT                   /note="Similar to Escherichia coli 30S ribosomal protein
FT                   S11 RpsK SW:RS11_ECOLI (P02366) (128 aa) fasta scores: E():
FT                   0, 98.4% id in 128 aa"
FT                   /db_xref="GOA:Q8ZJ89"
FT                   /db_xref="InterPro:IPR001971"
FT                   /db_xref="InterPro:IPR018102"
FT                   /db_xref="InterPro:IPR019981"
FT                   /db_xref="InterPro:IPR036967"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZJ89"
FT                   /protein_id="CAL18915.1"
FT                   /translation="MAKAPIRARKRVRKTVSDGVAHIHASFNNTIVTITDRQGNALGWA
FT                   TAGGSGFRGSRKSTPFAAQVAAERCAEAVKEYGIKNLEVMVKGPGPGRESTIRALNAAG
FT                   FRITNITDVTPIPHNGCRPPKKRRV"
FT   misc_feature    232906..233232
FT                   /note="Pfam match to entry PF00411 Ribosomal_S11, Ribosomal
FT                   protein S11, score 256.30, E-value 7e-79"
FT                   /inference="protein motif:PF00411"
FT   misc_feature    233137..233205
FT                   /note="PS00054 Ribosomal protein S11 signature."
FT                   /inference="protein motif:ProSite:PS00054"
FT   CDS_pept        233269..233889
FT                   /transl_table=11
FT                   /gene="ramA"
FT                   /gene_synonym="rpsD"
FT                   /locus_tag="YPO0233"
FT                   /product="30S ribosomal protein S4"
FT                   /note="Similar to Escherichia coli 30S ribosomal protein S4
FT                   RpsD SW:RS4_ECOLI (P02354) (205 aa) fasta scores: E():
FT                   0,96.1% id in 205 aa"
FT                   /db_xref="GOA:Q8ZJ88"
FT                   /db_xref="InterPro:IPR001912"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR005709"
FT                   /db_xref="InterPro:IPR018079"
FT                   /db_xref="InterPro:IPR022801"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZJ88"
FT                   /protein_id="CAL18916.1"
FT                   /translation="MARYLGPKLKLSRREGTDLFLKSGVRAIDTKCKIEQPPGQHGARK
FT                   PRLSDYGVQLREKQKVRRIYGVLERQFRNYYKEAARLKGNTGANLLQLLEGRLDNVVYR
FT                   MGFGATRAESRQLVSHKAIMVNGRVVNIASYQVSPNDVVSIREKAKKQSRVKAALELAE
FT                   QREKPTWLEVDAVKMEGVFKRIPERTDLSADINEHLIVELYSK"
FT   misc_feature    233269..233553
FT                   /note="Pfam match to entry PF00163 Ribosomal_S4, Ribosomal
FT                   protein S4/S9 N-terminal domain, score 139.40, E-value
FT                   6.5e-38"
FT                   /inference="protein motif:PF00163"
FT   misc_feature    233548..233622
FT                   /note="PS00632 Ribosomal protein S4 signature."
FT                   /inference="protein motif:ProSite:PS00632"
FT   misc_feature    233554..233697
FT                   /note="Pfam match to entry PF01479 S4, S4 domain, score
FT                   78.30, E-value 1.6e-19"
FT                   /inference="protein motif:PF01479"
FT   CDS_pept        233915..234904
FT                   /transl_table=11
FT                   /gene="rpoA"
FT                   /locus_tag="YPO0234"
FT                   /product="DNA-directed RNA polymerase alpha chain"
FT                   /EC_number="2.7.7.6"
FT                   /note="Similar to Escherichia coli, and Salmonella
FT                   typhimurium DNA-directed RNA polymerase alpha chain RpoA
FT                   SW:RPOA_ECOLI (P00574) (329 aa) fasta scores: E(): 0, 99.4%
FT                   id in 329 aa"
FT                   /db_xref="GOA:Q8ZJ87"
FT                   /db_xref="InterPro:IPR011260"
FT                   /db_xref="InterPro:IPR011262"
FT                   /db_xref="InterPro:IPR011263"
FT                   /db_xref="InterPro:IPR011773"
FT                   /db_xref="InterPro:IPR036603"
FT                   /db_xref="InterPro:IPR036643"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZJ87"
FT                   /protein_id="CAL18917.1"
FT                   /translation="MQGSVTEFLKPRLVDIEQVSSTHAKVTLEPLERGFGHTLGNALRR
FT                   ILLSSMPGCAVTEVEIDGVLHEYSTKEGVQEDILEILLNLKGLAVRVQGKDEVILTLNK
FT                   SGIGPVTAADITHDGDVEIVKPQHVICHLTDENASINMRIKVQRGRGYVPASARIHSEE
FT                   DERPIGRLLVDACYSPVERIAYNVEAARVEQRTDLDKLVIEMETNGTIDPEEAIRRAAT
FT                   ILAEQLEAFVDLRDVRQPEVKEEKPEFDPILLRPVDDLELTVRSANCLKAEAIHYIGDL
FT                   VQRTEVELLKTPNLGKKSLTEIKDVLASRGLSLGMRLENWPPASIADE"
FT   misc_feature    233930..234598
FT                   /note="Pfam match to entry PF01000 RNA_pol_A_bac, Bacterial
FT                   RNA polymerase, alpha chain, score 385.10, E-value 7e-112"
FT                   /inference="protein motif:PF01000"
FT   CDS_pept        234945..235334
FT                   /transl_table=11
FT                   /gene="rplQ"
FT                   /locus_tag="YPO0235"
FT                   /product="50S ribosomal protein L17"
FT                   /note="Similar to Escherichia coli 50S ribosomal protein
FT                   L17 RplQ SW:RL17_ECOLI (P02416) (127 aa) fasta scores: E():
FT                   0, 94.5% id in 127 aa"
FT                   /db_xref="GOA:Q7CFS8"
FT                   /db_xref="InterPro:IPR000456"
FT                   /db_xref="InterPro:IPR036373"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7CFS8"
FT                   /protein_id="CAL18918.1"
FT                   /translation="MRHRKSGRQLNRNSSHRQAMFRNMAGSLVRHEIIKTTLPKAKELR
FT                   RVVEPLITLAKTDNVANRRLAFARTRDNEIVAKLFNELGPRFASRAGGYTRILKCGFRA
FT                   GDNAPMAYIELVDRAASQAEVVAAE"
FT   misc_feature    235002..235292
FT                   /note="Pfam match to entry PF01196 Ribosomal_L17, Ribosomal
FT                   protein L17, score 231.80, E-value 9.8e-66"
FT                   /inference="protein motif:PF01196"
FT   misc_feature    235044..235112
FT                   /note="PS01167 Ribosomal protein L17 signature."
FT                   /inference="protein motif:ProSite:PS01167"
FT   CDS_pept        235781..236206
FT                   /transl_table=11
FT                   /locus_tag="YPO0236"
FT                   /product="MerR-family transcriptional regulator"
FT                   /note="Similar to Escherichia coli zinc responsive
FT                   regulator of the zinc/cadmium expoter, ZntR SW:ZNTR_ECOLI
FT                   (P36676) (141 aa) fasta scores: E(): 0, 69.6% id in 135 aa"
FT                   /db_xref="GOA:A0A384LD54"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR011788"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384LD54"
FT                   /protein_id="CAL18919.1"
FT                   /translation="MLKIGQLAKLADVTPDTIRYYEKQGMMDHGERTDGGYRLYTDQDL
FT                   QRLRFIRYAKQLGFTLDTIAELLSIRIDPDHHTCQESKSIVDSRLSDVEGKIRELERMR
FT                   DSLKRLSEACCGTSHATTYCSILEALEQGATEELIKV"
FT   misc_feature    235784..235849
FT                   /note="Predicted helix-turn-helix motif with score 1795
FT                   (+5.30 SD) at aa 5-26, sequence LKIGQLAKLADVTPDTIRYYEK"
FT   misc_feature    235793..235900
FT                   /note="Pfam match to entry PF00376 merR, Bacterial
FT                   regulatory proteins, merR family, score 67.60, E-value
FT                   2.7e-16"
FT                   /inference="protein motif:PF00376"
FT   misc_feature    235793..235861
FT                   /note="PS00552 Bacterial regulatory proteins, merR family
FT                   signature."
FT                   /inference="protein motif:ProSite:PS00552"
FT   CDS_pept        236294..236494
FT                   /transl_table=11
FT                   /locus_tag="YPO0237"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Escherichia coli hypothetical protein
FT                   YhdL SW:YHDL_ECOLI (P36675) (72 aa) fasta scores: E():
FT                   5.5e-17, 69.4% id in 62 aa"
FT                   /db_xref="GOA:A0A384KAM4"
FT                   /db_xref="InterPro:IPR005589"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384KAM4"
FT                   /protein_id="CAL18920.1"
FT                   /translation="MTTYRHTKGKIKDNALEALLHDPLFRQRIEKNSKGKGSYQRKEKY
FT                   AKGSNWEASGKQSIDFLLLAF"
FT   CDS_pept        complement(236604..237017)
FT                   /transl_table=11
FT                   /gene="mscL"
FT                   /locus_tag="YPO0238"
FT                   /product="mechanosensitive ion channel"
FT                   /note="Similar to Escherichia coli O157:H7 mechanosensitive
FT                   ion channel MscL TR:AAG58412 (EMBL:AE005556) (136 aa) fasta
FT                   scores: E(): 0, 75.9% id in 137 aa"
FT                   /db_xref="GOA:Q8ZJ83"
FT                   /db_xref="InterPro:IPR001185"
FT                   /db_xref="InterPro:IPR019823"
FT                   /db_xref="InterPro:IPR036019"
FT                   /db_xref="InterPro:IPR037673"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZJ83"
FT                   /inference="protein motif:TMHMM:2.0"
FT                   /inference="similar to sequence:INSDC:AE005556"
FT                   /protein_id="CAL18921.1"
FT                   /translation="MSFMKEFREFAMRGNVVDLAVGVIIGAAFGRIVSSLVADIIMPPL
FT                   GLLLGGVDFKQFHFVLRAAEGTIPAVVMNYGTFIQSIFDFVIVALAIFSAVKLMNKLRR
FT                   EKAEEEPATPPAPTTEEILLAEIRDLLKAQHTK"
FT   misc_feature    complement(236616..237011)
FT                   /note="Pfam match to entry PF01741 MscL, Large-conductance
FT                   mechanosensitive channel, MscL, score 274.30, E-value
FT                   1.6e-78"
FT                   /inference="protein motif:PF01741"
FT   misc_feature    complement(236730..236786)
FT                   /gene="mscL"
FT                   /locus_tag="YPO0238"
FT                   /note="one of 2 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    complement(236904..236969)
FT                   /gene="mscL"
FT                   /locus_tag="YPO0238"
FT                   /note="one of 2 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    complement(236940..236981)
FT                   /note="PS01327 Large-conductance mechanosensitive channels
FT                   mscL family signature."
FT                   /inference="protein motif:ProSite:PS01327"
FT   CDS_pept        complement(237156..238532)
FT                   /transl_table=11
FT                   /gene="trkA"
FT                   /locus_tag="YPO0239"
FT                   /product="trk system potassium uptake protein"
FT                   /note="Similar to Escherichia coli Trk system potassium
FT                   uptake protein TrkA SW:TRKA_ECOLI (P23868) (458 aa) fasta
FT                   scores: E(): 0, 86.2% id in 458 aa"
FT                   /db_xref="GOA:A0A384LNH6"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR006036"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384LNH6"
FT                   /protein_id="CAL18922.1"
FT                   /translation="MKIIILGAGQVGGTLAENLVGENNDITVVDIDSGRLRQLQDKFDL
FT                   RVVQGYGSHPRVLREAGAEDADMLVAVTNSDETNMIACQIAYSLFNTPNRIARIRSTEY
FT                   IREADKLFLPEAVPIDHLISPEQLVIDYIYKLIEYPGALQVVNFAEGKVSIAAVKAYYG
FT                   GPLVGNALSSLREHMPHIDTRVAAIFRQDRPIRPQGSTIIEAGDEVFFVAASQHIRAVM
FT                   SELQRLEKPYKRIMIVGGGNVGAGLALRLEKDYSVKLIERDQQRAAELAEMLHDTIVFY
FT                   GDASDQELLAEEHIEQVDVFIAITNDDEANIMSAMLAKRMGAKKAMVLIQRSAYVDLVQ
FT                   GSVIDIVISPQQATISALLGHVRKADIVSVSSLRRGVAEAIEAIAHGDESTSKVVGRMV
FT                   EDIKLPPGTTIGAIVRGDEVIIANSNSIIKQGDHVIMFITHKKFVPDVERLFQPSPFFL
FT                   "
FT   misc_feature    complement(237168..237431)
FT                   /note="Pfam match to entry PF02080 TrkA, Potassium
FT                   channel,score 58.80, E-value 1.2e-13"
FT                   /inference="protein motif:PF02080"
FT   misc_feature    complement(237483..237833)
FT                   /note="Pfam match to entry PF02254 KTN, KTN NAD-binding
FT                   domain, score 55.50, E-value 1.2e-12"
FT                   /inference="protein motif:PF02254"
FT   misc_feature    complement(237846..238115)
FT                   /note="Pfam match to entry PF02080 TrkA, Potassium
FT                   channel,score 83.60, E-value 3.9e-21"
FT                   /inference="protein motif:PF02080"
FT   misc_feature    complement(238158..238529)
FT                   /note="Pfam match to entry PF02254 KTN, KTN NAD-binding
FT                   domain, score 75.40, E-value 1.2e-18"
FT                   /inference="protein motif:PF02254"
FT   CDS_pept        complement(238588..239877)
FT                   /transl_table=11
FT                   /locus_tag="YPO0240"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Escherichia coli hypothetical protein Sun
FT                   which belongs to the Bacterial Sun-family and the
FT                   Eukaryotic nucleolar Nol1/Nop2 family SW:SUN_ECOLI (P36929)
FT                   (429 aa) fasta scores: E(): 0, 73.9% id in 429 aa"
FT                   /db_xref="GOA:Q8ZJ81"
FT                   /db_xref="InterPro:IPR001678"
FT                   /db_xref="InterPro:IPR004573"
FT                   /db_xref="InterPro:IPR006027"
FT                   /db_xref="InterPro:IPR018314"
FT                   /db_xref="InterPro:IPR023267"
FT                   /db_xref="InterPro:IPR023541"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR035926"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZJ81"
FT                   /protein_id="CAL18923.1"
FT                   /translation="MKNTYNLRSIAAKAISQVLDQGQSLSAVLPELQKNISDKDRALLQ
FT                   ELCFGTLRVLPQLEWCIQQLMARPMTGKQRVFHYLIMVGLYQLIYTRIPPHAALAETVE
FT                   GATVLKRPQLKGLINGVLRQFQRQQVELLERAVNNDSHYLHPSWLLARIKQAYPAQWQQ
FT                   ILDANNQRPPMWLRVNRLHHSRSEYLELLTQADINAEPHPIYRDAVRLITPCAVNHLPG
FT                   FELGWVTVQDASAQGCVDLLDPQNGEQILDLCAAPGGKTTHILEAAPKAHVLAVDIDEQ
FT                   RLSRVKENLQRLQLQAVVRVGDGRAPDTWCGDQQFDRILLDAPCSATGVIRRHPDIKWL
FT                   RRDRDISELAQLQSEIIEAIWPKLKHGGVLVYATCSILPEENQQQIAAFLQRHPEAQLT
FT                   ETGTTAAPGKQNLPHPEDGDGFFYAKIIKK"
FT   misc_feature    complement(238597..239388)
FT                   /note="Pfam match to entry PF01189
FT                   Nol1_Nop2_Sun,NOL1/NOP2/sun family, score 417.40, E-value
FT                   1.3e-121"
FT                   /inference="protein motif:PF01189"
FT   misc_feature    complement(238897..238932)
FT                   /note="PS01153 NOL1/NOP2/sun family signature."
FT                   /inference="protein motif:ProSite:PS01153"
FT   misc_feature    complement(239500..239859)
FT                   /note="Pfam match to entry PF01029 NusB, NusB family, score
FT                   177.20, E-value 2.7e-49"
FT                   /inference="protein motif:PF01029"
FT   CDS_pept        complement(239971..240918)
FT                   /transl_table=11
FT                   /gene="fmt"
FT                   /locus_tag="YPO0241"
FT                   /product="methionyl-tRNA formyltransferase"
FT                   /EC_number="2.1.2.9"
FT                   /note="Similar to Escherichia coli methionyl-tRNA
FT                   formyltransferase Fmt SW:FMT_ECOLI (P23882) (314 aa) fasta
FT                   scores: E(): 0, 75.8% id in 314 aa"
FT                   /db_xref="GOA:Q8ZJ80"
FT                   /db_xref="InterPro:IPR001555"
FT                   /db_xref="InterPro:IPR002376"
FT                   /db_xref="InterPro:IPR005793"
FT                   /db_xref="InterPro:IPR005794"
FT                   /db_xref="InterPro:IPR011034"
FT                   /db_xref="InterPro:IPR036477"
FT                   /db_xref="InterPro:IPR037022"
FT                   /db_xref="InterPro:IPR041711"
FT                   /db_xref="PDB:3R8X"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZJ80"
FT                   /protein_id="CAL18924.1"
FT                   /translation="MSDSLRIIFAGTPDFAARHLGALLSSQHKIVGVFTQPDRPAGRGN
FT                   KLTPSPVKILAEHHGIPVFQPKSLRPEENQHLVADLNADIMVVVAYGLILPAAVLAMPR
FT                   LGCINVHGSLLPRWRGAAPIQRSVWAGDEKTGITIMQMDIGLDTGAMLHKIECAIQPED
FT                   TSATLYDKLAQLGPQGLLITLQQLAAGTALAEVQNETQATYAEKLSKEEAKLDWTLSAT
FT                   QLERCIRAFNPWPVSYFIVDEQPIKVWQAQVLPAGEDAEPGTIIHADKHGIQVATADGV
FT                   LNITQLQPAGKKAMSAADLLNSRREWFIPGSQLV"
FT   misc_feature    complement(240367..240912)
FT                   /note="Pfam match to entry PF00551 formyl_transf, Formyl
FT                   transferase, score 241.70, E-value 1e-68"
FT                   /inference="protein motif:PF00551"
FT   CDS_pept        complement(240943..241455)
FT                   /transl_table=11
FT                   /gene="def"
FT                   /gene_synonym="fms"
FT                   /locus_tag="YPO0242"
FT                   /product="polypeptide deformylase"
FT                   /EC_number="3.5.1.31"
FT                   /note="Similar to Escherichia coli polypeptide deformylase
FT                   Def SW:DEF_ECOLI (P27251) (168 aa) fasta scores: E():
FT                   0,89.3% id in 168 aa"
FT                   /db_xref="GOA:Q8ZJ79"
FT                   /db_xref="InterPro:IPR023635"
FT                   /db_xref="InterPro:IPR036821"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZJ79"
FT                   /protein_id="CAL18925.1"
FT                   /translation="MSVLQVLHYPDERLRKIAAPVKEVNGEIQRIVDDMFETMYAEEGI
FT                   GLAATQVDVHQQIIVIDISENRDQRLVLINPELLEKSGETGIEEGCLSIPEQRALVPRA
FT                   EKVKIRALDRDGKPFELETDGLLAICIQHEMDHLIGKLFVDYLSPLKRQRIRQKLEKMA
FT                   KLNARAN"
FT   misc_feature    complement(241027..241443)
FT                   /note="Pfam match to entry PF01327
FT                   Pep_deformylase,Polypeptide deformylase, score 260.60,
FT                   E-value 2.1e-74"
FT                   /inference="protein motif:PF01327"
FT   CDS_pept        241590..242711
FT                   /transl_table=11
FT                   /locus_tag="YPO0243"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Escherichia coli hypothetical protein Smf
FT                   SW:SMF_ECOLI (P30852) (374 aa) fasta scores: E(): 0, 54.0%
FT                   id in 374 aa, and to Haemophilus influenzae Smf protein
FT                   SW:SMF_HAEIN (P43862) (373 aa) fasta scores: E(): 0, 44.0%
FT                   id in 368 aa"
FT                   /db_xref="GOA:A0A384LHF7"
FT                   /db_xref="InterPro:IPR003488"
FT                   /db_xref="InterPro:IPR041614"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384LHF7"
FT                   /protein_id="CAL18926.1"
FT                   /translation="MLAAELWLRMTQVKGLGVVKRSALAKRLLASGDIHPGRLAAYGLD
FT                   SQQCHQFAQLSPRYIADTLEWLSDPNHHLLTYGEPGYPPRLVHIAGAPLVLFVSGELDV
FT                   LYRPQIAMVGSRHFSHYGEQWGRYFASELARTGLVITSGLAVGIDGICHQAALNIQGRT
FT                   IAVLGSGLENIYPQRHSRLAKEIEYQGGALVSEFLTTALPIAAHFPRRNRIISGLSDAV
FT                   LVVEATLKSGSLITARYAMDQGRDVFALPGPLGSASSEGTHWLIQQGAYLATSVKDVSE
FT                   QVSGSLQWLSLPEEVIISSPQEQVELPFADVLANVGDEVTPVDVVAERAGQPVQDIASK
FT                   LLELELAGWIAAVPGGYVRIRRAGHVRRSNLLI"
FT   misc_feature    241785..242411
FT                   /note="Pfam match to entry PF02481 SMF, , score
FT                   363.70,E-value 2e-105"
FT                   /inference="protein motif:PF02481"
FT   CDS_pept        242719..243156
FT                   /transl_table=11
FT                   /locus_tag="YPO0244"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Escherichia coli hypothetical protein Smg
FT                   SW:SMG_ECOLI (P30853) (157 aa) fasta scores: E(): 0, 68.3%
FT                   id in 145 aa"
FT                   /db_xref="InterPro:IPR007456"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZJ77"
FT                   /protein_id="CAL18927.1"
FT                   /translation="MHNEPEMLVDQDKITDDLADAGFYREDINNALNWLEVLADLQEGQ
FT                   KAPYLYTADPQALRIYTVEECRRLGAACRGFILFLEQIQVLQFDTREMVIDRIMALDSP
FT                   EIDLEDLKWVVLMVLFNIPGYENAYKQMEELLFEVNDGYLH"
FT   CDS_pept        243197..243736
FT                   /transl_table=11
FT                   /locus_tag="YPO0245"
FT                   /product="putative DNA-binding protein"
FT                   /note="Similar to the C-terminal DNA-binding zinc finger
FT                   domains of several DNA topoisomerases e.g. Bacillus
FT                   subtilis SW:TOP1_BACSU (P39814) (691 aa) fasta scores: E():
FT                   3.3e-15, 40.7% id in 108 aa. Also similar to Escherichia
FT                   coli hypothetical protein YrdD SW:YRDD_ECOLI (P45771) (169
FT                   aa) fasta scores: E(): 0, 69.0% id in 155 aa"
FT                   /db_xref="GOA:Q0WK62"
FT                   /db_xref="InterPro:IPR000380"
FT                   /db_xref="InterPro:IPR013498"
FT                   /db_xref="UniProtKB/TrEMBL:Q0WK62"
FT                   /protein_id="CAL18928.1"
FT                   /translation="MTKKVITKDNGSCPECGSALVIRSGGHGPFLGCSHYPDCQYIRPL
FT                   KAQADGHVVKTLEGQPCPECGSDMMLRQGRFGMFIGCSQYPQCDHTEVIDKPDETSIDC
FT                   PQCGQGKLLQRKSRFGKVFHACNRYPDCQFTLNQPPIAGKCGYCHYPLLIEKRTARGIK
FT                   RICASKLCGKAVASES"
FT   misc_feature    243224..243340
FT                   /note="Pfam match to entry PF01396
FT                   zf-C4_Topoisom,Topoisomerase DNA binding C4 zinc finger,
FT                   score 64.40,E-value 2.5e-15"
FT                   /inference="protein motif:PF01396"
FT   misc_feature    243371..243487
FT                   /note="Pfam match to entry PF01396
FT                   zf-C4_Topoisom,Topoisomerase DNA binding C4 zinc finger,
FT                   score 70.20,E-value 4.4e-17"
FT                   /inference="protein motif:PF01396"
FT   misc_feature    243497..243619
FT                   /note="Pfam match to entry PF01396
FT                   zf-C4_Topoisom,Topoisomerase DNA binding C4 zinc finger,
FT                   score 64.90,E-value 1.7e-15"
FT                   /inference="protein motif:PF01396"
FT   CDS_pept        243738..244310
FT                   /transl_table=11
FT                   /locus_tag="YPO0245a"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Escherichia coli hypothetical protein
FT                   YrdC SW:YRDC_ECOLI (P45748) (190 aa) fasta scores: E():
FT                   0,67.9% id in 190 aa"
FT                   /db_xref="GOA:Q74XX5"
FT                   /db_xref="InterPro:IPR006070"
FT                   /db_xref="InterPro:IPR017945"
FT                   /db_xref="InterPro:IPR023535"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q74XX5"
FT                   /protein_id="CAL18929.1"
FT                   /translation="MNQQENNFVLADIVRALRQEEVIAYPTEAVFGLGCDPDSEKAVNT
FT                   LLALKQRPWQKGLILVAANYAQLEPYINDSMLNEIQRETLFSTWPGPITWVIPARVETP
FT                   QWLTGCFDSLAVRVSNHPLVQQLCAEYGKPLVSTSANLSGHEPCRTEEEVRIQFGPSLP
FT                   VLSGHVGGRLNPSEIRDALTGKRFRQG"
FT   misc_feature    243801..243839
FT                   /note="PS01147 SUA5/yciO/yrdC family signature."
FT                   /inference="protein motif:ProSite:PS01147"
FT   CDS_pept        244319..245140
FT                   /transl_table=11
FT                   /gene="aroE"
FT                   /locus_tag="YPO0246"
FT                   /product="shikimate 5-dehydrogenase"
FT                   /EC_number="1.1.1.25"
FT                   /note="Similar to Escherichia coli shikimate
FT                   5-dehydrogenase AroE SW:AROE_ECOLI (P15770) (272 aa) fasta
FT                   scores: E(): 0, 61.7% id in 269 aa"
FT                   /db_xref="GOA:Q8ZJ74"
FT                   /db_xref="InterPro:IPR006151"
FT                   /db_xref="InterPro:IPR011342"
FT                   /db_xref="InterPro:IPR013708"
FT                   /db_xref="InterPro:IPR022893"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR041121"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZJ74"
FT                   /protein_id="CAL18930.1"
FT                   /translation="MDQKFAVFGNPISHSKSPRIHTLFSEQTGIEHRYGKVLAPSEAFE
FT                   NTLVSFFADGAQGANITTPFKERAYDQCDELTDRASLAGAVNTIKRLEDGRLLGDNTDG
FT                   IGLLSDLERQNLIRTTDHILLVGAGGAARGVILPLLSYGCTVVVTNRTHTRAQQLAKVF
FT                   NHIGDIDVCEMSELAGQRFDLVINATASGLHGEVPNLPAAILTSQTRCYDMFYQAGTTP
FT                   FLAWAQRLGLADYADGLGMLVGQAAHAFKLWHGVMPEITPVLAQLRSELGK"
FT   misc_feature    244376..245086
FT                   /note="Pfam match to entry PF01488 Shikimate_DH, Shikimate
FT                   / quinate 5-dehydrogenase, score 323.40, E-value 2.5e-93"
FT                   /inference="protein motif:PF01488"
FT   CDS_pept        complement(245195..245725)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="YPO0247"
FT                   /product="putative transferase (pseudogene)"
FT                   /note="Similar to many proteins of undefined function e.g.
FT                   Escherichia coli O157:H7 putative transferase z4650
FT                   TR:AAG58401 (EMBL:AE005555) (256 aa) fasta scores: E():
FT                   0,72.7% id in 172 aa. This CDS has been disrupted by a
FT                   IS100 element."
FT                   /db_xref="PSEUDO:CAL18931.1"
FT                   /inference="similar to sequence:INSDC:AE005555"
FT   misc_feature    complement(245342..245395)
FT                   /note="Pfam match to entry PF00132 hexapep, Bacterial
FT                   transferase hexapeptide (four repeats), score 13.00,E-value
FT                   7.2"
FT                   /inference="protein motif:PF00132"
FT   misc_feature    complement(245396..245449)
FT                   /note="Pfam match to entry PF00132 hexapep, Bacterial
FT                   transferase hexapeptide (four repeats), score 12.60,E-value
FT                   9.3"
FT                   /inference="protein motif:PF00132"
FT   misc_feature    complement(245534..245587)
FT                   /note="Pfam match to entry PF00132 hexapep, Bacterial
FT                   transferase hexapeptide (four repeats), score 7.20, E-value
FT                   80"
FT                   /inference="protein motif:PF00132"
FT   misc_feature    complement(245597..245650)
FT                   /note="Pfam match to entry PF00132 hexapep, Bacterial
FT                   transferase hexapeptide (four repeats), score 11.90,E-value
FT                   16"
FT                   /inference="protein motif:PF00132"
FT   misc_feature    complement(245651..245704)
FT                   /note="Pfam match to entry PF00132 hexapep, Bacterial
FT                   transferase hexapeptide (four repeats), score 0.30, E-value
FT                   7e+02"
FT                   /inference="protein motif:PF00132"
FT   repeat_region   complement(245726..247679)
FT                   /note="insertion sequence:IS100"
FT   repeat_region   245726..245753
FT                   /rpt_type=INVERTED
FT                   /note="IS100 inverted repeat"
FT   CDS_pept        complement(245792..246574)
FT                   /transl_table=11
FT                   /gene="ypmt1.57c"
FT                   /locus_tag="YPO0248"
FT                   /product="insertion sequence IS100, ATP-binding protein"
FT                   /note="Similar to Escherichia coli insertion sequence IS21
FT                   putative ATP-binding protein, IstB SW:ISTB_ECOLI (P15026)
FT                   (265 aa) fasta scores: E(): 0, 47.4% id in 249 aa. Also
FT                   almost identical to Yersinia pestis and Escherichia coli
FT                   putative IS100 transposase ypmt1.57c TR:Q9R3L5
FT                   (EMBL:AL117211) (260 aa) fasta scores: E(): 0, 99.6% id in
FT                   260 aa."
FT                   /db_xref="GOA:Q7ARK4"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR002611"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028350"
FT                   /db_xref="UniProtKB/TrEMBL:Q7ARK4"
FT                   /inference="similar to sequence:INSDC:AL117211"
FT                   /protein_id="CAL18932.1"
FT                   /translation="MMMELQHQRLMALAGQLQLESLISAAPALSQQAVDQEWSYMDFLE
FT                   HLLHEEKLARHQRKQAMYTRMAAFPAVKTFEEYDFTFATGAPQKQLQSLRSLSFIERNE
FT                   NIVLLGPSGVGKTHLAIAMGYEAVRAGIKVRFTTAADLLLQLSTAQRQGRYKTTLQRGV
FT                   MAPRLLIIDEIGYLPFSQEEAKLFFQVIAKRYEKSAMILTSNLPFGQWDQTFAGDAALT
FT                   SAMLDRILHHSHVVQIKGESYRLRQKRKAGVIAEANPE"
FT   misc_feature    complement(245867..246406)
FT                   /note="Pfam match to entry PF01695 IstB, IstB-like ATP
FT                   binding protein, score 367.20, E-value 1.7e-106"
FT                   /inference="protein motif:PF01695"
FT   misc_feature    complement(246224..246247)
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:ProSite:PS00017"
FT   CDS_pept        complement(246571..247593)
FT                   /transl_table=11
FT                   /gene="y1093"
FT                   /gene_synonym="ypmt1"
FT                   /locus_tag="YPO0249"
FT                   /product="transposase for insertion sequence IS100"
FT                   /note="Similar to Escherichia coli transposase for
FT                   insertion sequence element IS21 IstA SW:ISTA_ECOLI (P15025)
FT                   (390 aa) fasta scores: E(): 3e-27, 33.1% id in 329 aa.
FT                   Identical to the previously sequenced Yersinia
FT                   pestis,Yersinia pseudotuberculosis, and Escherichia coli
FT                   pesticin plasmid insertion sequence transposase Y1055
FT                   TR:P74993 (EMBL:U59875) (340 aa) fasta scores: E(): 0,
FT                   100.0% id in 340 aa"
FT                   /db_xref="GOA:Q7ARN5"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR006120"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR017894"
FT                   /db_xref="UniProtKB/TrEMBL:Q7ARN5"
FT                   /inference="similar to sequence:INSDC:U59875"
FT                   /protein_id="CAL18933.1"
FT                   /translation="MVTFETVMEIKILHKQGMSSRAIARELGISRNTVKRYLQAKSEPP
FT                   KYTPRPAVASLLDEYRDYIRQRIADAHPYKIPATVIAREIRDQGYRGGMTILRAFIRSL
FT                   SVPQEQEPAVRFETEPGRQMQVDWGTMRNGRSPLHVFVAVLGYSRMLYIEFTDNMRYDT
FT                   LETCHRNAFRFFGGVPREVLYDNMKTVVLQRDAYQTGQHRFHPSLWQFGKEMGFSPRLC
FT                   RPFRAQTKGKVERMVQYTRNSFYIPLMTRLRPMGITVDVETANRHGLRWLHDVANQRKH
FT                   ETIQARPCDRWLEEQQSMLALPPEKKEYDVHLDENLVNFDKHPLHHPLSIYDSFCRGVA
FT                   "
FT   misc_feature    complement(246715..247248)
FT                   /note="Pfam match to entry PF00665 rve, Integrase core
FT                   domain, score 81.90, E-value 1.6e-22"
FT                   /inference="protein motif:PF00665"
FT   misc_feature    complement(247477..247542)
FT                   /note="Predicted helix-turn-helix motif with score 2147
FT                   (+6.50 SD) at aa 18-39, sequence MSSRAIARELGISRNTVKRYLQ"
FT   misc_feature    complement(247486..247569)
FT                   /note="Pfam match to entry PF00239
FT                   recombinase,Site-specific recombinases, score 25.70,
FT                   E-value 4.7e-06"
FT                   /inference="protein motif:PF00239"
FT   repeat_region   complement(247652..247679)
FT                   /rpt_type=INVERTED
FT                   /note="IS100 inverted repeat"
FT   CDS_pept        247679..248638
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="YPO0250"
FT                   /product="putative hydrolase (pseudogene)"
FT                   /note="Similar to Bacillus subtilis hypothetical protein
FT                   YtaP TR:O34973 (EMBL:AF008220) (299 aa) fasta scores: E():
FT                   1.8e-13, 30.0% id in 323 aa. This CDS has been disrupted by
FT                   the insertion of an IS100 element."
FT                   /inference="similar to sequence:INSDC:AF008220"
FT   misc_feature    247823..247888
FT                   /note="Pfam match to entry PF01738 DLH, Dienelactone
FT                   hydrolase family, score 3.40, E-value 7.3"
FT                   /inference="protein motif:PF01738"
FT   misc_feature    248165..248293
FT                   /note="Pfam match to entry PF01738 DLH, Dienelactone
FT                   hydrolase family, score 19.60, E-value 0.00021"
FT                   /inference="protein motif:PF01738"
FT   CDS_pept        complement(248712..250367)
FT                   /transl_table=11
FT                   /locus_tag="YPO0251"
FT                   /product="putative transmembrane transport protein"
FT                   /note="Similar to many proposed sodium symporter family
FT                   proteins including: Pseudomonas aeruginosa PA3234
FT                   TR:AAG06622 (EMBL:AE004746) (551 aa) fasta scores: E():
FT                   0,83.3% id in 552 aa and to Haemophilus influenzae PutP
FT                   SW:PUTP_HAEIN (P45174) (504 aa) fasta scores: E():
FT                   1.1e-21,24.2% id in 466 aa"
FT                   /db_xref="GOA:Q8ZJ73"
FT                   /db_xref="InterPro:IPR001734"
FT                   /db_xref="InterPro:IPR014083"
FT                   /db_xref="InterPro:IPR018212"
FT                   /db_xref="InterPro:IPR038377"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZJ73"
FT                   /inference="protein motif:TMHMM:2.0"
FT                   /inference="similar to sequence:INSDC:AE004746"
FT                   /protein_id="CAL18935.1"
FT                   /translation="MKIRHWSALSLFVLPALAQAEALTGEVHRQPLNIQAIVMFLLFVG
FT                   GTLYITYWASKRTRSRQDYYTAGGRITGFQNGLAIAGDYMSAASFLGISALVYASGYDG
FT                   LIYSIGFLIGWPIILFLIAERLRNLGRYTFADVASYRLQQRPIRTLSACGSLVVVALYL
FT                   IAQMVGAGKLIQLLFGLNYHVAVVLVGILMVLYVLFGGMLATTWVQIIKAVMLLSGATF
FT                   MAIMVMKSVNFNFNTLFSEAVKVHPKGLSIMSPGGLVSDPISALSLGLALMFGTAGLPH
FT                   ILMRFFTVSDAKEARKSVFYATGFIGYFYILTFIIGFGAILLVGPNQTFKDAAGALLGG
FT                   NNMAAVHLANAVGGSFFLGFISAVAFATILAVVAGLTLAGASAVSHDLYASVIKKGKAN
FT                   ERDELRVSKITVIILGIVAIGLGILFENQNIAFMVGLAFSIAASCNFPIIIISMYWDKL
FT                   TTRGAMIGGWLGLSTAVILMILGPTIWVTILGHEKPIYPYEYPALFSMIAAFVGTWFFS
FT                   ITDNSETGKQERLLFKSQFVRSQTGLGASKGGAH"
FT   misc_feature    complement(248811..248861)
FT                   /locus_tag="YPO0251"
FT                   /note="one of 14 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    complement(248907..248972)
FT                   /locus_tag="YPO0251"
FT                   /note="one of 14 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    complement(248958..250178)
FT                   /note="Pfam match to entry PF00474 SSF, Sodium:solute
FT                   symporter family, score 605.70, E-value 2.7e-178"
FT                   /inference="protein motif:PF00474"
FT   misc_feature    complement(249012..249077)
FT                   /locus_tag="YPO0251"
FT                   /note="one of 14 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    complement(249093..249149)
FT                   /locus_tag="YPO0251"
FT                   /note="one of 14 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    complement(249213..249278)
FT                   /locus_tag="YPO0251"
FT                   /note="one of 14 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    complement(249402..249467)
FT                   /locus_tag="YPO0251"
FT                   /note="one of 14 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    complement(249507..249572)
FT                   /locus_tag="YPO0251"
FT                   /note="one of 14 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    complement(249684..249749)
FT                   /locus_tag="YPO0251"
FT                   /note="one of 14 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    complement(249756..249833)
FT                   /note="PS00456 Sodium:solute symporter family signature 1."
FT                   /inference="protein motif:ProSite:PS00456"
FT   misc_feature    complement(249765..249830)
FT                   /locus_tag="YPO0251"
FT                   /note="one of 14 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    complement(249861..249926)
FT                   /locus_tag="YPO0251"
FT                   /note="one of 14 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    complement(249990..250055)
FT                   /locus_tag="YPO0251"
FT                   /note="one of 14 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    complement(250071..250136)
FT                   /locus_tag="YPO0251"
FT                   /note="one of 14 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    complement(250200..250265)
FT                   /locus_tag="YPO0251"
FT                   /note="one of 14 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    complement(250296..250346)
FT                   /locus_tag="YPO0251"
FT                   /note="one of 14 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        complement(250364..250675)
FT                   /transl_table=11
FT                   /locus_tag="YPO0252"
FT                   /product="putative membrane protein"
FT                   /note="Similar to Escherichia coli hypothetical 11.7 kDa
FT                   protein in soxR-acs intergenic region YjcH SW:YJCH_ECOLI
FT                   (P32706) (104 aa) fasta scores: E(): 1e-25, 64.7% id in 102
FT                   aa"
FT                   /db_xref="InterPro:IPR007436"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384KT45"
FT                   /inference="protein motif:TMHMM:2.0"
FT                   /protein_id="CAL18936.1"
FT                   /translation="MNDSIYQEIEDNPRFQELVKKRSRFAWLLSLITLTMYVAFIFLIA
FT                   FEPQWLGTPIYTGSSVTRGIPVGVGLIVTSFILTGIYVIRANGEFDRLTAEIIREVKQ"
FT   misc_feature    complement(250424..250489)
FT                   /locus_tag="YPO0252"
FT                   /note="one of 2 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    complement(250535..250600)
FT                   /locus_tag="YPO0252"
FT                   /note="one of 2 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        complement(250732..252690)
FT                   /transl_table=11
FT                   /gene="acs"
FT                   /locus_tag="YPO0253"
FT                   /product="acetyl-coenzyme A synthetase"
FT                   /EC_number="6.2.1.1"
FT                   /note="Similar to Escherichia coli acetyl-coenzyme A
FT                   synthetase Acs SW:ACSA_ECOLI (P27550) (652 aa) fasta
FT                   scores: E(): 0, 84.8% id in 652 aa"
FT                   /db_xref="GOA:Q8D1G8"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR011904"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR032387"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8D1G8"
FT                   /protein_id="CAL18937.1"
FT                   /translation="MSQIHKHPIPAAIAEHALITPEKYQHYYQQSVQNPDEFWGEQGKI
FT                   IDWIKPYKTVKNTSFDPGHVSIRWFEDGTLNLAANCLDRHLAERGDQTAIIWEGDDPNQ
FT                   SKTVTYKQLHHDVCQFANVLKSLGVKKGDVVAIYMPMVPEAAVAMLACARIGAVHSVIF
FT                   GGFSPDAVAGRIIDSHSKLVITADEGIRAGRAIPLKKNVDEALKNPAITSIKNVVVFQR
FT                   TGNASYWEDGRDVWWHDLIKEASADCPPEEMNAEDPLFILYTSGSTGKPKGVVHTTGGY
FT                   LVYAALTFKYVFDYHPGDIYWCTADVGWVTGHSYLLYGPLACGAITLMFEGVPNYPGVN
FT                   RLSQVVDKHKVNILYTAPTAIRALMAEGDKAIEGTKRDSLRIMGSVGEPINPEAWEWYY
FT                   NKIGNSKCPIVDTWWQTETGGFMITPLPGATELKAGSATRPFFGVQPALVDNLGNPQEG
FT                   VAEGNLVITDSWPGQARTLFGDHERFEQTYFSTFKGMYFSGDGARRDEDGYYWITGRVD
FT                   DVLNVSGHRLGTAEIESALVAHPKIAEAAVVGVPHNIKGQAIYAYITLNHGEEPTPELY
FT                   TEVRNWVRKEIGPLATPDILHWTDSLPKTRSGKIMRRILRKIATGDTSNLGDTSTLADP
FT                   SVVEKLLEEKQSMQTPS"
FT   misc_feature    complement(251050..252366)
FT                   /note="Pfam match to entry PF00501 AMP-binding, AMP-binding
FT                   enzyme, score 527.00, E-value 1.3e-154"
FT                   /inference="protein motif:PF00501"
FT   misc_feature    complement(251875..251910)
FT                   /note="PS00455 Putative AMP-binding domain signature."
FT                   /inference="protein motif:ProSite:PS00455"
FT   CDS_pept        253545..254861
FT                   /transl_table=11
FT                   /gene="gltP"
FT                   /locus_tag="YPO0254"
FT                   /product="proton glutamate symport protein"
FT                   /note="Similar to Escherichia coli proton glutamate symport
FT                   protein GltP SW:GLTP_ECOLI (P21345) (437 aa) fasta scores:
FT                   E(): 0, 81.0% id in 437 aa"
FT                   /db_xref="GOA:Q0WK54"
FT                   /db_xref="InterPro:IPR001991"
FT                   /db_xref="InterPro:IPR018107"
FT                   /db_xref="InterPro:IPR033380"
FT                   /db_xref="InterPro:IPR034703"
FT                   /db_xref="InterPro:IPR036458"
FT                   /db_xref="UniProtKB/TrEMBL:Q0WK54"
FT                   /inference="protein motif:TMHMM:2.0"
FT                   /protein_id="CAL18938.1"
FT                   /translation="MKSIKISLAWQILIALVLGILVGAVLHNQIESREWLVSNILSPAG
FT                   DIFIRLIKMIVVPIVISTLIVGIAGVGDAKKLGRIGLKTIIYFEVITTIAIIIGITLAN
FT                   VFQPGVGIDMSALTVVDISQYEKTTEQVQSGSHSLVSTILSLIPANVFASMAKGDMLPI
FT                   IFFSVLFGLGLSSLPKETKEPLLNVFKAVSESMFKVTHMIMRYAPIGVFGLISVTVANF
FT                   GFASLIPLAKLVILVYAAILFFALVILGTVARLCKLRIWILIRILKDELILAYSTASSE
FT                   TVLPRIIEKMEAYGAPKAITSFVVPTGYSFNLDGSTLYQSIAAIFIAQLYGIELSIGQE
FT                   IILVLTLMVTSKGIAGVPGVSFVVLLATLGSVGIPLEGLAFIAGVDRILDMARTALNVV
FT                   GNALAVLVIAKWENQFDDKKAKAYEKTLFAVEQTPANQS"
FT   misc_feature    253563..253631
FT                   /gene="gltP"
FT                   /locus_tag="YPO0254"
FT                   /note="one of 8 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    253566..254777
FT                   /note="Pfam match to entry PF00375 SDF,Sodium:dicarboxylate
FT                   symporter family, score 724.50,E-value 4.8e-214"
FT                   /inference="protein motif:PF00375"
FT   misc_feature    253671..253718
FT                   /note="PS00713 Sodium:dicarboxylate symporter family
FT                   signature 1."
FT                   /inference="protein motif:ProSite:PS00713"
FT   misc_feature    253689..253757
FT                   /gene="gltP"
FT                   /locus_tag="YPO0254"
FT                   /note="one of 8 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    253794..253862
FT                   /gene="gltP"
FT                   /locus_tag="YPO0254"
FT                   /note="one of 8 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    254022..254075
FT                   /gene="gltP"
FT                   /locus_tag="YPO0254"
FT                   /note="one of 8 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    254160..254228
FT                   /gene="gltP"
FT                   /locus_tag="YPO0254"
FT                   /note="one of 8 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    254241..254309
FT                   /gene="gltP"
FT                   /locus_tag="YPO0254"
FT                   /note="one of 8 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    254460..254531
FT                   /note="PS00714 Sodium:dicarboxylate symporter family
FT                   signature 2."
FT                   /inference="protein motif:ProSite:PS00714"
FT   misc_feature    254520..254588
FT                   /gene="gltP"
FT                   /locus_tag="YPO0254"
FT                   /note="one of 8 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    254631..254699
FT                   /gene="gltP"
FT                   /locus_tag="YPO0254"
FT                   /note="one of 8 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    complement(255039..273457)
FT                   /note="Region encoding a type III ssecretion system which
FT                   is shares a high degree of synteny and a significant level
FT                   of sequence identity with the type III secretion system
FT                   carried on the Salmonella typhi pathogenicity island 2."
FT   CDS_pept        complement(255039..255671)
FT                   /transl_table=11
FT                   /locus_tag="YPO0255"
FT                   /product="putative two-component response regulator"
FT                   /note="Similar to Salmonella typhimurium transcriptional
FT                   activator SsrB TR:O54305 (EMBL:Z95891) (193 aa) fasta
FT                   scores: E(): 0, 52.9% id in 189 aa, and to Pseudomonas
FT                   aeruginosa response regulator GacA or Pa2586 TR:AAG05974
FT                   (EMBL:U27988) (214 aa) fasta scores: E(): 2.3e-22, 34.3% id
FT                   in 207 aa"
FT                   /db_xref="GOA:A0A384LPF6"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384LPF6"
FT                   /inference="similar to sequence:INSDC:Z95891"
FT                   /inference="similar to sequence:INSDC:U27988"
FT                   /protein_id="CAL18939.1"
FT                   /translation="MNTKLLIVDDHELIIHGIKNMLAAYPRYLIVGQADNGLEVYNLCR
FT                   QTEPDMVILDLGLPGMDGLDVIIQLLRRWPALKILTLTARNEEHYASRTFNSGALGYVL
FT                   KKSPQQILMAAIQTVAIGKRYIDPALDASMVIKLTQGSDNTPPVLTPRERQILKLITEG
FT                   SCNRVIAAQLSISQKTVETHRLNMMKKLDVHKVAELIHWSYRLGLNV"
FT   misc_feature    complement(255045..255236)
FT                   /note="Pfam match to entry PF00196 GerE, Bacterial
FT                   regulatory proteins, luxR family, score 73.20, E-value
FT                   5.3e-18"
FT                   /inference="protein motif:PF00196"
FT   misc_feature    complement(255102..255185)
FT                   /note="PS00622 Bacterial regulatory proteins, luxR family
FT                   signature."
FT                   /inference="protein motif:ProSite:PS00622"
FT   misc_feature    complement(255324..255665)
FT                   /note="Pfam match to entry PF00072 response_reg, Response
FT                   regulator receiver domain, score 107.90, E-value 1.9e-28"
FT                   /inference="protein motif:PF00072"
FT   CDS_pept        complement(255684..258503)
FT                   /transl_table=11
FT                   /locus_tag="YPO0256"
FT                   /product="two-component sensor/regulator"
FT                   /note="Similar to Salmonella typhimurium pathogenicity
FT                   island regulator gene SpiR TR:P74862 (EMBL:U51927) (823 aa)
FT                   fasta scores: E(): 0, 46.5% id in 826 aa and to Vibrio
FT                   cholerae sensory box sensor histidine kinase/response
FT                   regulator VieS VC1653 TR:Q9KRI8 (EMBL:AE004243) (1146 aa)
FT                   fasta scores: E(): 0, 30.4% id in 559 aa. This CDS carries
FT                   both the sensor and response regulator domains"
FT                   /db_xref="GOA:Q0WK52"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR008207"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036641"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q0WK52"
FT                   /inference="protein motif:TMHMM:2.0"
FT                   /inference="similar to sequence:INSDC:U51927"
FT                   /inference="similar to sequence:INSDC:AE004243"
FT                   /protein_id="CAL18940.1"
FT                   /translation="MGKASSLVTRLTLLMGVTLTVIWLILIATTAFFSYENTRQILINE
FT                   LTHMASMRADLSNHQFEGAERDAASLISRRESLQSTSPLPEISIKHYDSYYIPFNLDSC
FT                   NINQHKNDLWIIQAYGTAGQTYYLDSFIIKQKEGIVLFPPQKSSSDYLNQRRKDLLLLP
FT                   KFPTHNNIYWGAPTYTPQGGWHVSVAVCDKVGTLAGFALKLNDLIAYNHPVEQRDINLL
FT                   LDKNGELLPISQQATSSNQLHEILNQLKNSKLHDGWQQTPDYLVLRTQLKGPGWQQLVI
FT                   YPRMGFAWEALKPALYQLPFALAILLLLTSVLSLLLRYYLAIPLWNFINIIGATGPQAM
FT                   EPRLPINRIDELGHIARAYNNLLDTLNEQYDTLEMKVKERTLALAEAKRAAEQANRRKS
FT                   DHLTTISHEIRTPLNGALGAVELLQNTPLDAGQMRLAETAHQCSLSLLAIINNLLDFSR
FT                   IESGQMTLSLEKTALLPLLDQAMLTIHSQALSKSLALSTFISANIPLELELDTLRLRQI
FT                   LVNLLGNAVKFTPQGRIQLRVRRQNQTLCFTVEDTGCGIDVQHQQTIFQPFMQTSDHEQ
FT                   GTGLGLAIADNLAKMMGGHLTVFSEPGQGSCFSLCLPFNAITPPMPFHGELFAPQRLHA
FT                   QLSAWGMTCQPELANQPSRHFVDNALCYLPGRLYAKLKQYLQGAETEALKSLPLQPWQM
FT                   HILLVDDSETNRDITGMMLQQLGHQVTRADSGTTALAIGRQHRFDLVLMDIRMPVLDGL
FT                   ATTARWRHDPANIDSHCMITALSANASPDEQIKTSQAGMNHYLSKPVTLGQLAEMLDLT
FT                   AQFQLERGVDLSPQLSEPQPLLDLADSALSLKLYQSLQVLIQQAKDAIENLPVLSHTLH
FT                   TIKGCAGQAGLIELQDAVIQLEHALDTHETLTQQEIIQLDEIIHVLLQPPTTCESTFII
FT                   SQGQSLMVK"
FT   misc_feature    complement(256077..256424)
FT                   /note="Pfam match to entry PF00072 response_reg, Response
FT                   regulator receiver domain, score 96.10, E-value 6.8e-25"
FT                   /inference="protein motif:PF00072"
FT   misc_feature    complement(256665..257285)
FT                   /note="Pfam match to entry PF00512 signal, Histidine
FT                   kinase, score 233.70, E-value 2.6e-66"
FT                   /inference="protein motif:PF00512"
FT   misc_feature    complement(257400..257609)
FT                   /note="Pfam match to entry PF00672 DUF5, HAMP domain, score
FT                   34.80, E-value 1.9e-06"
FT                   /inference="protein motif:PF00672"
FT   misc_feature    complement(257496..257546)
FT                   /locus_tag="YPO0256"
FT                   /note="one of 3 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    complement(257553..257618)
FT                   /locus_tag="YPO0256"
FT                   /note="one of 3 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    complement(258399..258464)
FT                   /locus_tag="YPO0256"
FT                   /note="one of 3 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        258675..260246
FT                   /transl_table=11
FT                   /locus_tag="YPO0257"
FT                   /product="possible type III secretion protein"
FT                   /note="Similar to Salmonella typhimurium Pathogenicity
FT                   island secretion protein SpiA TR:P74864 (EMBL:U51927) (497
FT                   aa) fasta scores: E(): 0, 51.5% id in 499 aa"
FT                   /db_xref="GOA:A0A384K9K8"
FT                   /db_xref="InterPro:IPR003522"
FT                   /db_xref="InterPro:IPR004845"
FT                   /db_xref="InterPro:IPR004846"
FT                   /db_xref="InterPro:IPR005644"
FT                   /db_xref="InterPro:IPR038591"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384K9K8"
FT                   /inference="similar to sequence:INSDC:U51927"
FT                   /protein_id="CAL18941.1"
FT                   /translation="MIVGLRQKPYLNLRNYKWMSLIYIMRKITGLILLFFATLLPYGKF
FT                   SYVKAIPWQGEPFFIYSRGMTVSELLKDLGMNYGIPVVISSEINEHFTGKIRDKTPEKI
FT                   LSELAGRYNITWYYDGETLYFYPVQSIKREFISPDGLAANTLVKYLQRGDVLAGKNCAI
FT                   KAIPHLDTLEVKGVPICIERVKSVSKMLSEQVRHQNQNKETVKVFPLKYASAADSDYQY
FT                   RDQNVRLPGLVSVLRELNQGNNLPLAGGNQPDGNQASSPVFSADPRQNAVIIRDRQANM
FT                   PIYRSLITQLDQRPIQIEISVTIIDVDAGDISQLGVDWSASASIGGTGVSFNSTFAKNN
FT                   AEGFSTVIGDTGNFMVRLNALQKNSRARILSQPSVVTLNNIQAVLDKNVTFYTKLQGEK
FT                   VAKLESVTSGSLLRVTPRMIETEGVQEVLLNLNIQDGQQQASTNSNEPLPEIRNSDIST
FT                   QATLQVGQSLLLGGFIQDTQIESQNKIPLLGDIPLLGGLFRSTDKQSHSVVRLFLIKAV
FT                   PVNAGE"
FT   misc_feature    258735..258803
FT                   /note="1 probable transmembrane helix predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    258864..260234
FT                   /note="Pfam match to entry PF00263
FT                   Bac_GSPproteins,Bacterial type II secretion system protein,
FT                   score 237.20,E-value 2.2e-67"
FT                   /inference="protein motif:PF00263"
FT   misc_feature    260067..260168
FT                   /note="PS00875 Bacterial type II secretion system protein D
FT                   signature."
FT                   /inference="protein motif:ProSite:PS00875"
FT   CDS_pept        260248..261462
FT                   /transl_table=11
FT                   /locus_tag="YPO0258"
FT                   /product="putative type-III secretion protein"
FT                   /note="Similar to several type III secretion proteins
FT                   including: Escherichia coli EscD TR:O52148 (EMBL:AF022236)
FT                   (406 aa) fasta scores: E(): 1.8e-26, 25.1% id in 414 aa and
FT                   Yersinia enterocolitica Yop proteins translocation protein
FT                   D YscD SW:YSCD_YEREN (Q01245) (418 aa) fasta scores: E():
FT                   0.00018, 23.5% id in 404 aa"
FT                   /db_xref="InterPro:IPR012843"
FT                   /db_xref="InterPro:IPR032034"
FT                   /db_xref="UniProtKB/TrEMBL:Q0WK50"
FT                   /inference="similar to sequence:INSDC:AF022236"
FT                   /protein_id="CAL18942.1"
FT                   /translation="MTTVFKLRLLNGDLNGLELILPEGEFTLGEQGCDVLLPLSDGNIV
FT                   TLCVNEYQVMIQVAEEVWINGAQHDLHTPLPLLQSIEIAGLVFVLGEQTDILSGIKVTH
FT                   RARFPLLVWLAIAICVPLSLLFVFLFWLTTQPETLRASIPADVPTQLAERLREPALQGI
FT                   KGTWLADGSVTLSGHCASSSMMEPLQHFLLRNHIAFRNQLVCDDRLIASVSDLLHQHGY
FT                   HDIEVRIGDEPGNIVIYGAVQMGDQWLTVQDTLAAVSGLKGWLVVNAHSGQIQQLVERL
FT                   RAAGLLGFLSMTESNKELAISGVLSSEQQQQLKETLAALSQQQPGFPSVRYQNIPASDR
FT                   TDQFLPAKVVSYGGNTQSAFVRLANGGRLQQGSVLANGYKVVFIGEQGLTLLKANNLVH
FT                   IPMDF"
FT   misc_feature    260575..260643
FT                   /note="1 probable transmembrane helix predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        261481..261702
FT                   /transl_table=11
FT                   /locus_tag="YPO0259"
FT                   /product="putative type III secretion apparatus"
FT                   /note="Similar to Salmonella typhimurium putative secretory
FT                   apparatus component SsaE TR:O84943 (EMBL:AF020808) (80 aa)
FT                   fasta scores: E(): 0.15, 31.0% id in 71 aa"
FT                   /db_xref="GOA:A0A384KG46"
FT                   /db_xref="InterPro:IPR012671"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384KG46"
FT                   /inference="similar to sequence:INSDC:AF020808"
FT                   /protein_id="CAL18943.1"
FT                   /translation="MQHITVLEEDIKHDPTAIKQRKEILARGRRLITCQLSLLQTPENY
FT                   QSLNNMMLALQRAEEIIEILTLRYGNKE"
FT   CDS_pept        261876..262496
FT                   /transl_table=11
FT                   /locus_tag="YPO0260"
FT                   /product="putative AraC-family regulatory protein"
FT                   /note="Similar to the C-terminal DNA-binding domain of
FT                   several AraC-family regulators e.g. Yersinia pestis
FT                   thermoregulatory transcription factor LcrF TR:AAC62554
FT                   (EMBL:AF053946) (271 aa) fasta scores: E(): 3e-11, 37.9% id
FT                   in 95 aa"
FT                   /db_xref="GOA:A0A384LNB7"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384LNB7"
FT                   /inference="similar to sequence:INSDC:AF053946"
FT                   /protein_id="CAL18944.1"
FT                   /translation="MIADEQASASAFANSAITSILCYPIDLFPIYQDLARRTLPLNKGH
FT                   LPHAVNDKYKVLPANVEIIQAAEELINIERVASLRFLYLYCLGIDNVYFSKLLDSIVGT
FT                   NNELLEFFEKNRLNPWSVSRYANELGISTRKLNFLFYEKFGMSAKQWLLDQRLKKGCEL
FT                   LLSTRLRVADIAMECGFSNHAHFSDSFRRRFQQCPSHMRSLIE"
FT   misc_feature    262230..262490
FT                   /note="Pfam match to entry PF00165 HTH_AraC, Bacterial
FT                   regulatory helix-turn-helix proteins, araC family, score
FT                   70.30, E-value 4.1e-17"
FT                   /inference="protein motif:PF00165"
FT   CDS_pept        262506..262721
FT                   /transl_table=11
FT                   /locus_tag="YPO0260a"
FT                   /product="putative type III secretion apparatus"
FT                   /note="Similar to Salmonella typhimurium putative secretory
FT                   apparatus component SsaG or SsaH TR:O30903 (EMBL:AF020808)
FT                   (71 aa) fasta scores: E(): 6.1e-06, 33.8% id in 71 aa"
FT                   /db_xref="GOA:A0A384L272"
FT                   /db_xref="InterPro:IPR011841"
FT                   /db_xref="InterPro:IPR021123"
FT                   /db_xref="InterPro:IPR037203"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384L272"
FT                   /inference="similar to sequence:INSDC:AF020808"
FT                   /protein_id="CAL18945.1"
FT                   /translation="MQISSPMGQLTNDIQQARQAYQNQMAAVNINDPEQMLTSQFTMNQ
FT                   YSAFLDFKSIEMKMINDIRNRILSRI"
FT   CDS_pept        262718..262966
FT                   /transl_table=11
FT                   /locus_tag="YPO0261"
FT                   /product="putative type III secretion apparatus"
FT                   /note="Similar to Salmonella typhimurium putative secretory
FT                   apparatus component SsaH or SsaI TR:O30904 (EMBL:AF020808)
FT                   (75 aa) fasta scores: E(): 2.8e-05, 37.7% id in 61 aa"
FT                   /db_xref="InterPro:IPR010437"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384KNV5"
FT                   /inference="similar to sequence:INSDC:AF020808"
FT                   /protein_id="CAL18946.1"
FT                   /translation="MSLLSADCRQLVVEAALAGVNHSLLAEAHDIVNALPLLIPDPQVR
FT                   LVCEAMLRFGLGDKVQARALLATSGEEDAQILLGLLQ"
FT   CDS_pept        263064..263315
FT                   /transl_table=11
FT                   /locus_tag="YPO0262"
FT                   /product="putative type III secretion apparatus"
FT                   /note="Weakly similar to Salmonella typhimurium putative
FT                   secretory apparatus component SsaI TR:Q9ZEF3
FT                   (EMBL:AJ224892) (82 aa) fasta scores: E(): 0.0041, 31.4% id
FT                   in 70 aa"
FT                   /db_xref="GOA:A0A384KVB9"
FT                   /db_xref="InterPro:IPR012670"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384KVB9"
FT                   /inference="similar to sequence:INSDC:AJ224892"
FT                   /protein_id="CAL18947.1"
FT                   /translation="MNMSSAQAVAGLFQATEPPVGNTQQVAKFTQLMAQPASTELMMTP
FT                   ESLLMQQAEWMHASLAIDLTAKVAGVMGQNINKLVNMQ"
FT   CDS_pept        263312..264043
FT                   /transl_table=11
FT                   /locus_tag="YPO0263"
FT                   /product="type III secretion system apparatus lipoprotein"
FT                   /note="Similar to Salmonella typhimurium type III secretion
FT                   system apparatus lipoprotein SsaJ SW:SSAJ_SALTY (P74852)
FT                   (249 aa) fasta scores: E(): 0, 45.5% id in 253 aa"
FT                   /db_xref="GOA:A0A384LCQ0"
FT                   /db_xref="InterPro:IPR003282"
FT                   /db_xref="InterPro:IPR006182"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384LCQ0"
FT                   /protein_id="CAL18948.1"
FT                   /translation="MKSLRQMLAIVLMTLSLSGCDMELYSGLSEGEANQMLALLMLHQI
FT                   NAEKQIEKSGMVGLTVDKRQFINAVELLRQNGFPRQRFITVDELFPANQLVTSPTQEQA
FT                   KMVFLKEQQLENMLSHMDGVIHADVTVAMPMSVDGKNPLPHTASVFIKYSPEVNLQSYQ
FT                   SQIKGLVRDAVPGIDYAKISVVMQPANYRFSASEAEQQQGPQTTVQWLLRHVGMVQNMV
FT                   GVAFISLIVLMFVGWFYYRRR"
FT   misc_feature    263312..263896
FT                   /note="Pfam match to entry PF01514 YscJ_FliF, Secretory
FT                   protein of YscJ/FliF family, score 240.10, E-value 3.1e-68"
FT                   /inference="protein motif:PF01514"
FT   misc_feature    263339..263371
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:ProSite:PS00013"
FT   misc_feature    263963..264031
FT                   /note="1 probable transmembrane helix predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        264218..264811
FT                   /transl_table=11
FT                   /locus_tag="YPO0264"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Escherichia coli L0051 TR:O85644
FT                   (EMBL:AF071034) (199 aa) fasta scores: E(): 0.011, 25.3% id
FT                   in 174 aa. L0051 is located within a pathogenicity island"
FT                   /db_xref="InterPro:IPR025292"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384L4X2"
FT                   /inference="similar to sequence:INSDC:AF071034"
FT                   /protein_id="CAL18949.1"
FT                   /translation="MAFSPSIDVQYLHQLAWRPAQFAHPLWLAAVGVNPENYGYGRSRA
FT                   LDSALNGMLIQRRKFPQQRLPAVLNPRQQRQIAQRQRLPALCLALGVVSLQCDDYLRLR
FT                   RYRQVLSPLLNDDDIQQIIGMGYRGQWQASLSPQQLPDVALRLGQSLACQVRSNNIIWQ
FT                   AVSILLPPNPRALCLSRSMQAQTEAWLSRLERLL"
FT   CDS_pept        264808..265455
FT                   /transl_table=11
FT                   /locus_tag="YPO0265"
FT                   /product="putative type III secretion system apparatus
FT                   protein"
FT                   /note="Similar to the C-terminus of the Salmonella
FT                   typhimurium type III secretion system apparatus protein
FT                   SsaK SW:SSAK_SALTY (P74853) (314 aa) fasta scores: E():
FT                   1.2e-10, 30.1% id in 176 aa. Also similar over the entire
FT                   range to Erwinia amylovora HrpE secretion protein TR:Q46622
FT                   (EMBL:U56662) (196 aa) fasta scores: E(): 0.73, 29.0% id in
FT                   186 aa"
FT                   /db_xref="InterPro:IPR009335"
FT                   /db_xref="InterPro:IPR012842"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384KQ29"
FT                   /inference="similar to sequence:INSDC:U56662"
FT                   /protein_id="CAL18950.1"
FT                   /translation="MNPFHLEIEKYGYPLPPGVVIPAAYLAEAMHSQDLLAQANAQAAE
FT                   ILQAAEQARVLLLDQAAEQADALISQAREQMETALLAQHVRWLVGAEQLESLLITQVRH
FT                   RILAAITTVVTTWSGEQPMSQILIQRLGDQAEKMAQQGELTLRVHPQHLPAVTTALGER
FT                   LRCVGDTEMAADQAQLSSPMLQLTLSLHHHLSQLVLWLQQSPDLFDEENVYE"
FT   CDS_pept        265448..267496
FT                   /transl_table=11
FT                   /locus_tag="YPO0266"
FT                   /product="secretion system apparatus protein"
FT                   /note="Similar to Salmonella typhimurium type III secretion
FT                   system apparatus protein SsaV SW:SSAV_SALTY (P74856) (681
FT                   aa) fasta scores: E(): 0, 58.1% id in 670 aa"
FT                   /db_xref="GOA:Q0WK41"
FT                   /db_xref="InterPro:IPR001712"
FT                   /db_xref="InterPro:IPR006302"
FT                   /db_xref="InterPro:IPR025505"
FT                   /db_xref="InterPro:IPR042193"
FT                   /db_xref="InterPro:IPR042194"
FT                   /db_xref="InterPro:IPR042196"
FT                   /db_xref="UniProtKB/TrEMBL:Q0WK41"
FT                   /inference="protein motif:TMHMM:2.0"
FT                   /protein_id="CAL18951.1"
FT                   /translation="MSKSALVRGLTMITARQDIFLAVMLLVAVFMMILPLPTTMVDLLI
FT                   AINLAFSVILLMISIYLRDPLEFSVFPSLLLITTLYRLALTISTTRLVLLQHDAGEIVE
FT                   AFGQFVVGGNLAVGMIIFTIITVVQFIVITKGSERVAEVSARFSLDGMPGKQMSIDGDM
FT                   RAGAIDSVEAKRLRERVQKESRLFGAMDGAMKFVKGDAIAGIIVILINIIGGITIGVMQ
FT                   HKMSAEEAMNTYAVLSIGDGLCAQIPSLLISITAGIIVTRVPGSNKQSLANELAVQVGR
FT                   QPDALWLAAAILTVFALLPGFPFLIFITLAAAVAAPAFLLYRKNRRISQDGRANGGSEE
FT                   GGATGQRMTPGAVPLMLHCASNLHHPHLGRDIDGLRWRWFEHLGVPLPEVEIRCDPTLA
FT                   ENTLSVQVYQERVLEVVLPPDSLLLTRPCSSLVTNNQVLGAKMGSFDWLDAKQAMQART
FT                   LGIPYVEGHQRIITCLTRVFERYTAEFIGVQETRYLMDAMEGRYGELVKELQRQIPVGK
FT                   VAEILQRLVEENISIRDLRTIFGALVVWAPKEKDIVMLTEYVRIALRRHLCRRFSHNKT
FT                   WISVLRLGDGVEHLIRDSIRQTSSGTYSALEERQSLLILNKIKNAFAENQDAVLLTTLD
FT                   VRRFVRKIIERDLFVLPVLSWQELGDEMNLKVAGTIELIGDELDETA"
FT   misc_feature    265502..265555
FT                   /locus_tag="YPO0266"
FT                   /note="one of 7 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    265526..267442
FT                   /note="Pfam match to entry PF00771 FHIPEP, FHIPEP
FT                   family,score 1053.30, E-value 0"
FT                   /inference="protein motif:PF00771"
FT   misc_feature    265565..265633
FT                   /locus_tag="YPO0266"
FT                   /note="one of 7 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    265652..265720
FT                   /locus_tag="YPO0266"
FT                   /note="one of 7 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    265778..265846
FT                   /locus_tag="YPO0266"
FT                   /note="one of 7 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    265862..265933
FT                   /note="PS00994 Bacterial export FHIPEP family signature."
FT                   /inference="protein motif:ProSite:PS00994"
FT   misc_feature    266048..266116
FT                   /locus_tag="YPO0266"
FT                   /note="one of 7 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    266174..266242
FT                   /locus_tag="YPO0266"
FT                   /note="one of 7 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    266303..266407
FT                   /locus_tag="YPO0266"
FT                   /note="one of 7 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        267483..268820
FT                   /transl_table=11
FT                   /locus_tag="YPO0267"
FT                   /product="putative type III secretion system ATP synthase"
FT                   /EC_number="3.6.3.14"
FT                   /note="Similar to many secretion system proteins including:
FT                   Salmonella typhimurium probable secretion system apparatus
FT                   ATP synthase SsaN SW:SSAN_SALTY (P74857) (433 aa) fasta
FT                   scores: E(): 0, 58.1% id in 432 aa, Pseudomonas aeruginosa
FT                   ATP synthase in type III secretion system PA1697
FT                   TR:AAG05086 (EMBL:AE004596) (440 aa) fasta scores: E():
FT                   0,55.8% id in 423 aa and to Bacillus subtilis
FT                   flagellum-specific ATP synthase FliI SW:FLII_BACSU (P23445)
FT                   (440 aa) fasta scores: E(): 0, 46.6% id in 423 aa. Note the
FT                   overlap with the upstream CDS."
FT                   /db_xref="GOA:Q0WK40"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005714"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040627"
FT                   /db_xref="UniProtKB/TrEMBL:Q0WK40"
FT                   /inference="similar to sequence:INSDC:AE004596"
FT                   /protein_id="CAL18952.1"
FT                   /translation="MKLPDIARLTPRLQQQLTRPSAPPEGLRYRGPIVEIGPTLLRASL
FT                   PNVAQGELCRIEPQGMLAEVVSIEQEMALLSPFASSDGLRCGQWVTPLGHMHRVQVGAD
FT                   LAGRILDGLGAPIDGGPPLTGQWRELDCPPPSPLTRQPVEQMLTTGIRAIDGILSCGEG
FT                   QRIGIFAAAGVGKSTLLSMLCADSAADVMVLALIGERGREVREFLEQVLTPEARARTVV
FT                   VVATSDRPALERLKGLSTATTVAEYFRERGLKVLLLADSLTRYARAAREIGLAAGEPPA
FT                   AGSFPPSVFANLPRLLERTGNSDRGSITAFYTVLVEGDDMNEPVADEVRSLLDGHIVLS
FT                   RRLAGAGHYPAIDIAASVSRIMPQIVSAGQLAMAQKLRRMLACYQEIELLVQIGEYQAG
FT                   EDLQADEALQRYPAICAFLQQDHSLTRDPDTAHLDTTLEHLAQVVG"
FT   misc_feature    267567..268562
FT                   /note="Pfam match to entry PF00006 ATP-synt_ab, ATP
FT                   synthase alpha/beta family, score 412.50, E-value 3.8e-120"
FT                   /inference="protein motif:PF00006"
FT   misc_feature    267990..268013
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:ProSite:PS00017"
FT   misc_feature    268530..268559
FT                   /note="PS00152 ATP synthase alpha and beta subunits
FT                   signature."
FT                   /inference="protein motif:ProSite:PS00152"
FT   CDS_pept        268817..269218
FT                   /transl_table=11
FT                   /locus_tag="YPO0268"
FT                   /product="type III secretion system apparatus protein"
FT                   /note="Similar to Erwinia amylovora HrpO TR:Q46643
FT                   (EMBL:L25828) (148 aa) fasta scores: E(): 0.0017, 34.1% id
FT                   in 129 aa"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384KMZ5"
FT                   /inference="similar to sequence:INSDC:L25828"
FT                   /protein_id="CAL18953.1"
FT                   /translation="MNHSQQRTLQRLLALRQRQERRLRQQLGQLRREQQQQEQQLENGR
FT                   RRHQQLCQQLQQLAQWCGMLTPREADEQKVLRQAVYQAERQAKKQLNAWVAQGRQQVSA
FT                   IERQQARLRRNQREQEKLRMLTEDESNRY"
FT   CDS_pept        269382..269597
FT                   /transl_table=11
FT                   /locus_tag="YPO0268a"
FT                   /product="hypothetical protein"
FT                   /note="Similar to the N-terminal region of Neisseria
FT                   meningitidis glycerol-3-phosphate dehydrogenase [NAD(P)+]
FT                   GpsA or Nma0375 TR:Q9JWH0 (EMBL:AL162753) (329 aa) fasta
FT                   scores: E(): 1.2, 32.759% id in 58 aa"
FT                   /db_xref="UniProtKB/TrEMBL:Q0WK38"
FT                   /inference="similar to sequence:INSDC:AL162753"
FT                   /protein_id="CAL18954.1"
FT                   /translation="METHYRIVSGPLCGTKVSVSMTAHGLRIVLSNTESKLIERLQRIQ
FT                   NRWQRQLHQLGFPCLLEVTCADESDA"
FT   CDS_pept        269617..270537
FT                   /transl_table=11
FT                   /locus_tag="YPO0269"
FT                   /product="type III secretion system apparatus protein"
FT                   /note="Similar to Salmonella typhimurium secretion system
FT                   apparatus protein SsaQ SW:SSAQ_SALTY (P74860) (322 aa)
FT                   fasta scores: E(): 1.1e-20, 26.3% id in 285 aa"
FT                   /db_xref="GOA:Q0WK37"
FT                   /db_xref="InterPro:IPR001172"
FT                   /db_xref="InterPro:IPR001543"
FT                   /db_xref="InterPro:IPR013385"
FT                   /db_xref="InterPro:IPR036429"
FT                   /db_xref="UniProtKB/TrEMBL:Q0WK37"
FT                   /protein_id="CAL18955.1"
FT                   /translation="MIGSGRQTAGVSVALTEIDGEGVYLPLHYGGQECGLWLSQSCWQH
FT                   WLNTTLATDNPQLLAAELVIAMANWAVTPLLALFTDLVVLAESPQKRSLPKQWAVTVAF
FT                   ELEGQPIIGVLQDWPQAALADTLSHWPCEAVTAPDLLWQSGLVAGWCHLSLRQLQQLRP
FT                   GEGLRLSMAAELDKEACWLWHHASPQIYIKLEGGNRMTIQQINEASDPLACGSRAESPP
FT                   LAAVQLEDLPQTLVMEIGRLTLPLGEIKQLAVGQTLACQTHCYGEVNICLNGQSVGRGS
FT                   LLRCDEKLVVRIAQWGLQNGENIME"
FT   misc_feature    270286..270516
FT                   /note="Pfam match to entry PF01052 SpoA, Surface
FT                   presentation of antigens (SPOA) protein, score
FT                   57.10,E-value 3.9e-13"
FT                   /inference="protein motif:PF01052"
FT   CDS_pept        270664..271314
FT                   /transl_table=11
FT                   /locus_tag="YPO0270"
FT                   /product="putative type III secretion apparatus protein"
FT                   /note="Similar to Salmonella typhimurium virulence protein
FT                   YscR SW:YSCR_SALTY (P74890) (215 aa) fasta scores: E():
FT                   0,59.9% id in 217 aa"
FT                   /db_xref="GOA:A0A384KY24"
FT                   /db_xref="InterPro:IPR005773"
FT                   /db_xref="InterPro:IPR005838"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384KY24"
FT                   /inference="protein motif:TMHMM:2.0"
FT                   /protein_id="CAL18956.1"
FT                   /translation="MELLNSSYQLIALLFMLSVLPLLVVMGTAFLKLSVVFSLLRNALG
FT                   VQQVPPNIAIYGLALVLTIFIMAPVGLDVQARLQNEELSNDIGALAHQIDQNALVPYRD
FT                   FLQRNTDIEQVTFFNDIVQNKWPERYRDSVKPDSLLILMPAFTLSQLNEAFKIGLLLFL
FT                   PFVAIDLIVSNILLAMGMMMVSPMTLSLPFKLLVFVLVDGWSLVLGQLVGSYL"
FT   misc_feature    270694..270762
FT                   /locus_tag="YPO0270"
FT                   /note="one of 4 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    270700..271299
FT                   /note="Pfam match to entry PF00813 FliP, FliP family, score
FT                   360.50, E-value 1.8e-104"
FT                   /inference="protein motif:PF00813"
FT   misc_feature    270820..270879
FT                   /locus_tag="YPO0270"
FT                   /note="one of 4 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    271093..271140
FT                   /note="PS01060 Flagella transport protein fliP family
FT                   signature 1."
FT                   /inference="protein motif:ProSite:PS01060"
FT   misc_feature    271138..271206
FT                   /locus_tag="YPO0270"
FT                   /note="one of 4 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    271237..271275
FT                   /note="PS01061 Flagella transport protein fliP family
FT                   signature 2."
FT                   /inference="protein motif:ProSite:PS01061"
FT   misc_feature    271249..271308
FT                   /locus_tag="YPO0270"
FT                   /note="one of 4 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        271311..271604
FT                   /transl_table=11
FT                   /locus_tag="YPO0271"
FT                   /product="putative type III secretion apparatus protein"
FT                   /note="Similar to Salmonella typhimurium secretion system
FT                   apparatus protein SsaS SW:SSAS_SALTY (P74891) (88 aa) fasta
FT                   scores: E(): 5.8e-16, 60.8% id in 79 aa"
FT                   /db_xref="GOA:A0A0H2W0M9"
FT                   /db_xref="InterPro:IPR002191"
FT                   /db_xref="InterPro:IPR006306"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2W0M9"
FT                   /inference="protein motif:TMHMM:2.0"
FT                   /protein_id="CAL18957.1"
FT                   /translation="MNNHMSSYHENAIIVHLATELLWLVLLLSLPVVVVASTVGLVISL
FT                   VQALTQIQDQTLQFLIKLLAVSATLLMTYHWMGATLLNYTQQSFLQITSMRP"
FT   misc_feature    271344..271571
FT                   /note="Pfam match to entry PF01313 Bac_export_3, Bacterial
FT                   export proteins, family 3, score 124.50, E-value 2e-33"
FT                   /inference="protein motif:PF01313"
FT   misc_feature    271371..271439
FT                   /locus_tag="YPO0271"
FT                   /note="one of 2 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    271497..271565
FT                   /locus_tag="YPO0271"
FT                   /note="one of 2 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        271606..272400
FT                   /transl_table=11
FT                   /locus_tag="YPO0272"
FT                   /product="putative type III secretion apparatus protein"
FT                   /note="Similar to Salmonella typhimurium secretion system
FT                   apparatus protein SsaT SW:SSAT_SALTY (P96068) (259 aa)
FT                   fasta scores: E(): 0, 51.3% id in 234 aa"
FT                   /db_xref="GOA:A0A384LHA5"
FT                   /db_xref="InterPro:IPR002010"
FT                   /db_xref="InterPro:IPR006304"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384LHA5"
FT                   /inference="protein motif:TMHMM:2.0"
FT                   /protein_id="CAL18958.1"
FT                   /translation="MTDVLPGLTALALAMMRPYGILLILPLFTARSLGSSLLRNGLIVA
FT                   IALPVTPLFLSAPIITNSSPVTWIGVLCTELLIGVVMGFVAALPFWAMNMAGFLIDTLR
FT                   GATMSTLFNPGMGVESSLFGVLFTQILTVLFLISGGFNQVLAALYGSYDSLPIGQGIQP
FT                   AADLLLFLQTEWQMMFELCLCFALPALLVMVLADLSLGLINRSARQLNVFFLAMPIKSA
FT                   LALFLLLISLPYGLHHYLSRMSDTEQKIGTLIPLIKGGNDVH"
FT   misc_feature    271609..272358
FT                   /note="Pfam match to entry PF01311 Bac_export_1, Bacterial
FT                   export proteins, family 1, score 242.10, E-value 7.8e-69"
FT                   /inference="protein motif:PF01311"
FT   misc_feature    271618..271686
FT                   /locus_tag="YPO0272"
FT                   /note="one of 6 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    271723..271791
FT                   /locus_tag="YPO0272"
FT                   /note="one of 6 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    271834..271902
FT                   /locus_tag="YPO0272"
FT                   /note="one of 6 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    271963..272031
FT                   /locus_tag="YPO0272"
FT                   /note="one of 6 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    272146..272214
FT                   /locus_tag="YPO0272"
FT                   /note="one of 6 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    272233..272301
FT                   /locus_tag="YPO0272"
FT                   /note="one of 6 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        272390..273457
FT                   /transl_table=11
FT                   /locus_tag="YPO0273"
FT                   /product="putative type III secretion apparatus protein"
FT                   /note="Similar to Salmonella typhimurium secretion system
FT                   apparatus protein SsaU SW:SSAU_SALTY (P96069) (352 aa)
FT                   fasta scores: E(): 0, 48.6% id in 354 aa"
FT                   /db_xref="GOA:A0A384KHJ8"
FT                   /db_xref="InterPro:IPR006135"
FT                   /db_xref="InterPro:IPR006307"
FT                   /db_xref="InterPro:IPR029025"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384KHJ8"
FT                   /inference="protein motif:TMHMM:2.0"
FT                   /protein_id="CAL18959.1"
FT                   /translation="MSTEKNEKPTPKRLKEAKEKGQVVKSVEITSGVQLVALVIYFLLT
FT                   GYSLVEQAKALIRSSIIQLQQPLTLALARIGAECMTVLMHIVVVLGGALIVVTIIAGIA
FT                   QVGPLLATKAVSFKGERINPIQNAKQLFSLRSVFELMKSLLKVGVLTLIFGYLLMQYAP
FT                   SFGYLTHCGSRCALPVFSTLMGWLLGSLIACYLVFSLMDYAFQRYTIMKQLKMSHDEVK
FT                   REYKDSNGDPHIKQKRRQLQHEVQSGSFATNVRRSTAVVRNPTHFAVCLIYHPEETPLP
FT                   IVIEKGHDEQAALIVSLAEQSGIPVVENIALARALHRDVACGDTIPEQFFEPVAALLRM
FT                   ALELDYQPSSDDPPR"
FT   misc_feature    272390..273415
FT                   /note="Pfam match to entry PF01312 Bac_export_2, FlhB HrpN
FT                   YscU SpaS Family, score 454.30, E-value 1e-132"
FT                   /inference="protein motif:PF01312"
FT   misc_feature    272471..272539
FT                   /locus_tag="YPO0273"
FT                   /note="one of 4 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    272633..272701
FT                   /locus_tag="YPO0273"
FT                   /note="one of 4 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    272828..272896
FT                   /locus_tag="YPO0273"
FT                   /note="one of 4 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    272915..272983
FT                   /locus_tag="YPO0273"
FT                   /note="one of 4 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        273840..275054
FT                   /transl_table=11
FT                   /locus_tag="YPO0274"
FT                   /product="putative integral membrane protein"
FT                   /note="Similar to Escherichia coli hypothetical 44.4 kDa
FT                   protein in amyA-fliE intergenic region YedE SW:YEDE_ECOLI
FT                   (P31064) (401 aa) fasta scores: E(): 0, 78.0% id in 400 aa"
FT                   /db_xref="InterPro:IPR007272"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384KZ70"
FT                   /inference="protein motif:TMHMM:2.0"
FT                   /protein_id="CAL18960.1"
FT                   /translation="MSWPEFKSQYLVRFWAPLPAVIAAGILATYYFGLTGTFWAVTGEF
FT                   TRWGGHIMQLFGAQPQEWGYFKVIGLEGTPLDRIDGMMIIGMFAGCIAAALWANNIKLR
FT                   KPQHTIRIAQALVGGIIAGFGARLAMGCNLAAFFTGIPQFSLHAWFFALATAAGSYFGA
FT                   KFTLLPLFRIPIKLQKVTAASPLTQHPARAARRFRLGMVVLVLALGWSLIELFRQPKLG
FT                   IAMLCGIGFGLLIERAQICFTSAFRDLWITGRTHMAKAIILGMAVSTLGIFSYVQLGVE
FT                   PKILWAGPNAVIGGLLFGFGIVLAGGCETGWMYRAVEGQIHYWWVGLGNIIGATLLAYY
FT                   WDDFAPALATNYDKVNLLETFGPMGGLLVTYLMLALAFAAMLWWEKRFFRKQKATTSAL
FT                   IKESL"
FT   misc_feature    273900..273968
FT                   /locus_tag="YPO0274"
FT                   /note="one of 10 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    274080..274148
FT                   /locus_tag="YPO0274"
FT                   /note="one of 10 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    274185..274253
FT                   /locus_tag="YPO0274"
FT                   /note="one of 10 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    274281..274349
FT                   /locus_tag="YPO0274"
FT                   /note="one of 10 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    274428..274487
FT                   /locus_tag="YPO0274"
FT                   /note="one of 10 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    274500..274559
FT                   /locus_tag="YPO0274"
FT                   /note="one of 10 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    274617..274676
FT                   /locus_tag="YPO0274"
FT                   /note="one of 10 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    274689..274757
FT                   /locus_tag="YPO0274"
FT                   /note="one of 10 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    274794..274862
FT                   /locus_tag="YPO0274"
FT                   /note="one of 10 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    274920..274988
FT                   /locus_tag="YPO0274"
FT                   /note="one of 10 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        275051..275320
FT                   /transl_table=11
FT                   /locus_tag="YPO0275"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Escherichia coli and Salmonella
FT                   typhimurium hypothetical protein YedF SW:YEDF_ECOLI
FT                   (P31065) (77 aa) fasta scores: E(): 1.5e-26, 94.6% id in 74
FT                   aa. Note alternative possible translational start site at
FT                   codon 17"
FT                   /db_xref="InterPro:IPR001455"
FT                   /db_xref="InterPro:IPR036868"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2W2E2"
FT                   /protein_id="CAL18961.1"
FT                   /translation="MSHSPSVETPQLAAPIVPDYRLDMVGEPCPYPAVATLEAMPQLKP
FT                   GEILEVISDCPQSINNIPLDARNYGYTVLDIQQDGPTIRYLIQR"
FT   misc_feature    275096..275317
FT                   /note="Pfam match to entry PF01206 UPF0033, Uncharacterized
FT                   protein family UPF0033, score 146.60, E-value 4.5e-40"
FT                   /inference="protein motif:PF01206"
FT   misc_feature    275114..275152
FT                   /note="PS01148 Uncharacterized protein family UPF0033
FT                   signature."
FT                   /inference="protein motif:ProSite:PS01148"
FT   CDS_pept        complement(275398..276384)
FT                   /transl_table=11
FT                   /locus_tag="YPO0276"
FT                   /product="putative LysR-family transcriptional regulator"
FT                   /note="Similar to several putative regulators e.g.
FT                   Pseudomonas aeruginosa probable transcriptional regulator
FT                   PA0056 TR:AAG03446 (EMBL:AE004445) (306 aa) fasta scores:
FT                   E(): 1.2e-30, 32.4% id in 293 aa"
FT                   /db_xref="GOA:A0A384LDZ2"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384LDZ2"
FT                   /inference="similar to sequence:INSDC:AE004445"
FT                   /protein_id="CAL18962.1"
FT                   /translation="MMSIDENTFAFSAKINNHAIYKHLENFIKIVECNSLSIAAHKLNI
FT                   TPSSTSRSLAQLEEKLGVVLLKRTTRSIVLTDAGDYLFHQARQLLLDLDETLVNTHSFY
FT                   NHPQGQLKITCSIAFGVCHLMHLFSQYKETNSDVCLSVDLNDQLVNLNEEHFDIALRIT
FT                   SIPPPNFAIRRICTINWVYCGSKEYLMKRGVPATIEDLEQHDCLVNPNVSDAWLYKSTE
FT                   GESVPLKIKNTVQANSSLGLLHAALHHQGIVCLPTYMLGDYITSGKLVPILLDYNAKDK
FT                   EYGLYALYYPSKYNDPKIRSFIDFMLDELSMDVPWDKWRADYQISLS"
FT   misc_feature    complement(275905..276324)
FT                   /note="Pfam match to entry PF00126 HTH_1, Bacterial
FT                   regulatory helix-turn-helix protein, lysR family, score
FT                   106.50, E-value 5.1e-28"
FT                   /inference="protein motif:PF00126"
FT   misc_feature    complement(276220..276285)
FT                   /note="Predicted helix-turn-helix motif with score 1299
FT                   (+3.61 SD) at aa 34-55, sequence NSLSIAAHKLNITPSSTSRSLA"
FT   CDS_pept        276551..277837
FT                   /transl_table=11
FT                   /locus_tag="YPO0277"
FT                   /product="putative transmembrane transport protein"
FT                   /note="Similar to many transport proteins e.g. Escherichia
FT                   coli serine transporter SdaC SW:SDAC_ECOLI (P36559) (429
FT                   aa) fasta scores: E(): 6.7e-26, 25.2% id in 437 aa"
FT                   /db_xref="GOA:A0A384LDS7"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384LDS7"
FT                   /inference="protein motif:TMHMM:2.0"
FT                   /protein_id="CAL18963.1"
FT                   /translation="MSEISSSKSELKKLYKSVPFTQYDVGWVILCIGMAIGSGIVFMPV
FT                   QVGIKGIWVFIAAVIISYPAIYLLQNLYLRTLSESDNCTDYTSVITQYLGKNWGVGLGI
FT                   AYFLMLLHGMFSYSLAVTFDSASYIKTFGLTEGLLSDSIWYGLIILTVLVAIAAQGEKI
FT                   LFKVSGPMVCVKFGIIVVLGVVMVPYWDFNNISAFPELFSFLRDVLLTLPFTLFSILFV
FT                   QILSPMNIAYRKVESDKRIATYRAIRANRVAYIILAVAVLFFAFSFTFSISHEQAVSAF
FT                   EQNISALAIAAQVIPGSIVRIMTALLNIFAILTAFLGIYLGFQEAIKGIVVNIISRFIP
FT                   EENINQKVLHIGVCVGVILTLWLWVSTRFSILFFLQLGGPLFGVVSCLIPCYLVYKVPV
FT                   LHKLKGPTIWFISFFGILLCLSPFFKFFE"
FT   misc_feature    276623..276691
FT                   /locus_tag="YPO0277"
FT                   /note="one of 12 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    276704..276772
FT                   /locus_tag="YPO0277"
FT                   /note="one of 12 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    276851..276919
FT                   /locus_tag="YPO0277"
FT                   /note="one of 12 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    276977..277045
FT                   /locus_tag="YPO0277"
FT                   /note="one of 12 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    277064..277120
FT                   /locus_tag="YPO0277"
FT                   /note="one of 12 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    277178..277246
FT                   /locus_tag="YPO0277"
FT                   /note="one of 12 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    277304..277372
FT                   /locus_tag="YPO0277"
FT                   /note="one of 12 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    277415..277483
FT                   /locus_tag="YPO0277"
FT                   /note="one of 12 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    277496..277564
FT                   /locus_tag="YPO0277"
FT                   /note="one of 12 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    277592..277648
FT                   /locus_tag="YPO0277"
FT                   /note="one of 12 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    277667..277735
FT                   /locus_tag="YPO0277"
FT                   /note="one of 12 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    277763..277831
FT                   /locus_tag="YPO0277"
FT                   /note="one of 12 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        277883..279064
FT                   /transl_table=11
FT                   /gene="metC"
FT                   /locus_tag="YPO0278"
FT                   /product="cystathionine beta-lyase"
FT                   /EC_number="4.4.1.8"
FT                   /note="Similar to Prokaryotic and Eukaryotic cystathionine
FT                   beta-lyases including Escherichia coli MetC SW:METC_ECOLI
FT                   (P06721) (395 aa) fasta scores: E(): 0, 42.6% id in 390 aa
FT                   and Saccharomyces cerevisiae YFR055W SW:METC_YEAST (P43623)
FT                   (340 aa) fasta scores: E(): 0, 64.1% id in 340 aa"
FT                   /db_xref="GOA:A0A0H2W1M0"
FT                   /db_xref="InterPro:IPR000277"
FT                   /db_xref="InterPro:IPR006233"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2W1M0"
FT                   /protein_id="CAL18964.1"
FT                   /translation="MNKKDISSFGISTQITQLGRNPQEQTGFVNTPIYRGSTVIFNTVD
FT                   DIVNNRAVFNYGTAGTPTIANLESAWTALAGAAGTVISPSGLGVIALALLTTLKAGDHL
FT                   LMPDSVYKPTRLLCAGLIARMGVETTYYDPLIGAEIETLMKPNTSTLFLESPGSQSFEI
FT                   QDIPMMTAITKRRGIATIIDNTWASPLFFAAHKHGCDLSLEAGTKYLGGHSDLLMGLVS
FT                   ANEQWWPKLRETYDSMAMLPGAEDCFLALRGLRTLHLRIKEAEKRGLEMAQWLKERPEV
FT                   LRVLHPAFPDCPGHEFWKRDFTGSSGLFSIVLKPEFTQKGLAEMLDNMSIFAMGFSWGG
FT                   YESLVIPFDCSEYRTVTKWNPGGLTIRLQIGLEDMEDLKEDLAQGFIRLASNS"
FT   misc_feature    277916..279043
FT                   /note="Pfam match to entry PF01053 Cys_Met_Meta_PP, Cys/Met
FT                   metabolism PLP-dependent enzyme, score 321.90, E-value
FT                   7.5e-93"
FT                   /inference="protein motif:PF01053"
FT   misc_feature    278480..278524
FT                   /note="PS00868 Cys/Met metabolism enzymes
FT                   pyridoxal-phosphate attachment site."
FT                   /inference="protein motif:ProSite:PS00868"
FT   CDS_pept        complement(279205..280005)
FT                   /transl_table=11
FT                   /gene="hmuV"
FT                   /locus_tag="YPO0279"
FT                   /product="hemin transport system ATP-binding protein"
FT                   /note="Previously sequenced Yersinia pestis hemin transport
FT                   system ATP-binding protein HmuV SW:HMUV_YERPE (Q56993) (266
FT                   aa) fasta scores: E(): 0, 99.6% id in 266 aa"
FT                   /db_xref="GOA:Q56993"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR015863"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="PDB:4G1U"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q56993"
FT                   /protein_id="CAL18965.1"
FT                   /translation="MVDMAVTPVALLEASHLHYHVQQQALINDVSLHIASGEMVAIIGP
FT                   NGAGKSTLLRLLTGYLSPSHGECHLLGQNLNSWQPKALARTRAVMRQYSELAFPFSVSE
FT                   VIQMGRAPYGGSQDRQALQQVMAQTDCLALAQRDYRVLSGGEQQRVQLARVLAQLWQPQ
FT                   PTPRWLFLDEPTSALDLYHQQHTLRLLRQLTRQEPLAVCCVLHDLNLAALYADRIMLLA
FT                   QGKLVACGTPEEVLNAETLTQWYQADLGVSRHPESALPQIYLRQ"
FT   misc_feature    complement(279334..279897)
FT                   /note="Pfam match to entry PF00005 ABC_tran, ABC
FT                   transporter, score 146.30, E-value 5.6e-40"
FT                   /inference="protein motif:PF00005"
FT   misc_feature    complement(279538..279582)
FT                   /note="PS00211 ABC transporters family signature."
FT                   /inference="protein motif:ProSite:PS00211"
FT   misc_feature    complement(279853..279876)
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:ProSite:PS00017"
FT   CDS_pept        complement(279998..281002)
FT                   /transl_table=11
FT                   /gene="hmuU"
FT                   /locus_tag="YPO0280"
FT                   /product="hemin transport system permease protein HmuU"
FT                   /note="Previously sequenced Yersinia pestis hemin transport
FT                   system permease protein HmuU SW:HMUU_YERPE (Q56992) (334
FT                   aa) fasta scores: E(): 0, 100.0% id in 334 aa"
FT                   /db_xref="GOA:Q56992"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="PDB:4G1U"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q56992"
FT                   /inference="protein motif:TMHMM:2.0"
FT                   /protein_id="CAL18966.1"
FT                   /translation="MNGRVQPRLMLGFLLILLVILALGSANMGALSLSFRTLWNTSTND
FT                   AMWHIWLNIRLPRVLLAVVVGCALAVSGTIMQGLFRNPLADPGLLGISSGAALCVGLII
FT                   VMPFSLPPLLALYSHMVGAFIGSLAISTIIFTLSRWGHGNLARLLLAGIAINALCGAAV
FT                   GVLTYISDDQQLRQFSLWSMGSLGQAQWSTLLVASSLILPTCILGLLQARQLNLLQLGD
FT                   EEAHYLGVNVRQAKLRLLLLSAILIGAAVAVSGVIGFIGLVVPHLIRMRIGADHRWLLP
FT                   GAALGGACLLLTADTLARTLVAPAEMPVGLLTSLLGGPYFLWLILRQREQRSG"
FT   misc_feature    complement(280022..280918)
FT                   /note="Pfam match to entry PF01032 FecCD_family, FecCD
FT                   transport family, score 491.60, E-value 6.3e-144"
FT                   /inference="protein motif:PF01032"
FT   misc_feature    complement(280025..280081)
FT                   /gene="hmuU"
FT                   /locus_tag="YPO0280"
FT                   /note="one of 8 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    complement(280220..280285)
FT                   /gene="hmuU"
FT                   /locus_tag="YPO0280"
FT                   /note="one of 8 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    complement(280367..280432)
FT                   /gene="hmuU"
FT                   /locus_tag="YPO0280"
FT                   /note="one of 8 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    complement(280493..280558)
FT                   /gene="hmuU"
FT                   /locus_tag="YPO0280"
FT                   /note="one of 8 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    complement(280580..280645)
FT                   /gene="hmuU"
FT                   /locus_tag="YPO0280"
FT                   /note="one of 8 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    complement(280676..280741)
FT                   /gene="hmuU"
FT                   /locus_tag="YPO0280"
FT                   /note="one of 8 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    complement(280763..280828)
FT                   /gene="hmuU"
FT                   /locus_tag="YPO0280"
FT                   /note="one of 8 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    complement(280910..280975)
FT                   /gene="hmuU"
FT                   /locus_tag="YPO0280"
FT                   /note="one of 8 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        complement(280999..281838)
FT                   /transl_table=11
FT                   /gene="hmuT"
FT                   /locus_tag="YPO0281"
FT                   /product="hemin-binding periplasmic protein"
FT                   /note="Previously sequenced Yersinia pestis hemin-binding
FT                   periplasmic protein HmuT precursor SW:HMUT_YERPE (Q56991)
FT                   (279 aa) fasta scores: E(): 0, 100.0% id in 279 aa"
FT                   /db_xref="GOA:Q56991"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="PDB:3MD9"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q56991"
FT                   /protein_id="CAL18967.1"
FT                   /translation="MRLRLLSLPFILSLCAPLLPLNTLAAERIVTIGGDVTEIAYALGA
FT                   GDEIVARDSTSQQPQAAQKLPDVGYMRTLNAEGILAMKPTMLLVSELAQPSLVLTQIAS
FT                   SGVNVVTVPGQTTPESVAMKINAVATALHQTEKGQKLIEDYQQRLAAVNKTPLPVKVLF
FT                   VMSHGGLTPMAAGQNTAADAMIRAAGGSNAMQGFSRYRPLSQEGVIASAPDLLLITTDG
FT                   VKALGSSENIWKLPGMALTPAGKHKRLLVVDDMALLGFGLETPQVLAQLREKMEQMQ"
FT   misc_feature    complement(281074..281769)
FT                   /note="Pfam match to entry PF01497 Peripla_BP_2,Periplasmic
FT                   binding protein, score 219.20, E-value 5.9e-62"
FT                   /inference="protein motif:PF01497"
FT   CDS_pept        complement(281835..282872)
FT                   /transl_table=11
FT                   /gene="hmuS"
FT                   /locus_tag="YPO0282"
FT                   /product="hemin transport protein"
FT                   /note="Previously sequenced Yersinia pestis hemin transport
FT                   protein HmuS SW:HMUS_YERPE (Q56990) (345 aa) fasta scores:
FT                   E(): 0, 100.0% id in 345 aa"
FT                   /db_xref="GOA:Q56990"
FT                   /db_xref="InterPro:IPR007845"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q56990"
FT                   /protein_id="CAL18968.1"
FT                   /translation="MNASLYQQYVQAKAEHPGKYARDLATLMGISEAELTHSRVGHDAK
FT                   RLQSDARALLAALESVGEVKAITRNTYAVHEQVGRYENQHLNGHAGLILNPRALDLRLF
FT                   LNQWASAFTLTEETRHGVRHSIQFFDHQGDALHKVYVTEQTDMSAWEALLAQFIIPENP
FT                   ALQLEPLSTPEAVEPTADDATVDSEWRAMTDVHQFFQLLKRNNLTRQQAFRAVGDDLAY
FT                   QVDNNSLTQLLHIAQQDQNEIMIFVGNRGCVQIFTGLIEKVTPHNEWINVFNQRFTLHL
FT                   IETAIAESWITRKPTKDGFVTSLELFAADGTQLAQLYGQRTEGQPEQNQWREQIARLIN
FT                   KDIAA"
FT   CDS_pept        complement(282991..285021)
FT                   /transl_table=11
FT                   /gene="hmuR"
FT                   /locus_tag="YPO0283"
FT                   /product="hemin receptor precursor"
FT                   /note="Previously sequenced Yersinia pestis hemin receptor
FT                   precursor HmuR SW:HMUR_YERPE (Q56989) (676 aa) fasta
FT                   scores: E(): 0, 100.0% id in 676 aa"
FT                   /db_xref="GOA:Q56989"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR010916"
FT                   /db_xref="InterPro:IPR010949"
FT                   /db_xref="InterPro:IPR011276"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039426"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q56989"
FT                   /protein_id="CAL18969.1"
FT                   /translation="MLRSTSDRFRWSSLSLAIACTLPLATQAADTTTTQTSSKKHSTDT
FT                   MVVTATGNERSSFEAPMMVTVIEGNAPTSQTAATAADMLRQVPGLTVTGSGRTNGQDVV
FT                   MRGYGKQGVLTLVDGVRQGTDTGHLNSTFLDPALVKRIEIVRGPAALLYGSGALGGVIA
FT                   YETVDAADMLQPGQNSGYRVYSSAATGDHSFGLGASAFGRTDDLDGILSFGTRDIGNIR
FT                   QSNGFNAPNDETISNVLAKGTWQIDSIQSLSANLRYYNNSAIEPKNPQTSAPSSTNVMT
FT                   NRSTIQRDAQLRYNIKPLDQEWLNATAQVYYSEVEINARPQGSAEEGREQTTEGVKLEN
FT                   RTRLFIESPASHLLTYGTETYKQEQTPGGATESFPQAKIRFSSGWLQDEITLRDLPVSI
FT                   LAGTRYDNYSGSSDGYADVDADKWSSRGAISITPTDWLMLFGSYAQAFRAPTMGEMYND
FT                   SKHFAIPIRPGLTLTNYWVPNPNLKPETNETQEYGFGLRFSDLLMAEDDLQFKVSYFDT
FT                   KAKDYISTRVDMQAMTTTSVNIDQAKIWGWDASMSYKTALFNWDLAYNRTRGKNQNTDE
FT                   WLDTINPDTVTSIVDVPVANSGFSVGWIGTFANRSSRVSSSTPQAGYGVNDFYVSYKGQ
FT                   EAFKGMTTTMLLGNVFEKEYYTPQGIPQDGRNVKFFVSYQW"
FT   misc_feature    complement(282994..283296)
FT                   /note="Pfam match to entry PF00593 TonB_boxC, TonB
FT                   dependent receptor C-terminal region, score 56.20, E-value
FT                   2.9e-14"
FT                   /inference="protein motif:PF00593"
FT   misc_feature    complement(284869..285021)
FT                   /note="PS00430 TonB-dependent receptor proteins signature
FT                   1."
FT                   /inference="protein motif:ProSite:PS00430"
FT   CDS_pept        complement(285436..286086)
FT                   /transl_table=11
FT                   /locus_tag="YPO0284"
FT                   /product="conserved hypothetical protein"
FT                   /note="Previously sequenced as Yersinia pestis hypothetical
FT                   23.2 kDa protein TR:Q56987 (EMBL:U60647) (216 aa) fasta
FT                   scores: E(): 0, 100.0% id in 216 aa. Also similar to
FT                   Shigella dysenteriae hypothetical 21.8 kDa protein ShuY
FT                   TR:O70016 (EMBL:U64516) (207 aa) fasta scores: E(): 0,55.9%
FT                   id in 211 aa"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q56987"
FT                   /inference="similar to sequence:INSDC:U60647"
FT                   /inference="similar to sequence:INSDC:U64516"
FT                   /protein_id="CAL18970.1"
FT                   /translation="MRPWLIFGAGRGVGAHLLALANQHADSASNPRPVTLLIRNQQQAE
FT                   ELRNKGLTVVCGDACDPASVREACQLAGEDAAIISTLGNNNANYQGNRLIIDTAEQLGL
FT                   KRMLLVTSIGCGDSWPTLSPAARAAFGQAVREKSLAESWLQTSNLIYTLIRPGGLLDQP
FT                   ATGNAIRLQTEAHGMVTRADVAHHISQMIEDPATYYQAYALIEPGLARKVKMN"
FT   CDS_pept        complement(286120..286665)
FT                   /transl_table=11
FT                   /locus_tag="YPO0285"
FT                   /product="conserved hypothetical protein"
FT                   /note="Previously sequenced as Yersinia pestis hypothetical
FT                   protein TR:Q56986 (EMBL:U60647) (162 aa) fasta scores: E():
FT                   0, 98.8% id in 162 aa. Also similar to Shigella dysenteriae
FT                   hypothetical protein ShuX TR:O70017 (EMBL:U64516) (164 aa)
FT                   fasta scores: E(): 0, 58.1% id in 160 aa. Note alternative
FT                   possible translational start site at codon 13"
FT                   /db_xref="InterPro:IPR010413"
FT                   /db_xref="UniProtKB/TrEMBL:Q7CKR1"
FT                   /inference="similar to sequence:INSDC:U60647"
FT                   /inference="similar to sequence:INSDC:U64516"
FT                   /protein_id="CAL18971.1"
FT                   /translation="MNTSSSINTSSSMNRSPLAEFLATQPDGTLEQIAQDYQVSVLDVV
FT                   RALPERVLVGAEHFDRIWDSMTEWGDVTTLVHTADVILEHKGPLPSGTHRHGYFNLRSK
FT                   QGLSGHIRAQNCQAIALLERPFMGMATASVQFFNQQGEVMFKVYVGRDEHRQLRADGLA
FT                   AFHQLAQQLLIEDPTLVK"
FT   CDS_pept        complement(286662..287975)
FT                   /transl_table=11
FT                   /locus_tag="YPO0286"
FT                   /product="putative coproporphyrinogen III oxidase"
FT                   /note="Similar to many coproporphyrinogen III oxidases
FT                   including: Vibrio cholerae oxygen-independent
FT                   coproporphyrinogen III oxidase VCA0909 TR:Q9KL39
FT                   (EMBL:AE004418) (455 aa) fasta scores: E(): 0, 37.9% id in
FT                   428 aa and to Escherichia coli oxygen-independent
FT                   coproporphyrinogen III oxidase HemN SW:HEMN_ECOLI (P32131)
FT                   (457 aa) fasta scores: E(): 4.7e-19, 26.9% id in 420 aa"
FT                   /db_xref="GOA:A0A384LAZ5"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR026332"
FT                   /db_xref="InterPro:IPR034505"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384LAZ5"
FT                   /inference="similar to sequence:INSDC:AE004418"
FT                   /protein_id="CAL18972.1"
FT                   /translation="MNIDLMPYYAQPGPLPFPKRWATMPWRDSRPLPAESLQDSWQSLL
FT                   QKALPRNKRLLYLHIPFCATHCTFCGFYQNPLQSGSTERYTDYLLRELSMEADSPLLQG
FT                   GPIHAIYFGGGTPSALSAQQLHSIISQLRKSLPLAPDCEITVEGRIFNFDDERIDACLE
FT                   AGANRFSIGVQTFNTRIRQRMGRKADRDQAIRFLTDLATRDRAAVVCDLMFGLPHQTPE
FT                   IWQEDLAIVRQLPLDGVDLYALNLLPTTPLAKSVENNRVELPTLAQQCDFYCSGADSLA
FT                   QAGWHQLSNSHWARTTRERNLYNLLIKQGADCLALGSGAGGSLQGHAYMQHRSLDNYYR
FT                   LIDSGQKPLMMMTQASGEHPWRAKLQSGIEVGRLDLSELIADPYPLMPLISQWYQSNLL
FT                   KDNSFCLRLTDSGRFWASNIMQALQNIIPSLITAESHS"
FT   misc_feature    complement(286944..287675)
FT                   /note="Pfam match to entry PF02473 Coprogen_an_ox, , score
FT                   -16.40, E-value 2.9e-13"
FT                   /inference="protein motif:PF02473"
FT   CDS_pept        complement(288316..289116)
FT                   /transl_table=11
FT                   /locus_tag="YPO0287"
FT                   /product="putative methylenetetrahydrofolate reductase"
FT                   /note="Similar to Haemophilus influenzae
FT                   5,10-methylenetetrahydrofolate reductase MetF SW:METF_HAEIN
FT                   (P45208) (292 aa) fasta scores: E(): 4.6e-14, 26.8% id in
FT                   269 aa"
FT                   /note="deleted EC_number 1.7.99.5"
FT                   /db_xref="GOA:A0A384K8U1"
FT                   /db_xref="InterPro:IPR003171"
FT                   /db_xref="InterPro:IPR029041"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384K8U1"
FT                   /protein_id="CAL18973.1"
FT                   /translation="MERKLSFEMNSAKNEKEMENIFKLIEFTDTLDPIYYTVNTEIGSS
FT                   VWSDTYRTVIELREKTDVPLIPHITINNKKEREIMQIIEKYINVGICEFFVIRGDKHVY
FT                   DQDNPINYGVELIELIRRSHKHIGIKTSLYPDFHKETTEVKEEIDWNERKYQLGVNEFI
FT                   SQLTLNTNALDFLSHWVDKERPFTPSIMPLGNFSFIEKFTSSNSIDYPLWIKKFANSKS
FT                   NSNEDKENIGIEIIRFLCREYLNQRERLHVFTLNKVDVMKKIFQ"
FT   misc_feature    complement(288319..289116)
FT                   /note="Pfam match to entry PF02219
FT                   MTHFR,Methylenetetrahydrofolate reductase, score -79.00,
FT                   E-value 8.1e-07"
FT                   /inference="protein motif:PF02219"
FT   CDS_pept        complement(289431..289919)
FT                   /transl_table=11
FT                   /locus_tag="YPO0288"
FT                   /product="putative exported protein"
FT                   /note="Similar to Escherichia coli O157:H7 hypothetical
FT                   protein TerW TR:AAG55309 (EMBL:AE005273) (155 aa) fasta
FT                   scores: E(): 2.5e-24, 52.3% id in 149 aa, and to Serratia
FT                   marcescens TerW TR:P75010 (EMBL:U49054) (155 aa) fasta
FT                   scores: E(): 5.5e-24, 52.3% id in 149 aa"
FT                   /db_xref="InterPro:IPR011233"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384LK79"
FT                   /inference="similar to sequence:INSDC:AE005273"
FT                   /inference="similar to sequence:INSDC:U49054"
FT                   /protein_id="CAL18974.1"
FT                   /translation="MLLSTKQFRHYTLALLLASGKPVDADDIYDKLSCSGPTLTRALKE
FT                   LRETYNAEIRYSKSTHSYQLTEKGTLTPKVLRHIKDAIASHMIIKSHEELVASHVILDK
FT                   EKKRSISLSLRMSVIRKIDRVVNQLEITRSEAVEILVNTYISELMLSVSQPPKGKKSV"
FT   CDS_pept        complement(290316..291275)
FT                   /transl_table=11
FT                   /locus_tag="YPO0289"
FT                   /product="putative ATP/GTP-binding protein"
FT                   /note="Similar to several proteins of undefined function
FT                   including: Deinococcus radiodurans hypothetical protein
FT                   DR2219 TR:Q9RSA7 (EMBL:AE002054) (310 aa) fasta scores:
FT                   E(): 0, 40.5% id in 309 aa and Streptomyces coelicolor
FT                   putative ATP/GTP-binding protein SCC8A.21c TR:Q9KY27
FT                   (EMBL:AL356892) (388 aa) fasta scores: E(): 5.7e-14, 32.6%
FT                   id in 344 aa"
FT                   /db_xref="GOA:A0A384LFL4"
FT                   /db_xref="InterPro:IPR011206"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR039480"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384LFL4"
FT                   /inference="similar to sequence:INSDC:AE002054"
FT                   /inference="similar to sequence:INSDC:AL356892"
FT                   /protein_id="CAL18975.1"
FT                   /translation="MKSTPSAYALGATLYMPATRTDIADIIIHNKISGLRSLVICLEDA
FT                   VSEDDVPLAISQLSTLLGTLAVEKKRDGSAHWPLIFVRPRHEAMGLALITRFNLSAING
FT                   FVLPKFTQASITTWWEIMKETHLCMMPTLETEDVFDVAKMSTLARELENHPSRQRIVAL
FT                   RIGGNDLMSVISMRRSRKLTLYDGPMGYVIKMLVSVFCPKNFALTAPVCEQIDNPQLLE
FT                   TELALDIAHGLVGKTAIHPSQIEVIQRALMVDTHDHADALRILNSTQAVFKSQGAMCEP
FT                   STHKRWAAAILERAQYYGIMPDFTAMAVRDAPRKHQSG"
FT   misc_feature    complement(290565..290588)
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:ProSite:PS00017"
FT   CDS_pept        complement(291275..292354)
FT                   /transl_table=11
FT                   /locus_tag="YPO0290"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Deinococcus radiodurans hypothetical
FT                   protein DR2218 TR:Q9RSA8 (EMBL:AE002054) (353 aa) fasta
FT                   scores: E(): 6.2e-23, 35.2% id in 338 aa"
FT                   /db_xref="InterPro:IPR011215"
FT                   /db_xref="InterPro:IPR028157"
FT                   /db_xref="UniProtKB/TrEMBL:Q0WK16"
FT                   /inference="similar to sequence:INSDC:AE002054"
FT                   /protein_id="CAL18976.1"
FT                   /translation="MHDITPFSGSYLPDDIQFLLKPIQIEMTPVEVKEKLIQSGARHYS
FT                   DMLSQEPAPTEHHLTLFARALDQGATRMAREVVMLAKALINRFGDTPIVLASLVRAGVP
FT                   LGVMLHHTLRALGKTSFHYGISIIRDRGIDEVALSYIEQKHGTEGLVFVDGWTGKGAIT
FT                   GELTRSLQGRPGYPELPRLVVLADPCGCSWLSATDDDWLIPFGIMGAPVSGLVSRSLWS
FT                   EKGLHGCVHCEHLQEFECSQLLVNTVADCRQQLDLSQIPAAEWDYQQNAALRIQSHQVV
FT                   KKMAEQFEINSVNRIKPGIAEATRAVLRRVPDHVLVRHIDDPDVSLLVYLAKQKKIAIK
FT                   EVGNELGQYRAITIIKKVI"
FT   CDS_pept        complement(292347..293159)
FT                   /transl_table=11
FT                   /locus_tag="YPO0291"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Deinococcus radiodurans hypothetical
FT                   protein DR2215 TR:Q9RSB0 (EMBL:AE002054) (260 aa) fasta
FT                   scores: E(): 3.3e-21, 36.1% id in 255 aa. Also similar to
FT                   the C-terminus of Serratia marcescens plasmid hypothetical
FT                   protein TR:P95795 (EMBL:U59239) (238 aa) fasta scores: E():
FT                   3.3e-29, 87.1% id in 93 aa"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR024197"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:Q0WK15"
FT                   /inference="similar to sequence:INSDC:AE002054"
FT                   /inference="similar to sequence:INSDC:U59239"
FT                   /protein_id="CAL18977.1"
FT                   /translation="MNKPVFLCDLDDTLFQTRRKMVDELDLPPFRVGALDRSLTPRSFM
FT                   TEEQSMLVDWLLEHAEFIPVTARGTEEISRVNIPFSSWAITTHGAVILTPDRQPDAGWQ
FT                   DTVLTNLQPYRDRLIAMESRINDMMAERGLNAWCRINYEYGDTPVYFVMKHRDSTQIAE
FT                   LYAFNDQLESLFSTDGFYIHRNSNNIAWLPVCIEKGLATTYLLDKLRHEHGAFPVLGFG
FT                   DSLSDFSFMRHCHWFGMPAKSQFSQALTSHLFDNTTFNKNNVNGDNDA"
FT   CDS_pept        complement(293152..294288)
FT                   /transl_table=11
FT                   /locus_tag="YPO0292"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Deinococcus radiodurans conserved
FT                   hypothetical protein DR2214 TR:Q9RSB1 (EMBL:AE002054) (371
FT                   aa) fasta scores: E(): 0, 40.7% id in 369 aa. The
FT                   N-terminus of this protein is similar to Serratia
FT                   marcescens plasmid hypothetical protein TR:P95796
FT                   (EMBL:U59239) (197 aa) fasta scores: E(): 0, 70.4% id in
FT                   189 aa, and to"
FT                   /db_xref="GOA:A0A384LCF2"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR011214"
FT                   /db_xref="InterPro:IPR022537"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR041688"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384LCF2"
FT                   /inference="similar to sequence:INSDC:AE002054"
FT                   /inference="similar to sequence:INSDC:U59239"
FT                   /protein_id="CAL18978.1"
FT                   /translation="MMTTQPPVYRRELSGGTLTVIPNSSNIPLDSLFDIAERRNPKRAF
FT                   LFVSKVLGRHIPVSPATMRNVYRQLAERFPADLPGPVLFIGMAETAVGLAAGVFQELRG
FT                   TVAEPVFLTSTRHPVDGDLLCEFKENHSHATDHLLYLPSDPVLRARLQRARSVVLIDDE
FT                   ATTGNTFINLLQALRDANLNGLEKVVAVTLTDWSGSALTERCPLPVTTVSLITGEWNWS
FT                   PIPDAPVPVMPACNVTARGKVAITDKQNWGRLGMDETRADIGHKVHVLAGEKVLVLGTS
FT                   EFVWQPFLLAERLEHAGANVKFSSITRSPIAQGHAINSIIAFSDNYGLGIPNFLYNVAH
FT                   QHFDRIIVCVETPAESIDPTLIEQLRTVAPCVEVIAYE"
FT   CDS_pept        complement(294300..295361)
FT                   /transl_table=11
FT                   /locus_tag="YPO0293"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Streptomyces coelicolor hypothetical 41.6
FT                   kDa protein SC5A7.21c TR:O88027 (EMBL:AL031107) (388 aa)
FT                   fasta scores: E(): 1.1e-14, 27.4% id in 328 aa. In addition
FT                   the C-terminus of the product of this CDS is similar to
FT                   Serratia marcescens plasmid hypothetical protein TR:P95797
FT                   (EMBL:U59239) (173 aa) fasta scores: E(): 0, 56.1% id in
FT                   171 aa"
FT                   /db_xref="GOA:A0A384KJI6"
FT                   /db_xref="InterPro:IPR011226"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384KJI6"
FT                   /inference="similar to sequence:INSDC:AL031107"
FT                   /inference="similar to sequence:INSDC:U59239"
FT                   /protein_id="CAL18979.1"
FT                   /translation="MKKNIWFMGGLSSQRDIISGVKNTSELHGNAIQVFASHHQHRYEI
FT                   LEKADVAFIEPSDLDTKMAFIRHIVKAFDIEAIHTGRSCLWFEQHRAAIEGLGVKLTTG
FT                   AQCPATFTLADNKVEYAAYMAQKGLPVVPSIQIASPDELREWLANPPFDTEKLCIKPVT
FT                   GIYGMGFWKLDQSISAMDCFDRTDNRVVHPDLYLAALERTEKMQPMVLMPYLPGPESSV
FT                   DMLVEKGKVIAAVARRKEGSVQHLHQSGAAFELAKSSAELMQADGLVNVQTRCDHHGQP
FT                   LLLEINLRPSGGIDYTRHSGVNLPGLFALRQLDLMSQDEVSSQAVAHFKPVSVRAMTDA
FT                   LPFPAELQNLTHF"
FT   CDS_pept        295637..296230
FT                   /transl_table=11
FT                   /gene="terZ"
FT                   /locus_tag="YPO0294"
FT                   /product="tellurium resistance protein"
FT                   /note="Similar to Serratia marcescens tellurium resistance
FT                   protein TerZ SW:TERZ_SERMA (Q52353) (193 aa) fasta scores:
FT                   E(): 0, 76.6% id in 197 aa and to Escherichia coli O157:H7
FT                   putative tellurium resistance protein TR:Q9LAN8
FT                   (EMBL:AF126104) (192 aa) fasta scores: E(): 9.9e-16, 40.2%
FT                   id in 189 aa"
FT                   /db_xref="InterPro:IPR003325"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384KYA1"
FT                   /inference="similar to sequence:INSDC:AF126104"
FT                   /protein_id="CAL18980.1"
FT                   /translation="MISLSKNQTISLAKESSALSRVQFGLGWDPVKKKKSFLGGLFGGG
FT                   SASDSIDLDASCVMLSQAGKPVDTVSFRHLTSKCRSVQHTGDNLTGEGDGDDEVINVDL
FT                   SRLPAEVEYLAFTVNSFRGQTFNEVENAFCRVVDQTGKELARYVLTEQGSHTGIVISSL
FT                   RRNNGQWDFTAHGRACRGRTIEDMMSEIIETVVR"
FT   misc_feature    295841..296212
FT                   /note="Pfam match to entry PF02342 TerD, , score
FT                   183.50,E-value 3.4e-51"
FT                   /inference="protein motif:PF02342"
FT   CDS_pept        296362..297414
FT                   /transl_table=11
FT                   /gene="terA"
FT                   /locus_tag="YPO0295"
FT                   /product="putative tellurite resistance protein"
FT                   /note="Similar to Serratia marcescens tellurite resistance
FT                   protein TerA TR:Q52354 (EMBL:U59239) (341 aa) fasta scores:
FT                   E(): 0, 70.0% id in 350 aa"
FT                   /db_xref="InterPro:IPR003325"
FT                   /db_xref="InterPro:IPR017115"
FT                   /db_xref="UniProtKB/TrEMBL:Q0WK11"
FT                   /inference="similar to sequence:INSDC:U59239"
FT                   /protein_id="CAL18981.1"
FT                   /translation="MVFYGQPVTDDSTIRLSGQGVNTAFSVNLQAINHDVQKIAFTATC
FT                   DGNQTLSQLGNLSIQVELNGSVLMKGDVETQGRQEAALILGELYRRNTEWKFRFVAQGF
FT                   NGGLKPLAEHFGVVVEDEPAAPTPVPTPVSTPAPTAPPVAKPINLSKVSLTKEKPVISL
FT                   TKRDDFGEIRVNLNWHRGGGAPAKGFLQGIFNSNKGIDLDLGAFVALNDGSRGVIQALG
FT                   NNFGSYHSEPYVQLQGDDRTGDVSDGEWMHINGREWKHVKEVLIFAFIYEGVPSWGSTD
FT                   GIVTINVPGQAPIETQMNEGNDRKNMCAVARLVNESGNIKVERINRYFSGHKEMDEAFG
FT                   WGFRWKAGSK"
FT   misc_feature    296362..296709
FT                   /note="Pfam match to entry PF02342 TerD, , score
FT                   118.20,E-value 1.6e-31"
FT                   /inference="protein motif:PF02342"
FT   misc_feature    297022..297381
FT                   /note="Pfam match to entry PF02342 TerD, , score
FT                   80.60,E-value 3.1e-20"
FT                   /inference="protein motif:PF02342"
FT   CDS_pept        297447..297902
FT                   /transl_table=11
FT                   /gene="terB"
FT                   /locus_tag="YPO0296"
FT                   /product="tellurite resistance protein"
FT                   /note="Similar to Serratia marcescens tellurite resistance
FT                   protein TerB TR:Q52355 (EMBL:U59239) (151 aa) fasta scores:
FT                   E(): 0, 71.5% id in 151 aa"
FT                   /db_xref="InterPro:IPR007791"
FT                   /db_xref="InterPro:IPR029024"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384KXS9"
FT                   /inference="similar to sequence:INSDC:U59239"
FT                   /protein_id="CAL18982.1"
FT                   /translation="MSFFNKVKNAISAGRTELTNQVGRFKNRKFMEGTVAVCAHISMAS
FT                   NGAGPEEKQKMIMFIKQSPELSVFDTNEVIEFFNKLVTSYEFDADIGKGEAMKYIMALK
FT                   SQPEAAQLALRVGIAVAKSDGVFDEMEEAAAREICVTLGFVPADFQL"
FT   CDS_pept        297924..298961
FT                   /transl_table=11
FT                   /gene="terC"
FT                   /locus_tag="YPO0297"
FT                   /product="tellurium resistance protein"
FT                   /note="Similar to Serratia marcescens tellurium resistance
FT                   protein TerC SW:TERC_SERMA (Q52356) (346 aa) fasta scores:
FT                   E(): 0, 83.3% id in 342 aa, and to Escherichia coli O157:H7
FT                   putative tellurium resistance protein D TR:Q9LAN7
FT                   (EMBL:AF126104) (89 aa) fasta scores: E(): 5.4e-21, 82.3%
FT                   id in 79 aa"
FT                   /db_xref="GOA:A0A0H2W1I9"
FT                   /db_xref="InterPro:IPR005496"
FT                   /db_xref="InterPro:IPR022369"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2W1I9"
FT                   /inference="protein motif:TMHMM:2.0"
FT                   /inference="similar to sequence:INSDC:AF126104"
FT                   /protein_id="CAL18983.1"
FT                   /translation="MESTHIGFPIETVAVFILLSVGAICIDLFMHRHDKPISLKSAALW
FT                   SLFWVAIAFVFAGFLYLHHGAEAASLFVTGYALEKVLSIDNLFVMMAIFSWFAVPDRLR
FT                   YRVLYWGIIGAIVFRGIFVAIGTGLLMLGPWVEVVFAIVVAWTAVMMLRKGDDDDAIED
FT                   YSQHIAYRLVKRFFPIWPKLRGNAFILSQKEVDAELAKPENADVQVGRKGGVARYATPL
FT                   MLCLAVVELSDVMFAFDSVPAVIAVSREPLIVYSAMMFAILGLRTLYFVLEALKQYLVH
FT                   LEKAVIVLLFFIAAKLGLNASDHFFNHGYDISANVSLFVVIGVLAIGIVASFLFPEKDS
FT                   KEGQH"
FT   misc_feature    297951..298019
FT                   /gene="terC"
FT                   /locus_tag="YPO0297"
FT                   /note="one of 9 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    298053..298121
FT                   /gene="terC"
FT                   /locus_tag="YPO0297"
FT                   /note="one of 9 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    298164..298223
FT                   /gene="terC"
FT                   /locus_tag="YPO0297"
FT                   /note="one of 9 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    298242..298310
FT                   /gene="terC"
FT                   /locus_tag="YPO0297"
FT                   /note="one of 9 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    298320..298379
FT                   /gene="terC"
FT                   /locus_tag="YPO0297"
FT                   /note="one of 9 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    298566..298634
FT                   /gene="terC"
FT                   /locus_tag="YPO0297"
FT                   /note="one of 9 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    298677..298739
FT                   /gene="terC"
FT                   /locus_tag="YPO0297"
FT                   /note="one of 9 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    298758..298826
FT                   /gene="terC"
FT                   /locus_tag="YPO0297"
FT                   /note="one of 9 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    298869..298928
FT                   /gene="terC"
FT                   /locus_tag="YPO0297"
FT                   /note="one of 9 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        299025..299603
FT                   /transl_table=11
FT                   /gene="terD"
FT                   /locus_tag="YPO0298"
FT                   /product="tellurium resistance protein"
FT                   /note="Similar to Serratia marcescens tellurium resistance
FT                   protein TerD SW:TERD_SERMA (Q52357) (192 aa) fasta scores:
FT                   E(): 0, 86.5% id in 192 aa and Escherichia coli O157:H7
FT                   putative tellurium resistance protein TR:Q9LAN8
FT                   (EMBL:AF126104) (192 aa) fasta scores: E(): 0, 85.9% id in
FT                   192 aa"
FT                   /db_xref="InterPro:IPR003325"
FT                   /db_xref="UniProtKB/TrEMBL:Q0WK08"
FT                   /inference="similar to sequence:INSDC:AF126104"
FT                   /protein_id="CAL18984.1"
FT                   /translation="MGVSLSKGGNVSLSKEAPTMTNVLIGLGWDARSTDGQDFDLDASA
FT                   FLLTANGKVRNDADFIFYNNLKSSDGSVMHTGDNRTGEGEGDDESLKIKLPLIPADVDK
FT                   IVFVVTIHDAQARRQSFGQVANAFIRLVNDDNGVEIARYDLSEDASTETAMLFGELYRH
FT                   NAEWKFRAVGQGYAGGLSSVCAQYGINAS"
FT   misc_feature    299202..299588
FT                   /note="Pfam match to entry PF02342 TerD, , score
FT                   249.30,E-value 5.4e-71"
FT                   /inference="protein motif:PF02342"
FT   CDS_pept        299787..300362
FT                   /transl_table=11
FT                   /gene="terE"
FT                   /locus_tag="YPO0299"
FT                   /product="tellurium resistance protein"
FT                   /note="Similar to Serratia marcescens tellurium resistance
FT                   protein TerE SW:TERE_SERMA (Q52358) (191 aa) fasta scores:
FT                   E(): 0, 84.3% id in 191 aa and to Escherichia coli O157:H7
FT                   putative tellurium resistance protein C, TlrC TR:Q9LAN8
FT                   (EMBL:AF126104) (192 aa) fasta scores: E(): 0, 64.7% id in
FT                   190 aa"
FT                   /db_xref="InterPro:IPR003325"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384KH20"
FT                   /inference="similar to sequence:INSDC:AF126104"
FT                   /protein_id="CAL18985.1"
FT                   /translation="MAVSLVKGGNVSLTKEAPTMNIAVVGLGWDARVTDGSEFDLDASV
FT                   FMVGENGKVLSDQHFIFFNNKVSPCGSVVHQGDNRTGAGDGDDEQIKIDLKKVPADVKK
FT                   IIFSVTIYDAEARKQNFGMVSNSFMRVVNEDNSAEIARFDLSEDASTETAMIFGELYRN
FT                   NDEWKFKAVGQGFAGGLSALASQHGVSV"
FT   misc_feature    299964..300350
FT                   /note="Pfam match to entry PF02342 TerD, , score
FT                   254.90,E-value 1.1e-72"
FT                   /inference="protein motif:PF02342"
FT   repeat_region   300409..301120
FT                   /note="Contains a 'G' at nucleotide position 315"
FT                   /note="IS200-like insertion sequence:IS1541"
FT   CDS_pept        300554..301012
FT                   /transl_table=11
FT                   /gene="tnp"
FT                   /locus_tag="YPO0300"
FT                   /product="transposase for the IS1541 insertion element"
FT                   /note="Similar to Salmonella typhimurium, and Salmonella
FT                   typhi transposase for insertion sequence IS200 TnpA
FT                   SW:T200_SALTY (Q57334) (152 aa) fasta scores: E(): 0, 94.1%
FT                   id in 152 aa. Identical to the Yersinia pseudotuberculosis
FT                   IS1541 element transposase Tnp TR:Q9X9F5 (EMBL:AJ238014)
FT                   (152 aa) fasta scores: E(): 0, 100.0% id in 152 aa"
FT                   /db_xref="GOA:Q74YM6"
FT                   /db_xref="InterPro:IPR002686"
FT                   /db_xref="InterPro:IPR036515"
FT                   /db_xref="UniProtKB/TrEMBL:Q74YM6"
FT                   /inference="similar to sequence:INSDC:AJ238014"
FT                   /protein_id="CAL18986.1"
FT                   /translation="MRDEKSLAHTRWNCKYHIVFAPKYRRQVFYREKRRAIGSILRKLC
FT                   EWKNVNILEAECCVDHIHMLLEIPPKMSVSGFMGYLKGKSSLMLYEQFGDLKFKYRNRE
FT                   FWCRGYYVDTVGKNTARIQEYIKHQLEEDKMGEQLSIPYPGSPFTGRK"
FT   misc_feature    300608..300919
FT                   /note="Pfam match to entry PF01797
FT                   Transposase_17,Transposase IS200 like, score 236.10,
FT                   E-value 5.1e-67"
FT                   /inference="protein motif:PF01797"
FT   CDS_pept        301786..302424
FT                   /transl_table=11
FT                   /locus_tag="YPO0301"
FT                   /product="putative exported protein"
FT                   /note="Weakly similar to Escherichia coli protein GltF
FT                   SW:GLTF_ECOLI (P28721) (254 aa) fasta scores: E():
FT                   0.0025,25.5% id in 251 aa"
FT                   /db_xref="InterPro:IPR010546"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384KY25"
FT                   /protein_id="CAL18987.1"
FT                   /translation="MKKPLTQIAILSSLVVSISAASAAVPTAELKVVGTMTVPSCTVVS
FT                   PDAGIYDIGKLSSSLVKPGTTVTVLAQINKTWTVNCDANTYLNFTPVDNRVGSSSDGSA
FT                   AAFGLGKINDTGKIGYYTVQMRNATVDGKKSGVFTASSASFSQADTSYLNRGQRTGWAA
FT                   GANTQNSGKVFVADLLVTPVLAGTNTMNGAITEDAKIDGSLTMNFAFGI"
FT   CDS_pept        302675..305053
FT                   /transl_table=11
FT                   /locus_tag="YPO0302"
FT                   /product="putative outer membrane fimbrial usher protein"
FT                   /note="Similar to several membrane usher proteins
FT                   including: Salmonella enteritidis SefC SW:SEFC_SALEN
FT                   (P33388) (814 aa) fasta scores: E(): 7.7e-22, 25.1% id in
FT                   804 aa and to Escherichia coli YhcD SW:YHCD_ECOLI (P45420)
FT                   (793 aa) fasta scores: E(): 0, 27.4% id in 795 aa."
FT                   /db_xref="GOA:A0A384LJ06"
FT                   /db_xref="InterPro:IPR000015"
FT                   /db_xref="InterPro:IPR018030"
FT                   /db_xref="InterPro:IPR025885"
FT                   /db_xref="InterPro:IPR025949"
FT                   /db_xref="InterPro:IPR037224"
FT                   /db_xref="InterPro:IPR042186"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384LJ06"
FT                   /protein_id="CAL18988.1"
FT                   /translation="MVARCINLQCIAFLFSFFPTLAFPVTEEGEVVFDIETLERLGYSA
FT                   ELAKFFSGQDRFLPGQHDVTIIINASKTYRIAATFDSEGKLCMDKALLMALKLRNTESD
FT                   GSCENMEARWPGMVVKLFPGQFRVEITLPQEAFDPEMEGSEYQQGGHALLLNYNIFGQR
FT                   VESNNSRFNLVQGQFEPGINFKNWVLRNRGSYSYNQGVSQYYNQETSALRAVESLKSVV
FT                   QLGEFGLVGNTFSGLPVTGIQLYSDNAQRDDTQLIVPIEGIANTNATIEIRQRGRVIYR
FT                   TIVAPGPFSLSNISNFSSGVNTDVSIIEEDGTQQNFTVTSALDINAEQQASIYQLAVGR
FT                   YRDMFTGEDRPSPLLLSGEMSFNPAATFYMTSAGLLSSGYQNIRVQNLYSGWDQAWFSA
FT                   AASYANTKDAGQGYQFSVQNQMTINGNFGVSWSSVYGSANYWLPDDALSSSNNLNDLMF
FT                   GKLKNATSVAVSWVHPRWGAFSYALSNNMYYQASGRTYHIFSISEQFGRATTILSSQLS
FT                   SQGQNSLYVGINMPLGNGTLSGRVQRNNGNVALGSTYQGRWGDNKDYSVGISGDNRQRR
FT                   INGSMNIRTAYSQLTGGVSQATNNSRSAYLSSRGSVAYVNNTFATSSSSVGDTFAVVNI
FT                   PNQPGLRVSSPSSGIAITDYAGIALLPLVRPYTASKVQISTQTLPLNIRLNNTSADLLM
FT                   TRGSVATHHFETTETRQLLLTIRGSDGEMLPIGANVLDEKGNFLGTIIGDGNFMLENKA
FT                   IGVTLRVKANNRDECRVNYREPEKFDPDVLYEVADAVCQ"
FT   misc_feature    302765..303631
FT                   /note="Pfam match to entry PF00577 Usher, Fimbrial Usher
FT                   proteins, score 170.90, E-value 2.1e-47"
FT                   /inference="protein motif:PF00577"
FT   misc_feature    303524..303556
FT                   /note="PS01151 Fimbrial biogenesis outer membrane usher
FT                   protein signature."
FT                   /inference="protein motif:ProSite:PS01151"
FT   misc_feature    304100..304999
FT                   /note="Pfam match to entry PF00577 Usher, Fimbrial Usher
FT                   proteins, score 63.20, E-value 5.1e-17"
FT                   /inference="protein motif:PF00577"
FT   CDS_pept        305125..305868
FT                   /transl_table=11
FT                   /locus_tag="YPO0303"
FT                   /product="putative fimbrial chaperone"
FT                   /note="Similar to Escherichia coli hypothetical 25.3 kDa
FT                   fimbrial chaperone YhcA SW:YHCA_ECOLI (P28722) (224 aa)
FT                   fasta scores: E(): 1.1e-17, 32.6% id in 190 aa"
FT                   /db_xref="GOA:A0A384LC61"
FT                   /db_xref="InterPro:IPR008962"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR016147"
FT                   /db_xref="InterPro:IPR036316"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384LC61"
FT                   /protein_id="CAL18989.1"
FT                   /translation="MQNFPTHHRDIGATIIYVNSVNRFNIFFVFTLLILLSSWSAVSYA
FT                   SFKLESTTVILQESEARTSFTIDNISSNPILLVTKLTDLDGKSFSKQILISPPVTRINA
FT                   GQSQQVNFVLKKGSVLNNEVLLKASFEGVEQVPGNAAVMPIRQEIGFLIQPSAVPQIRM
FT                   PWQTLVFSISGNNLVIKNPGKHVVRLGPQIILVPSNEVVALGNPYIMPETSKLFPITSS
FT                   PTAVKVTPLSRYGFVQTEVTLPVTR"
FT   misc_feature    305194..305262
FT                   /note="1 probable transmembrane helix predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        305876..306133
FT                   /transl_table=11
FT                   /locus_tag="YPO0304"
FT                   /product="putative membrane protein"
FT                   /note="No significant database hits"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384KS31"
FT                   /inference="protein motif:TMHMM:2.0"
FT                   /protein_id="CAL18990.1"
FT                   /translation="MMWGDHLYTEGGIFFPVVEIDMPQEFAGSARAIGYLIGYLPSLFG
FT                   YRLYGYFLDTYLGIQGVNYVFYIMAAFSAGRFICAAVWAK"
FT   misc_feature    305954..306022
FT                   /locus_tag="YPO0304"
FT                   /note="one of 2 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    306059..306127
FT                   /locus_tag="YPO0304"
FT                   /note="one of 2 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        307245..308645
FT                   /transl_table=11
FT                   /locus_tag="YPO0306"
FT                   /product="hypothetical protein"
FT                   /note="No significant database hits"
FT                   /db_xref="GOA:A0A384KX47"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384KX47"
FT                   /protein_id="CAL18991.1"
FT                   /translation="MSVIDHLERPLIPRRYPPNELIIMEDNMMHTENNSPSGLIPLPDW
FT                   YPVAFSHLDAMEYASVTRLWHHEPVLRDLVDELDKRNPGLITFTHCPHCHSADICPGTR
FT                   PEEYRCRTCHRCSSPYTHTPFFDLHHARHSRLYAVLVTLWGTWQVEDAAWLSDCKSKQI
FT                   WKQYCHRLKPILALIGGRAVTHTPRYLRGFTPGQQGLHCPACASTQLVYSETMPVGNPE
FT                   VHCQVCQTDFVMYPDIPKGIDPFAVNTPQYDIPLPRWFSRLFSHASQAQYQHLREVWQR
FT                   EPVLREAVDRLDAQNPEQGAVYACPYCQNKHISPRKTASSIEGYYCPACDNPFTATTGT
FT                   VFTRMRQEHFWRLYAVLVMLWTQWRPTQIFELCQLRSVHPFLTYHKRLAPLLAEFDGAP
FT                   ITPYPRNLLGFTPGQQGVCCVYCQSTKLITEGITVMPLDNPYICCLDCGQRFMLRVWRK
FT                   QVKSNEKK"
FT   CDS_pept        309068..309322
FT                   /transl_table=11
FT                   /locus_tag="YPO0307"
FT                   /product="hypothetical protein"
FT                   /note="No significant database hits"
FT                   /db_xref="UniProtKB/TrEMBL:Q74XG1"
FT                   /protein_id="CAL18992.1"
FT                   /translation="MRRYTRNTANCRCVSCLRSPPVTDLCKILRINEAYPRGLPCEQPL
FT                   PPSCNSDYCGYMRVYTKNKKWKNQNPKRKNGYFDNRFDR"
FT   CDS_pept        309654..311711
FT                   /transl_table=11
FT                   /locus_tag="YPO0308"
FT                   /product="putative oxidoreductase"
FT                   /note="Similar to the eukaryotic Chondrus crispus (red
FT                   algae) hexose oxidase TR:P93762 (EMBL:U89770) (546 aa)
FT                   fasta scores: E(): 0, 33.8% id in 551 aa. Note the
FT                   C-terminus of this protein is similar to many chitinases
FT                   e.g. Serratia marcescens ChiC TR:Q9WXD3 (EMBL:AB019238)
FT                   (480 aa) fasta scores: E(): 2.1e-15, 43.1% id in 144 aa"
FT                   /db_xref="GOA:A0A384LFF3"
FT                   /db_xref="InterPro:IPR003961"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR012951"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR036116"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="InterPro:IPR036573"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384LFF3"
FT                   /inference="similar to sequence:INSDC:U89770"
FT                   /inference="similar to sequence:INSDC:AB019238"
FT                   /protein_id="CAL18993.1"
FT                   /translation="MKIIDKNVSTYETLQKGFNLRWPPNVEQGAETIYICTTPDEVFAA
FT                   TNTALAAGNRITVRSGGHCYEGFVSNKLSTERLSIIDLGEMSGLDYDEDKTITSLWDAN
FT                   KNTYRFKSLTGNQNWNGYVSLYKRSGRTIPGGSCYSVGVGGHISGGGYGLLSRLHGLTV
FT                   DWVTGVDILVPVGNAHRLAFRHVRADSVSEVDRELLMACCGAGGGNFGIIIAYYFDDLP
FT                   KAPQKAYWIPLTYPWSSLKATFPAFLKAYWQWFADNDVNATSTKEGVGNGGLFTLLKLN
FT                   HIDASDNVVLAIQYTGPNGQVGGANDIPLNDFIEKMNAAAGMTPTIYDDFILPNIPPFK
FT                   HLYPGRKIGRTVDESASMDWLHVTQMINGSGSNQRGKYKSDYQIKQFSDEMCHALLTHL
FT                   TTATADKRFNQSLVQIDSYGGAINSRGIGATAVSQRNSLLKAQYQTYWTNEADDQTHLT
FT                   WIRNIYAAVHNGKPAPPEFEGCYINYPDIDMKYTDSGEEDPNWLNLYYGWDTQLIKRLI
FT                   ALKARIDPNNIFHHELSIPLVTELPKAPVNLHSTGQTTTSISLMWGSSIGALPVASYAI
FT                   YRDGHEVKLLNGTQTSAEDAGLQPNTEYRYFVAAGDEHGNLSVPSNVLTVSTQGTHPAW
FT                   VLNGSYAVGDVVSNLGKLWRCIQSHVAYDPLWAPGTNGGITLWAGYTAGR"
FT   misc_feature    311277..311516
FT                   /note="Pfam match to entry PF00041 fn3, Fibronectin type
FT                   III domain, score 38.90, E-value 1.1e-07"
FT                   /inference="protein motif:PF00041"
FT   CDS_pept        complement(312055..315771)
FT                   /transl_table=11
FT                   /locus_tag="YPO0309"
FT                   /product="putative exported protein"
FT                   /note="Similar to Bordetella pertussis putative
FT                   autotransporter protein, BapA TR:CAC14165 (EMBL:AJ277632)
FT                   (903 aa) fasta scores: E(): 0, 34.0% id in 915 aa. Also
FT                   similar in part to Salmonella typhimurium ShdA TR:Q9XCJ4
FT                   (EMBL:AF140550) (2035 aa) fasta scores: E(): 1.1e-16, 24.7%
FT                   id in 1382 aa. Also highly similar to Y. pestis CDSs
FT                   YPO1672 and YPO0765"
FT                   /db_xref="GOA:Q0WJZ8"
FT                   /db_xref="InterPro:IPR005546"
FT                   /db_xref="InterPro:IPR006315"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012332"
FT                   /db_xref="InterPro:IPR036709"
FT                   /db_xref="UniProtKB/TrEMBL:Q0WJZ8"
FT                   /inference="similar to sequence:INSDC:AJ277632"
FT                   /inference="similar to sequence:INSDC:AF140550"
FT                   /protein_id="CAL18994.1"
FT                   /translation="MNPITLAIIVAFSTLVLPQTAWAACNSSGVGTYVCEGENNTAISL
FT                   FGTDIAVETRPGFGITEHEITDSALSLTGSGTISYLDTNSSALDTDSRYSLYIKNDTLI
FT                   TEQSASINVQSNGSISSGVYIDNQSSDDSTIRVDLSGILSSSLSGAPALSIFSSAGNDS
FT                   TIILNTHAISGVTGIQSDNNSQNGATITHVDVTGDINVENSGVSIRNAANGGTSIINFN
FT                   SKSINTEYNSFYIQNTNYVGGVITDINIDGDISSANSQAARIYNYTNGGLASLRFRANN
FT                   VTGSTGLYIDNSSQNGAVTDIILTGDLTATSGSALQANAYSDEGNIETAIKLNNVYSLY
FT                   DALNISDYTRSGNILHDLDISGTITAENGTGIKVMGAAGEGSSTMLINVNNITSSSQSL
FT                   DINNYNFLGSAFSAITATGHLTAEWGQGAMLQTHSSLGDATTLIHFNDITAMSSGISLI
FT                   NEANQGTSTADITVTGQINVSHGEGITLNALTTDGRTLVNVDVNNIASEYDAIRLYNYN
FT                   YNDNYATGVDDGTGADNGTSTIDLITRGALVSQQGYGINIETNTADTYVTVGGLVHGGN
FT                   GTAIGIHRLDNIQTSATLELQSGYALEGVTQALVFTGSYAEINDAALDLANSHLVLGGA
FT                   GDAAFDLTRIDNREEAILDGDPNRITGFGTLTKTNNSIWTLTGANMADGDANAFLSANI
FT                   AGGILVLDNATLGLTPDAGALTGATVNRLSAADIAADPTRVATETGALTLAEGGALSSL
FT                   GDSVLSGNLISAGGILLSNHYTGGNGAATDDRLTVTGTYFGENNGSGEGAWLALDTVLG
FT                   DDDSATDRLVINGDATGTTSVRVNNAGGLGDKTLNGINLITVDGLAQDDTFLLAGDYVT
FT                   TDGYQAVVAGAYAYTLQADGEAATAGRNWYLSSELMLTEGVRYQVGVPLYEQYPQVLAA
FT                   LNTLPTLQQRVGNRYGAPGALADLNFDDNQWAWGRIEGSHQVTDPARSTSGSQREIDVW
FT                   KLQTGIDVPLYQSQGGSLLTGGVNFTYGKAKADIHSFFGDGRINSAGYGLGTSLTWYGN
FT                   NGVYVDGQLQTMWFDSDLSSRTAGHAVASGNNGRGYTSAIEAGKGYTLSHGLSLTPQMQ
FT                   VTYSRVDFDTFRDPFDSEVSLQEGDSLRGRLGVSLNKETTWSAKDGTTRRSHIYSHLDL
FT                   HNEFLNGSKVQVSGVEFATRDERQSVGLGAGGTYEWQNGRYAVYGNVNLLGATRNISDN
FT                   YAVGGTIGARVSW"
FT   CDS_pept        316696..317220
FT                   /transl_table=11
FT                   /gene="ubiC"
FT                   /locus_tag="YPO0310"
FT                   /product="putative chorismate--pyruvate lyase"
FT                   /note="Similar to Escherichia coli chorismate--pyruvate
FT                   lyase UbiC SW:UBIC_ECOLI (P26602) (164 aa) fasta scores:
FT                   E(): 0, 55.7% id in 158 aa"
FT                   /db_xref="GOA:Q8ZJ20"
FT                   /db_xref="InterPro:IPR007440"
FT                   /db_xref="InterPro:IPR028978"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZJ20"
FT                   /protein_id="CAL18995.1"
FT                   /translation="MFIGDASILKPIQWCATEHPELPADIADWLMELGSMTRRFEQHCQ
FT                   RVHVEPQRECFITRDALGEEAEHLPVSQRYWLREIVLFGDNVPWLLGRTVIPEETLSGP
FT                   DRALVDLGTLPLGRYLFSGDALTRDYIHVGRQDNLWARRSLLRLSGNPLLLTEVFLPAS
FT                   PLYTHCDSIPK"
FT   CDS_pept        317386..318252
FT                   /transl_table=11
FT                   /gene="b4040"
FT                   /gene_synonym="cyr"
FT                   /gene_synonym="ubiA"
FT                   /locus_tag="YPO0311"
FT                   /product="4-hydroxybenzoate octaprenyltransferase"
FT                   /EC_number="2.5.1.-"
FT                   /note="Similar to Escherichia coli 4-hydroxybenzoate
FT                   octaprenyltransferase UbiA SW:UBIA_ECOLI (P26601) (290 aa)
FT                   fasta scores: E(): 0, 73.3% id in 288 aa"
FT                   /db_xref="GOA:Q7CKP5"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="InterPro:IPR006370"
FT                   /db_xref="InterPro:IPR030470"
FT                   /db_xref="InterPro:IPR039653"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7CKP5"
FT                   /inference="protein motif:TMHMM:2.0"
FT                   /protein_id="CAL18996.1"
FT                   /translation="MKGSTVHTKWQAYCRLMRIDKPIGSLLLLWPTLWALWLAGRGIPE
FT                   AKILVVFVLGVFFMRAAGCVVNDYADRHIDGFVKRTASRPLPSGTISEKESKILFVVLI
FT                   LLSFGLVLTLNSMTIWLSLAALALAWIYPFMKRVTHLPQVVLGAAFGWSIPMGFAAVSE
FT                   SLPLVCWLLLLANICWTVAYDTQYAMVDRDDDLRIGVKSTAILFGQHDKLIIGLLQLAT
FT                   LLLMVAIGWLMNLGGAFYWSILLAGALFTHQQKMIAQREREPCFRAFLNNNYVGLVLFL
FT                   GILISYW"
FT   misc_feature    317446..317499
FT                   /gene="b4040"
FT                   /gene_synonym="cyr"
FT                   /gene_synonym="ubiA"
FT                   /locus_tag="YPO0311"
FT                   /note="one of 7 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    317458..318249
FT                   /note="Pfam match to entry PF01040 UbiA, UbiA
FT                   prenyltransferase family, score 341.20, E-value 1.2e-98"
FT                   /inference="protein motif:PF01040"
FT   misc_feature    317527..317595
FT                   /gene="b4040"
FT                   /gene_synonym="cyr"
FT                   /gene_synonym="ubiA"
FT                   /locus_tag="YPO0311"
FT                   /note="one of 7 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    317584..317652
FT                   /note="PS00943 UbiA prenyltransferase family signature."
FT                   /inference="protein motif:ProSite:PS00943"
FT   misc_feature    317677..317745
FT                   /gene="b4040"
FT                   /gene_synonym="cyr"
FT                   /gene_synonym="ubiA"
FT                   /locus_tag="YPO0311"
FT                   /note="one of 7 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    317803..317871
FT                   /gene="b4040"
FT                   /gene_synonym="cyr"
FT                   /gene_synonym="ubiA"
FT                   /locus_tag="YPO0311"
FT                   /note="one of 7 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    317884..317952
FT                   /gene="b4040"
FT                   /gene_synonym="cyr"
FT                   /gene_synonym="ubiA"
FT                   /locus_tag="YPO0311"
FT                   /note="one of 7 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    318064..318132
FT                   /gene="b4040"
FT                   /gene_synonym="cyr"
FT                   /gene_synonym="ubiA"
FT                   /locus_tag="YPO0311"
FT                   /note="one of 7 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    318193..318246
FT                   /gene="b4040"
FT                   /gene_synonym="cyr"
FT                   /gene_synonym="ubiA"
FT                   /locus_tag="YPO0311"
FT                   /note="one of 7 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        complement(318433..320910)
FT                   /transl_table=11
FT                   /gene="b4041"
FT                   /gene_synonym="plsB"
FT                   /locus_tag="YPO0312"
FT                   /product="glycerol-3-phosphate acyltransferase"
FT                   /EC_number="2.3.1.15"
FT                   /note="Similar to Escherichia coli glycerol-3-phosphate
FT                   acyltransferase PlsB SW:PLSB_ECOLI (P00482) (806 aa) fasta
FT                   scores: E(): 0, 80.2% id in 802 aa"
FT                   /db_xref="GOA:Q8ZJ18"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="InterPro:IPR022284"
FT                   /db_xref="InterPro:IPR028354"
FT                   /db_xref="InterPro:IPR041728"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZJ18"
FT                   /protein_id="CAL18997.1"
FT                   /translation="MSGWRKIYYKLLNLPLKLLVKSKVIPADPVSELGLDPSRPILYVL
FT                   PYNSKADLLTLRAQCLAQDLPDPLIPLEIDGVQLPSHVFIENGPRVFRYYVPKQESVKL
FT                   FHDYLDLHRNNPALDIQMLPVSVMFGRSPGREGHGTPHLRVLNGVQKFFAVLWLGRDSF
FT                   VRFSTTVSLRRMASEHGTDKTIAHKLARVARMHFSRQRLAAVGPSLPARQDLFKKLLAS
FT                   KAIEKAVADEARSKKISHEKAQQNAITLMEEIAANFSYEAVRLSDRVLSWTWNRLYQGI
FT                   NVHNAERVRQLAQDGHEIVYVPCHRSHMDYLLLSYVLYHQGLVPPHIAAGINLNFWPAG
FT                   PIFRRLGAFFIRRTFKGNKLYSTVFREYLGELFTRGYSVEYFVEGGRSRTGRLLEPKTG
FT                   TLSMTIQAMLRGGTRPITLVPIYIGYEHVMEVGTYAKELRGAIKEKENLLQMLRGLRKL
FT                   RNLGQGYVNFGEPLPLTTYLNTHVPQWRDAIDPIEAQRPSWLTPAVNDLANQIMVRINN
FT                   AAAANAMNLCSTALLASRQRSLTREQLLEQLDCYLQLMRNAPYAKDTTVPDKTPEELLN
FT                   HALNMNKFEVEKDTIGDIIILPREQAVLMTYYRNNIQHLLILPSLIASMVMYHRRITRT
FT                   ELLHKISMIYPMLKAELFLHYSKEQLPETLDTLIDELARQQLICDKGSELVLNPARIRP
FT                   LQLLAAGVRETLQRYAITLSLLSATPSINRGALEKESRIMAQRLSVLHGINAPEFFDKA
FT                   VFSTLVATLREEGYISDSGDAIQEHTLEVYNMLSALMTPEVKLTIESVSMPAETSNQPE
FT                   APETPEPEGKTES"
FT   misc_feature    complement(319462..320043)
FT                   /note="Pfam match to entry PF01553
FT                   Acyltransferase,Acyltransferase, score 145.10, E-value
FT                   1.3e-39"
FT                   /inference="protein motif:PF01553"
FT   CDS_pept        321038..321409
FT                   /transl_table=11
FT                   /gene="b4042"
FT                   /gene_synonym="dgkA"
FT                   /locus_tag="YPO0313"
FT                   /product="diacylglycerol kinase"
FT                   /EC_number="2.7.1.107"
FT                   /note="Similar to Escherichia coli diacylglycerol kinase
FT                   DgkA SW:KDGL_ECOLI (P00556) (121 aa) fasta scores: E():
FT                   0,68.1% id in 119 aa"
FT                   /db_xref="GOA:A0A384LMA0"
FT                   /db_xref="InterPro:IPR000829"
FT                   /db_xref="InterPro:IPR033718"
FT                   /db_xref="InterPro:IPR036945"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384LMA0"
FT                   /inference="protein motif:TMHMM:2.0"
FT                   /protein_id="CAL18998.1"
FT                   /translation="MANQSTGLTRIYKAAGYTVKGLTAAWNNEAAFRQESVAAVIAIIL
FT                   AFWLDVGAIARILLICSVVLVLIVEVINSAIEAVVDRIGSEFHALSGRAKDMGSAAVFL
FT                   TILMALFVWITVLWQHVAR"
FT   misc_feature    321059..321394
FT                   /note="Pfam match to entry PF01219 DAGK_prokar, Prokaryotic
FT                   diacylglycerol kinase, score 164.20, E-value 2.2e-45"
FT                   /inference="protein motif:PF01219"
FT   misc_feature    321146..321214
FT                   /gene="b4042"
FT                   /gene_synonym="dgkA"
FT                   /locus_tag="YPO0313"
FT                   /note="one of 2 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    321245..321280
FT                   /note="PS01069 Prokaryotic diacylglycerol kinase
FT                   signature."
FT                   /inference="protein motif:ProSite:PS01069"
FT   misc_feature    321335..321403
FT                   /gene="b4042"
FT                   /gene_synonym="dgkA"
FT                   /locus_tag="YPO0313"
FT                   /note="one of 2 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        321534..322142
FT                   /transl_table=11
FT                   /gene="b4043"
FT                   /gene_synonym="exrA"
FT                   /gene_synonym="lexA"
FT                   /gene_synonym="spr"
FT                   /gene_synonym="tsl"
FT                   /gene_synonym="umuA"
FT                   /locus_tag="YPO0314"
FT                   /product="LexA repressor"
FT                   /EC_number="3.4.21.88"
FT                   /note="Similar to Escherichia coli repressor LexA
FT                   SW:LEXA_ECOLI (P03033) (202 aa) fasta scores: E(): 0, 91.6%
FT                   id in 202 aa"
FT                   /db_xref="GOA:Q8ZJ16"
FT                   /db_xref="InterPro:IPR006197"
FT                   /db_xref="InterPro:IPR006199"
FT                   /db_xref="InterPro:IPR006200"
FT                   /db_xref="InterPro:IPR015927"
FT                   /db_xref="InterPro:IPR036286"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR039418"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZJ16"
FT                   /protein_id="CAL18999.1"
FT                   /translation="MKALTTRQQEVYDLVRDHLAQTGMPPTRAEIAQRLGFRSPNAAEE
FT                   HLKALARKGVIEIVSGASRGIRLLMEEEEGLPLIGRVAAGEPLLAQQHIEGHYKVDPSL
FT                   FKPGADFLLRVNGMSMRDIGILDGDLLAVHKTQDVRNGQVVVARIDDEVTVKRLKKQGN
FT                   IVHLLPENSEFQPIVVDLREQSFTIEGLAVGVIRNGDWI"
FT   misc_feature    321534..321728
FT                   /note="Pfam match to entry PF01726 LexA_DNA_bind, LexA DNA
FT                   binding domain, score 135.90, E-value 7.1e-37"
FT                   /inference="protein motif:PF01726"
FT   misc_feature    321729..322082
FT                   /note="Pfam match to entry PF00717 Peptidase_S24, Peptidase
FT                   family S24, score 200.10, E-value 3.5e-56"
FT                   /inference="protein motif:PF00717"
FT   repeat_region   322219..322253
FT                   /note="contains 5x TTTTTGC repeats"
FT   CDS_pept        complement(322302..322811)
FT                   /transl_table=11
FT                   /locus_tag="YPO0315"
FT                   /product="putative regulatory protein"
FT                   /note="Similar to Escherichia coli zinc uptake regulation
FT                   protein Zur SW:ZUR_ECOLI (P32692) (171 aa) fasta scores:
FT                   E(): 0, 69.2% id in 169 aa"
FT                   /db_xref="GOA:A0A384L4L7"
FT                   /db_xref="InterPro:IPR002481"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384L4L7"
FT                   /protein_id="CAL19000.1"
FT                   /translation="MNPINQEKLLAQAESLCQQRNVRLTPQRLEVLRLMAQQPGAISAY
FT                   DLLDLLRVAEPQAKPPTVYRALDFLLEQGFIHRVESANSYVLCHHFEEPTHTSALFICD
FT                   RCKIVTERPTVGIEEALAQLAKQSGFTLRHSVVEAHGLCTECGVVEACESHDDCEHDHS
FT                   IVVKKK"
FT   misc_feature    complement(322392..322757)
FT                   /note="Pfam match to entry PF01475 FUR, Ferric uptake
FT                   regulator family, score 6.30, E-value 7.2e-05"
FT                   /inference="protein motif:PF01475"
FT   CDS_pept        323066..324103
FT                   /transl_table=11
FT                   /locus_tag="YPO0316"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to many proteins of unknown function e.g.
FT                   Escherichia coli hypothetical protein YjbN SW:YJBN_ECOLI
FT                   (P32695) (330 aa) fasta scores: E(): 0, 78.2% id in 316 aa.
FT                   Note the possible alternative translational start site at
FT                   codon 27"
FT                   /db_xref="GOA:Q8ZJ14"
FT                   /db_xref="InterPro:IPR001269"
FT                   /db_xref="InterPro:IPR004653"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018517"
FT                   /db_xref="InterPro:IPR035587"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZJ14"
FT                   /protein_id="CAL19001.1"
FT                   /translation="MHEAQTFSSTPATKPQYPLQRFSVAPMLDWTDRHCRYFHRLLTKQ
FT                   ALLYTEMVTTGAIIHGKADYLAYSEQDHPVALQLGGSDPQALAHCAKLAEQRGYNEINL
FT                   NVGCPSDRVQNGRFGACLMGEADLVADCIKAMRDAVAIPVTVKTRIGIDQLDSYEFLCE
FT                   FVQTVAERGECEIFTIHARKAWLSGLSPKENREVPPLDYERVYQLKRDFPALTIAINGG
FT                   VKTLAEAKEHLKHLDGVMMGREAYQNPGILTQVDRELFDPNAPVVDSVKAIEALYPYIE
FT                   QELSQGAYLGHITRHILGIFQGIPGARQWRRHLSENAHKPGAGVSVVEEALALVSPSYY
FT                   ESVGG"
FT   misc_feature    323132..324073
FT                   /note="Pfam match to entry PF01207 UPF0034, Uncharacterized
FT                   protein family UPF0034, score 440.00, E-value 2.1e-128"
FT                   /inference="protein motif:PF01207"
FT   misc_feature    323369..323425
FT                   /note="PS01136 Uncharacterized protein family UPF0034
FT                   signature."
FT                   /inference="protein motif:ProSite:PS01136"
FT   CDS_pept        324619..324837
FT                   /transl_table=11
FT                   /locus_tag="YPO0318"
FT                   /product="putative exported protein"
FT                   /note="Similar to Escherichia coli hypothetical protein
FT                   YjbO SW:YJBO_ECOLI (P32696) (80 aa) fasta scores: E():
FT                   1.7e-14, 58.3% id in 72 aa"
FT                   /db_xref="InterPro:IPR014318"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384LP42"
FT                   /inference="protein motif:TMHMM:2.0"
FT                   /protein_id="CAL19002.1"
FT                   /translation="MLEIFFVIGFFMVLMVTGISLLGILAALLVAAVFMMLGGLFVMMI
FT                   KLLPWLILAVVVAWIWRSMQKPVIRRY"
FT   misc_feature    324637..324705
FT                   /locus_tag="YPO0318"
FT                   /note="one of 2 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    324733..324801
FT                   /locus_tag="YPO0318"
FT                   /note="one of 2 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        complement(325182..326165)
FT                   /transl_table=11
FT                   /gene="b4051"
FT                   /gene_synonym="hcz"
FT                   /gene_synonym="qor"
FT                   /locus_tag="YPO0319"
FT                   /product="quinone oxidoreductase"
FT                   /EC_number="1.6.5.5"
FT                   /note="Similar to Escherichia coli quinone oxidoreductase
FT                   Qor SW:QOR_ECOLI (P28304) (327 aa) fasta scores: E():
FT                   0,73.4% id in 327 aa"
FT                   /db_xref="GOA:A0A384KX66"
FT                   /db_xref="InterPro:IPR002364"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384KX66"
FT                   /protein_id="CAL19003.1"
FT                   /translation="MAKHIQFTTTGGPDVLQYLEFTPSDPAPHEVQVENKAIGINYIDT
FT                   YVRSGLYPPAHLPSGLGTEAAGIVSKVGAAVSSVKVGDRVVYAQSALGAYSEVHNVPAD
FT                   KIALLPEQISFEQAAASFLKGLTAYYLLRQTHEIKPGEVFLFHAAAGGVGLIACQWAKA
FT                   LGAKLIGTVGSDEKAQLAKAAGAWATINYRTENIAQRVAELTEGEKVGVVYDSVGKSTW
FT                   EASLDSLKRRGLLVSFGNASGPVTGVNLGILNQKGGIYVTRPSLNVYVANRQELESASQ
FT                   QLFSMITSGAINVDVAQAQQFPLRDAQRAHETLEGRQTTGSSLLIP"
FT   misc_feature    complement(325185..326123)
FT                   /note="Pfam match to entry PF00107 adh_zinc, Zinc-binding
FT                   dehydrogenases, score 264.40, E-value 1.5e-75"
FT                   /inference="protein motif:PF00107"
FT   misc_feature    complement(325680..325745)
FT                   /note="PS01162 Quinone oxidoreductase / zeta-crystallin
FT                   signature."
FT                   /inference="protein motif:ProSite:PS01162"
FT   misc_feature    complement(325692..325724)
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:ProSite:PS00013"
FT   CDS_pept        326497..327903
FT                   /transl_table=11
FT                   /gene="b4052"
FT                   /gene_synonym="dnaB"
FT                   /gene_synonym="groP"
FT                   /gene_synonym="grpA"
FT                   /locus_tag="YPO0320"
FT                   /product="replicative DNA helicase"
FT                   /EC_number="3.6.1.-"
FT                   /note="Similar to Escherichia coli replicative DNA helicase
FT                   DnaB SW:DNAB_ECOLI (P03005) (471 aa) fasta scores: E():
FT                   0,84.9% id in 471 aa"
FT                   /db_xref="GOA:A0A384KJG2"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR007692"
FT                   /db_xref="InterPro:IPR007693"
FT                   /db_xref="InterPro:IPR007694"
FT                   /db_xref="InterPro:IPR016136"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036185"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384KJG2"
FT                   /protein_id="CAL19004.1"
FT                   /translation="MAAKKPTNKMTEPRDRQMEGLKLPPHSLEAEQSVLGGLMLDNERW
FT                   DNVSERVASKDFFSRPHRRIFTEMQRLLENSKPIDLITLSESLEQKGDLDSVGGFAYLA
FT                   ELSKNTPSAANIGAYADIVRERAVVREMISVANEIADAGYDPQGRSSEDLLDLAESKVF
FT                   QIAESRASKDEGPKSVDRILEDTVARIEQLYQRPHDGVTGVSTGFTDLDKKTAGLQKSD
FT                   LIIVAARPSMGKTTFAMNLCENAAMMQDKPVLIFSLEMPGDQIMMRMLASLSHVDQTRI
FT                   RTGQLDDEDWARISSTMGILMEKRNMYIDDSSGLTPTEVRSRARRIFREHGGLSLIMID
FT                   YLQLMRVPSLSDNRTLEIAEISRSLKALAKELQVPVVALSQLNRSLEQRADKRPVNSDL
FT                   RESGSIEQDADLIMFIYRDEVYHENSDEKGIAQIILGKQRNGPIGSVRLKFNGQWSRFD
FT                   NYAGPQYDDE"
FT   misc_feature    326641..327693
FT                   /note="Pfam match to entry PF00772 DnaB, DnaB-like
FT                   helicase, score 652.30, E-value 1.4e-205"
FT                   /inference="protein motif:PF00772"
FT   misc_feature    327178..327201
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:ProSite:PS00017"
FT   misc_feature    327583..327648
FT                   /note="Predicted helix-turn-helix motif with score 1279
FT                   (+3.54 SD) at aa 363-384, sequence RSLKALAKELQVPVVALSQLNR"
FT   CDS_pept        328000..329079
FT                   /transl_table=11
FT                   /gene="alr"
FT                   /locus_tag="YPO0321"
FT                   /product="alanine racemase (biosynthetic)"
FT                   /EC_number="5.1.1.1"
FT                   /note="Similar to Escherichia coli biosynthetic alanine
FT                   racemase Alr SW:ALR1_ECOLI (P29743) (359 aa) fasta scores:
FT                   E(): 0, 72.1% id in 358 aa"
FT                   /db_xref="GOA:Q8ZJ10"
FT                   /db_xref="InterPro:IPR000821"
FT                   /db_xref="InterPro:IPR001608"
FT                   /db_xref="InterPro:IPR009006"
FT                   /db_xref="InterPro:IPR011079"
FT                   /db_xref="InterPro:IPR020622"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZJ10"
FT                   /protein_id="CAL19005.1"
FT                   /translation="MKAATAVIDRHALRHNLQQIRRLAPQSRLVAVVKANAYGHGLLAA
FT                   AHTLQDADCYGVARISEALMLRAGGIVKPILLLEGFFDAEDLPVLVANHIETAVHSLEQ
FT                   LVALEAATLSAPINVWMKLDTGMHRLGVRPDQAEAFYQRLSACRNVIQPVNIMSHFSRA
FT                   DEPEVAATQQQLACFDAFAAGKPGKQSIAASGGILRWPQAHRDWVRPGIVLYGVSPFDA
FT                   PYGRDFGLLPAMTLKSSLIAVREHKAGESVGYGGTWVSERDTRLGVIAIGYGDGYPRSA
FT                   PSGTPVWLNGREVSIVGRVSMDMISIDLGPESTDKVGDEALMWGAELPVERVAACTGIS
FT                   AYELITNLTSRVAMEYLGE"
FT   misc_feature    328081..329070
FT                   /note="Pfam match to entry PF00842 Ala_racemase, Alanine
FT                   racemase, score 589.20, E-value 2.5e-173"
FT                   /inference="protein motif:PF00842"
FT   misc_feature    328090..328122
FT                   /note="PS00395 Alanine racemase pyridoxal-phosphate
FT                   attachment site."
FT                   /inference="protein motif:ProSite:PS00395"
FT   CDS_pept        329265..330458
FT                   /transl_table=11
FT                   /gene="tyrB"
FT                   /locus_tag="YPO0322"
FT                   /product="aromatic-amino-acid aminotransferase"
FT                   /EC_number="2.6.1.57"
FT                   /note="Similar to Escherichia coli aromatic-amino-acid
FT                   aminotransferase TyrB SW:TYRB_ECOLI (P04693) (397 aa) fasta
FT                   scores: E(): 0, 75.5% id in 396 aa"
FT                   /db_xref="GOA:A0A0H2W2H9"
FT                   /db_xref="InterPro:IPR000796"
FT                   /db_xref="InterPro:IPR004838"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2W2H9"
FT                   /protein_id="CAL19006.1"
FT                   /translation="MFQNVDAYAGDPILSLMESFKADNRAHKVNLSIGLYYNEQGEIPQ
FT                   MQAVDAAEAQLSTQPHGTPVYLPMEGLQSYRTAIQQLLFGHDHPMLVQQRVATIQTVGG
FT                   SGALKVGADFLNHYFPDSQVWVSDPTWENHVAIFSGAGFKVNTYPYFDNDKLAVKFDPM
FT                   LATLQQLPARSIVLLHPCCHNPTGSDLTNAQWDRLIDVVKERELIPFLDIAYQGFGAGL
FT                   NEDAYAIRAMAAVGLPCLISNSFSKIFSLYNERVGGLSVVCESDEAAGRVLGQLKATVR
FT                   RNYSSPPNFGAQVVSKVLNDTVLRAQWQAEVEQMRLRILDMRHTLVEALKASLPERNFD
FT                   YLLQQRGMFSYTGFSEAQVESLREEFGVYLIASGRMCMAGVNHQNVEQVAVAFAAVQ"
FT   misc_feature    329265..330455
FT                   /note="Pfam match to entry PF00155
FT                   aminotran_1,Aminotransferases class-I, score 503.10,
FT                   E-value 2.1e-147"
FT                   /inference="protein motif:PF00155"
FT   misc_feature    329994..330035
FT                   /note="PS00105 Aminotransferases class-I
FT                   pyridoxal-phosphate attachment site."
FT                   /inference="protein motif:ProSite:PS00105"
FT   CDS_pept        330985..331344
FT                   /transl_table=11
FT                   /locus_tag="YPO0323"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Escherichia coli hypothetical protein
FT                   YjbR SW:YJBR_ECOLI (P32699) (118 aa) fasta scores: E():
FT                   1.6e-27, 57.4% id in 115 aa"
FT                   /db_xref="InterPro:IPR007351"
FT                   /db_xref="InterPro:IPR038056"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384KJT3"
FT                   /protein_id="CAL19007.1"
FT                   /translation="MNHSALLEYCLSKPGAEQCEHEQWQTNQIKVADVMFAMVGNIGGR
FT                   PSISLKSSPKLAERLREQHPEIVPSEHLNKTHWNTVFLDGKLPNSQFYTLIDHSYQLVL
FT                   QGLPEQRRQDLSSHL"
FT   CDS_pept        complement(331437..334280)
FT                   /transl_table=11
FT                   /gene="b4058"
FT                   /gene_synonym="dinE"
FT                   /gene_synonym="uvrA"
FT                   /locus_tag="YPO0324"
FT                   /product="excinuclease ABC subunit A"
FT                   /note="Similar to Escherichia coli excinuclease ABC subunit
FT                   A UvrA SW:UVRA_ECOLI (P07671) (940 aa) fasta scores: E():
FT                   0, 90.9% id in 940 aa"
FT                   /db_xref="GOA:Q8ZJ07"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR004602"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041102"
FT                   /db_xref="InterPro:IPR041552"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZJ07"
FT                   /protein_id="CAL19008.1"
FT                   /translation="MDNIEVRGARTHNLKNINLIIPRDKLIVVTGLSGSGKSSLAFDTL
FT                   YAEGQRRYVESLSAYARQFLSLMEKPDVDHIEGLSPAISIEQKSTSHNPRSTVGTITEI
FT                   HDYLRLLFARVGEPRCPDHDVPLAAQTVSQMVDNVISQPEGRRLMLLAPVVKDRKGEHT
FT                   KILENLAAQGYIRARIDGEVCDLSDPPKLELQKKHTIEVVVDRFKVREDLAQRLAESFE
FT                   TALALSGGTAVVADMDDPHVEELLFSANFACPICGYSMRELEPRLFSFNNPAGACPTCD
FT                   GLGVQQFFDPDRVLQNPELSLAGGAIRGWDRRNFYYFQMLRSLAEHYKFDIEAPFNSLD
FT                   SAVQQAVLYGSGKDTIEFKYINDRGDTTVRRHPFEGVLHNMERRYKETESSAVREELAK
FT                   FISNRSCASCSGTRLRREARYVFVENTTLPEISELSIGHALSFFQNMKLSGQRAQIAEK
FT                   ILKEIGDRLKFLVNVGLNYLSLSRSAETLSGGEAQRIRLASQIGAGLVGVMYVLDEPSI
FT                   GLHQRDNERLLETLIHLRNLGNTVIVVEHDEDAIRAADHVIDIGPGAGVHGGEVVAEGT
FT                   VDDIMAAPASLTGQFLSGKRSIAIPEKRVSADPSKVLKLIGATGNNLKDVTLTLPVGLF
FT                   SCITGVSGSGKSTLINDTLYSIAQRQLNGATITEPAPYREIQGLEHFDKVIDIDQSPIG
FT                   RTPRSNPATYTGIFTPIRELFAGVPESRTRGYTPGRFSFNVKGGRCEACQGDGVIKVEM
FT                   HFLPDIYVPCDHCKGKRYNRETLEVKYKGKSIHEVLAMTIEEAREFFDAVPALARKLQT
FT                   LIDVGLSYICLGQSATTLSGGEAQRVKLSRELSKRGTGQTLYILDEPTTGLHFADIQQL
FT                   LAVLHQLRDQGNTIVVIEHNLDVIKTADWIVDLGPEGGSGGGEILVSGTPETVAECAAS
FT                   HTARFLKPMLQRKPQTV"
FT   misc_feature    complement(331566..332384)
FT                   /note="Pfam match to entry PF00005 ABC_tran, ABC
FT                   transporter, score 133.30, E-value 4.5e-36"
FT                   /inference="protein motif:PF00005"
FT   misc_feature    complement(331749..331793)
FT                   /note="PS00211 ABC transporters family signature."
FT                   /inference="protein motif:ProSite:PS00211"
FT   misc_feature    complement(332340..332363)
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:ProSite:PS00017"
FT   misc_feature    complement(332592..334211)
FT                   /note="Pfam match to entry PF00005 ABC_tran, ABC
FT                   transporter, score 5.10, E-value 9.7e-06"
FT                   /inference="protein motif:PF00005"
FT   misc_feature    complement(332778..332822)
FT                   /note="PS00211 ABC transporters family signature."
FT                   /inference="protein motif:ProSite:PS00211"
FT   misc_feature    complement(334167..334190)
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:ProSite:PS00017"
FT   CDS_pept        334738..335286
FT                   /transl_table=11
FT                   /gene="exrB"
FT                   /gene_synonym="lexC"
FT                   /gene_synonym="ssb"
FT                   /locus_tag="YPO0325"
FT                   /product="single-strand binding protein"
FT                   /note="Similar to Escherichia coli single-strand
FT                   DNA-binding protein Ssb SW:SSB_ECOLI (P02339) (177 aa)
FT                   fasta scores: E(): 0, 87.3% id in 181 aa"
FT                   /db_xref="GOA:Q8ZJ06"
FT                   /db_xref="InterPro:IPR000424"
FT                   /db_xref="InterPro:IPR011344"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZJ06"
FT                   /protein_id="CAL19009.1"
FT                   /translation="MASRGVNKVILVGNLGQDPEVRYMPNGGAVANITLATSESWRDKQ
FT                   TGEQKEKTEWHRVVLFGKLAEVAGEYLRKGSQVYIEGALQTRKWQDQSGQERYTTEVVV
FT                   NVGGTMQMLGGRQGGGAPAGGGAAPQDGGAQGGWGQPQQPQGGNQFSGGQASRPAQPAP
FT                   AAPQGGNEPPMDFDDDIPF"
FT   misc_feature    334753..335079
FT                   /note="Pfam match to entry PF00436 SSB, Single-strand
FT                   binding protein family, score 232.50, E-value 2.2e-68"
FT                   /inference="protein motif:PF00436"
FT   misc_feature    334753..334791
FT                   /note="PS00735 Single-strand binding protein family
FT                   signature 1."
FT                   /inference="protein motif:ProSite:PS00735"
FT   misc_feature    334894..334923
FT                   /note="PS00736 Single-strand binding protein family
FT                   signature 2."
FT                   /inference="protein motif:ProSite:PS00736"
FT   CDS_pept        complement(335533..335847)
FT                   /transl_table=11
FT                   /locus_tag="YPO0326"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Escherichia coli hypothetical protein
FT                   YiiL SW:YIIL_ECOLI (P32156) (104 aa) fasta scores: E():
FT                   0,77.7% id in 103 aa"
FT                   /db_xref="GOA:Q0WJY2"
FT                   /db_xref="InterPro:IPR008000"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR013448"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0WJY2"
FT                   /protein_id="CAL19010.1"
FT                   /translation="MIRKAFVMAVNPDAHAEYQRRHTPIWPELESVLKAHGAHHYSIFL
FT                   DETRNLLFGVVEIESEERWNAVAQTAECQRWWQHMADVMPSHPDNSPVSQALREVFYLE
FT                   "
FT   CDS_pept        complement(335861..337009)
FT                   /transl_table=11
FT                   /locus_tag="YPO0327"
FT                   /product="probable alcohol dehydrogenase"
FT                   /EC_number="1.1.1.244"
FT                   /note="Similar to Bacillus methanolicus NAD-dependent
FT                   methanol dehydrogenase Mdh SW:MEDH_BACMT (P31005) (380 aa)
FT                   fasta scores: E(): 0, 42.9% id in 378 aa and to Escherichia
FT                   coli probable alcohol dehydrogenase YiaY SW:ADH2_ECOLI
FT                   (P37686) (382 aa) fasta scores: E(): 0, 43.6% id in 376 aa"
FT                   /db_xref="GOA:A0A384KEH5"
FT                   /db_xref="InterPro:IPR001670"
FT                   /db_xref="InterPro:IPR013460"
FT                   /db_xref="InterPro:IPR018211"
FT                   /db_xref="InterPro:IPR039697"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384KEH5"
FT                   /protein_id="CAL19011.1"
FT                   /translation="MSFMLALPKISLHGTGAIGDMVKLLSDKQWGKALIVTDGQLVELG
FT                   LLDSLFAAMAQYQLPYGLFGEVFPNPTEELVQAGFAAFTQHQCDYLIAFGGGSPIDTAK
FT                   AIKILTANPGPSTAYSGVGKVKQTGVPLIAINTTAGTAAELTSNAVIIDSQRQVKEVII
FT                   DTNLIPDIAVDDPSVMLNIPASVTAATGMDALTHAVEAYVSLGAHTLTDHSALESIRLI
FT                   SQWLPLAVADGKNLQAREMMACGQYLAGMAFNSAGLGLVHALAHQPGATHNLPHGVCNA
FT                   ILLPVIEEYNRPQATRRFARIAQAMGVDTQDMSDEQASHQAIAAIRQLSLQVGIPAGFS
FT                   ALGIEESDIEGWLDKALADPCAPCNPRSADREQIRTLYLQAL"
FT   misc_feature    complement(335888..336988)
FT                   /note="Pfam match to entry PF00465 Fe-ADH, Iron-containing
FT                   alcohol dehydrogenases, score 439.60, E-value 2.7e-128"
FT                   /inference="protein motif:PF00465"
FT   misc_feature    complement(336173..336235)
FT                   /note="PS00060 Iron-containing alcohol dehydrogenases
FT                   signature 2."
FT                   /inference="protein motif:ProSite:PS00060"
FT   misc_feature    complement(336410..336496)
FT                   /note="PS00913 Iron-containing alcohol dehydrogenases
FT                   signature 1."
FT                   /inference="protein motif:ProSite:PS00913"
FT   CDS_pept        complement(337076..337900)
FT                   /transl_table=11
FT                   /gene="b3902"
FT                   /gene_synonym="rhaD"
FT                   /locus_tag="YPO0328"
FT                   /product="rhamnulose-1-phosphate aldolase"
FT                   /EC_number="4.1.2.19"
FT                   /note="Similar to Escherichia coli rhamnulose-1-phosphate
FT                   aldolase RhaD SW:RHAD_ECOLI (P32169) (274 aa) fasta scores:
FT                   E(): 0, 68.4% id in 272 aa"
FT                   /db_xref="GOA:Q8ZJ03"
FT                   /db_xref="InterPro:IPR001303"
FT                   /db_xref="InterPro:IPR013447"
FT                   /db_xref="InterPro:IPR036409"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZJ03"
FT                   /protein_id="CAL19012.1"
FT                   /translation="MQAILSSWFIQGMIKATSDMWHKGWDERNGGNISLRLLAEEVEPY
FT                   RRDFYQQPRKVELTQPAPELANSWFLVTGSGKFFRNVELNPAENLVLLQVSNDGMAYHI
FT                   HWGLTQGGLPTSELAAHFQSHIVRMQVSGGTNRVIMHCHATNLIALSYVQKLENASFTR
FT                   LLWEGSTECLVVFPDGIGIVPWMVPGTDGIGTQTAEQMREHSLVLWPFHGIFGSGPTLD
FT                   DAFGLIDTAEKSAEIMVKVLSMGGKKQTISREQLIALAARFDVTPMAAALDA"
FT   misc_feature    complement(337097..337759)
FT                   /note="Pfam match to entry PF00596 Aldolase_II, Class II
FT                   Aldolase and Adducin N-terminal domain., score
FT                   169.40,E-value 6.1e-47"
FT                   /inference="protein motif:PF00596"
FT   CDS_pept        complement(337913..339169)
FT                   /transl_table=11
FT                   /gene="b3903"
FT                   /gene_synonym="rhaA"
FT                   /locus_tag="YPO0329"
FT                   /product="L-rhamnose isomerase"
FT                   /EC_number="5.3.1.14"
FT                   /note="Similar to Escherichia coli L-rhamnose isomerase
FT                   RhaA SW:RHAA_ECOLI (P32170) (419 aa) fasta scores: E():
FT                   0,85.2% id in 418 aa"
FT                   /db_xref="GOA:P58507"
FT                   /db_xref="InterPro:IPR009308"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/Swiss-Prot:P58507"
FT                   /protein_id="CAL19013.1"
FT                   /translation="MTNSIEQAWDLAKQRFAAVGVDVDAALTRLDTLPVSMHCWQGDDV
FT                   TGFEDPDGVLTGGIQATGNYPGKARNATELRSDLELALALIPGPKRLNLHAIYLESDTP
FT                   VARNKIEPRHFSHWVAWAKKHQLGLDFNPSCFSHPLSADGFTLSHADPEIRQFWIEHCQ
FT                   ASRRVSAYFGEQLGTPSVMNIWIPDGMKDTPIDRLAPRQRLLSALDEVISEKLNPAHHI
FT                   DAVESKLFGIGAESYTVGSNEFYMGYAASRQTALCLDAGHFHPTEVISDKISSAMLYVP
FT                   RLLLHVSRPVRWDSDHVVLLDDETQAIASEIIRHNLFDRVHIGLDFFDASINRIAAWVI
FT                   GTRNMKKALLRALLEPTDRLRQLELRGDYTARLALLEEQKSLPWQAIWEGYCQRNDVPV
FT                   DARWLDAVREYEQQILSQR"
FT   CDS_pept        complement(339166..340623)
FT                   /transl_table=11
FT                   /gene="b3904"
FT                   /gene_synonym="rhaB"
FT                   /locus_tag="YPO0330"
FT                   /product="rhamnulokinase"
FT                   /EC_number="2.7.1.5"
FT                   /note="Similar to Escherichia coli rhamnulokinase RhaB
FT                   SW:RHAB_ECOLI (P32171) (489 aa) fasta scores: E(): 0, 62.9%
FT                   id in 483 aa"
FT                   /db_xref="GOA:Q8ZJ02"
FT                   /db_xref="InterPro:IPR000577"
FT                   /db_xref="InterPro:IPR013449"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZJ02"
FT                   /protein_id="CAL19014.1"
FT                   /translation="MVAIDLGASSGRVMLASYYPGQQQLTLREVCRFTNQIKSIDGSDV
FT                   WDIDAIEQSIREGLSQLDSEGIALDSIGIDSWGVDFVLLDKQGKRIGQPVSYRDSRTQG
FT                   VMARAQQTLGSNAIYRRTGIQFLPFNTLYQLRALSEQQPHLLADVAHLLLIPDYLHYRL
FT                   TGQLNWEYTNASTTQLLNIETGDWDSDLLAYAGVPAHWFAKPGKPGNTIGYWHSANGQQ
FT                   VPVVAVATHDTASAVLAAPLIDADAAYLSSGTWSLMGFESGTPLTHQQAQCSNITNEGG
FT                   AEGRYRVLKNIMGLWLLQRATDELQIDDLPQLIEQAARQPACRSLINPNDSRFINPPNM
FT                   CREIQNACREHQFPVPNTAAQLARCIFDSLAMLYRQVAQELATLRGRPISHLHIVGGGC
FT                   QNQFLNQLCADACGLNVSMGPVEASTLGNIGSQLISLGEVADVTHYRRIVANNFPLHHL
FT                   SPHDNSDFAAHWLQFQSLSQLPKELCI"
FT   misc_feature    complement(339850..340395)
FT                   /note="Pfam match to entry PF00370 FGGY, FGGY family of
FT                   carbohydrate kinases, score 111.80, E-value 1.3e-29"
FT                   /inference="protein motif:PF00370"
FT   CDS_pept        340646..340828
FT                   /transl_table=11
FT                   /locus_tag="YPO0331"
FT                   /product="hypothetical protein"
FT                   /note="No significant database hits"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384KLZ8"
FT                   /protein_id="CAL19015.1"
FT                   /translation="MTADGEHVGCEHMGCAYVDGEHVDGVGMISGLLFLNANSVEICLF
FT                   DDLLITANRYGLMAE"
FT   CDS_pept        341050..341871
FT                   /transl_table=11
FT                   /gene="b3905"
FT                   /gene_synonym="rhaC2"
FT                   /gene_synonym="rhaS"
FT                   /locus_tag="YPO0332"
FT                   /product="L-rhamnose operon regulatory protein"
FT                   /note="Similar to Escherichia coli L-rhamnose operon
FT                   regulatory protein RhaS SW:RHAS_ECOLI (P09377) (278 aa)
FT                   fasta scores: E(): 0, 60.0% id in 270 aa"
FT                   /db_xref="GOA:Q8ZJ00"
FT                   /db_xref="InterPro:IPR003313"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="InterPro:IPR023609"
FT                   /db_xref="InterPro:IPR037923"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZJ00"
FT                   /protein_id="CAL19016.1"
FT                   /translation="MTVLHSIDFFSSSSAPVAIEARAPQSAFPEHHHDFYEIVIVEEGA
FT                   GVHVFNGNPYTLSRGCVCFVRDHDRHLFESTDDLFLTNVLFRAPDAFRFLSGVGHFLPR
FT                   ECDGVYPSHWRVNGQVLQQIKCLIACLEHAPKSDQVEDIALHESVFMQLLVKLWQGCQT
FT                   QVGDDQEGRLYQLLDWLQNNYSEAVEWPELADRFALPLRTLHRQLKNKTGMTPQRYLTR
FT                   LHLLQARHQLCYSDNSVTDIAYLCGFGDSNHFSTLFKREFSQSPRDLRSQL"
FT   misc_feature    341608..341868
FT                   /note="Pfam match to entry PF00165 HTH_AraC, Bacterial
FT                   regulatory helix-turn-helix proteins, araC family, score
FT                   97.10, E-value 3.6e-25"
FT                   /inference="protein motif:PF00165"
FT   misc_feature    341611..341676
FT                   /note="Predicted helix-turn-helix motif with score 1051
FT                   (+2.77 SD) at aa 196-217, sequence VEWPELADRFALPLRTLHRQLK"
FT   CDS_pept        342004..342876
FT                   /transl_table=11
FT                   /gene="b3906"
FT                   /gene_synonym="rhaC1"
FT                   /gene_synonym="rhaR"
FT                   /locus_tag="YPO0333"
FT                   /product="L-rhamnose operon transcriptional activator"
FT                   /note="Similar to Escherichia coli L-rhamnose operon
FT                   transcriptional activator RhaR SW:RHAR_ECOLI (P09378) (312
FT                   aa) fasta scores: E(): 0, 54.0% id in 272 aa"
FT                   /db_xref="GOA:Q8ZIZ9"
FT                   /db_xref="InterPro:IPR003313"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="InterPro:IPR023699"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZIZ9"
FT                   /protein_id="CAL19017.1"
FT                   /translation="MRAPLLLESRDYLLSEQMPVAVTNRYPQETFVEHTHQFCEIVIVW
FT                   RGNGLHVLNDHPYRITCGDVFYIQAADHHSYESVHDLVLDNIIYCPERLHLNAQWHKLL
FT                   PPLGPEQNQGYWRLTTQGMAQARPIIQQLAQESRKTDSWSIQLTEVLLLQLAIVLKRHR
FT                   YRAEQAHLLPDGEQLDLIMSALQQSLGAYFDMADFCHKNQLVERSLKQLFRQQTGMSIS
FT                   HYLRQIRLCHAKCLLRGSEHRISDIAARCGFEDSNYFSAVFTREAGMTPRDYRQRFIRS
FT                   PVLPAKNEP"
FT   misc_feature    342577..342837
FT                   /note="Pfam match to entry PF00165 HTH_AraC, Bacterial
FT                   regulatory helix-turn-helix proteins, araC family, score
FT                   98.50, E-value 1.4e-25"
FT                   /inference="protein motif:PF00165"
FT   misc_feature    342688..342816
FT                   /note="PS00041 Bacterial regulatory proteins, araC family
FT                   signature."
FT                   /inference="protein motif:ProSite:PS00041"
FT   CDS_pept        complement(343025..344059)
FT                   /transl_table=11
FT                   /gene="rhaT"
FT                   /locus_tag="YPO0334"
FT                   /product="L-rhamnose-proton symport protein"
FT                   /note="Similar to Escherichia coli L-rhamnose-proton
FT                   symport protein RhaT SW:RHAT_ECOLI (P27125) (344 aa) fasta
FT                   scores: E(): 0, 79.9% id in 343 aa"
FT                   /db_xref="GOA:Q8ZIZ8"
FT                   /db_xref="InterPro:IPR004673"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZIZ8"
FT                   /inference="protein motif:TMHMM:2.0"
FT                   /protein_id="CAL19018.1"
FT                   /translation="MNNAIILGIIWHLVGAASAACFYAPFKQVKKWSWETMWSIGGLVS
FT                   WLILPWTVSYLLLPDFWQYYGSFSIATLLPVFLFGAMWGIGNINYGLTMRYLGMSMGIG
FT                   IAIGITLIIGTLMTPILQGRFDVLLGTPGGRMTLLGVFVALIGVAIVSYAGLLKERAMG
FT                   IQAEEFNLKKGLILAVMCGIFSAGMSFAMDAAKPMHEAASALGINSLYVALPSYVIIMG
FT                   GGAIINLSYCFIRLATLKNLSVKADFSVAKPLLITNILFSALAGLMWYLQFFFYAWGHA
FT                   KIPQQYDYMSWMLHMSFYVLCGGIVGLLLKEWKCSTKKPVAVLCIGCLVIILAANIVGL
FT                   GMAA"
FT   misc_feature    complement(343031..343096)
FT                   /gene="rhaT"
FT                   /locus_tag="YPO0334"
FT                   /note="one of 10 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    complement(343130..343186)
FT                   /gene="rhaT"
FT                   /locus_tag="YPO0334"
FT                   /note="one of 10 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    complement(343232..343297)
FT                   /gene="rhaT"
FT                   /locus_tag="YPO0334"
FT                   /note="one of 10 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    complement(343361..343426)
FT                   /gene="rhaT"
FT                   /locus_tag="YPO0334"
FT                   /note="one of 10 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    complement(343487..343552)
FT                   /gene="rhaT"
FT                   /locus_tag="YPO0334"
FT                   /note="one of 10 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    complement(343592..343657)
FT                   /gene="rhaT"
FT                   /locus_tag="YPO0334"
FT                   /note="one of 10 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    complement(343703..343768)
FT                   /gene="rhaT"
FT                   /locus_tag="YPO0334"
FT                   /note="one of 10 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    complement(343790..343855)
FT                   /gene="rhaT"
FT                   /locus_tag="YPO0334"
FT                   /note="one of 10 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    complement(343886..343942)
FT                   /gene="rhaT"
FT                   /locus_tag="YPO0334"
FT                   /note="one of 10 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    complement(343982..344047)
FT                   /gene="rhaT"
FT                   /locus_tag="YPO0334"
FT                   /note="one of 10 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    complement(343997..344029)
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:ProSite:PS00013"
FT   misc_feature    complement(344098..348755)
FT                   /note="Region which exhibits many of the characteristics of
FT                   a pathogenicity island: low G+C (37%), next to tRNA
FT                   Phe,contains transposase remnants and other pseudogenes and
FT                   contains a viral enhancing protein (YPO0339) important for
FT                   the invasion of the cells of the insect midgut."
FT   CDS_pept        344213..344479
FT                   /transl_table=11
FT                   /locus_tag="YPO0335"
FT                   /product="hypothetical protein"
FT                   /note="Doubtful CDS with no significant database hits"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384L5C5"
FT                   /protein_id="CAL19019.1"
FT                   /translation="MMMITKWHSGGRLTGFMALTAVSQQKLRCPCSSLSLSVVDLKISS
FT                   VVDLKINKRLGINELPHLNRINAVQKGSRLLASRSNLGISLLS"
FT   mRNA            <344490..>344789
FT                   /locus_tag="YPO0336"
FT                   /product="insertion element protein (fragment)"
FT                   /note="Gene remnant which is similar to Shigella
FT                   dysenteriae insertion element protein InsB SW:ISBN_SHIDY
FT                   (P03832) (131 aa) fasta scores: E(): 0, 84.7% id in 98 aa"
FT                   /note="was marked partial"
FT   CDS_pept        complement(344915..345340)
FT                   /transl_table=11
FT                   /locus_tag="YPO0337"
FT                   /product="putative exported protein"
FT                   /note="No significant database hits"
FT                   /db_xref="GOA:A0A384LN78"
FT                   /db_xref="InterPro:IPR008992"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384LN78"
FT                   /protein_id="CAL19020.1"
FT                   /translation="MRYLLSLSVFLIVSLNPAFAEWTGDNVEGMHSGMIINKFHSGQVD
FT                   GKPYFCIEAFKPSTTITACSVKDTSIWGASYNTLYDQAMYYYTTGKRIRVYYAPDVWTN
FT                   NSFVRALTANALVGFSTCISESSCFGPDRKKHKFTVH"
FT   CDS_pept        345570..345737
FT                   /transl_table=11
FT                   /locus_tag="YPO0338"
FT                   /product="hypothetical protein"
FT                   /note="No significant database hits"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384KB96"
FT                   /protein_id="CAL19021.1"
FT                   /translation="MATFSDGSFFIDNKTPYFNLLIMGEVLIIYEVLDIFQNNFLYVNI
FT                   TNELHWGFNL"
FT   CDS_pept        345752..348322
FT                   /transl_table=11
FT                   /locus_tag="YPO0339"
FT                   /product="enhancing factor (viral)"
FT                   /note="Significantly similar to many viral enhancing
FT                   proteins important for the invasion of the cells of the
FT                   insect midgut e.g. Pseudalatia unipuncta granulosis virus
FT                   (PuGV) viral enhancing factor Vef SW:VEF_GVPU (P41723) (901
FT                   aa) fasta scores: E(): 1.5e-20, 25.2% id in 869 aa and to
FT                   Lymantria dispar multicapsid nuclear polyhedrosis virus
FT                   enhancin TR:O37353 (EMBL:AF019970) (782 aa) fasta scores:
FT                   E(): 1.2e-24, 24.5% id in 783 aa"
FT                   /db_xref="InterPro:IPR004954"
FT                   /db_xref="InterPro:IPR031161"
FT                   /db_xref="UniProtKB/TrEMBL:Q0WJX0"
FT                   /inference="similar to sequence:INSDC:AF019970"
FT                   /protein_id="CAL19022.1"
FT                   /translation="MRVIFMRQVTKSKKIKILPYPEWLVKAGMSKGIDHDRQHLGIILA
FT                   AGEMIKVRQVNAEYKEKLKLYLLNDNKNTQRSISFNTDWIELSVDAISVPFINTPYSDG
FT                   IIPEIVFEYPDTSKLLPVYEKGEDESIFFESWDKQNAEFGVVESEYVIILIPEVSKDRL
FT                   KSFSTSGGIDTVLGFYQDIFSFNNSLAGLSFEPQRYSDGNTRNRYFAKADKGGGGAAYY
FT                   SNNWIASSSGSINTFWLSPNATNWGCLHEIAHGYQGGFIDDKYFSTREVWNNIYAACYQ
FT                   DVMLGAEKFNKGWLYNFGKQKEVEKSILNNINNGKEVNAWGERSKLYFIMLMLEKAGVN
FT                   CFTHFNQIYRERKNTDQSVGSVLDMLSNSFATVENRVDVTLFLQMVGGHISKNQYQRNL
FT                   FSHAKAVYPLNQLLQGDELTAVKKTLDLNSELSLVDVDSIEFTDIKSNLTLQFSIDDFA
FT                   QIYGEELLILNGDNYVYNQSIMDKKQTLYNLPVGAYTLRIPTGRNKKYAPQINYLIVKN
FT                   EDSQTQVDFVHRIGSPIVSQKISLQGLNDYTFATIFFDQENDTVSVDITKTKPHYHFPG
FT                   MYARIRIKDKDNNELLNEVITGTNQSLSKNDFPLSSCYVIDIFHKEPGRVKLTPAYKGV
FT                   IDNKSSYNEFIITPYGLQNIKLNNDPKVFLLENIKSAAEMLRSHPIMWHANFSEAKDNI
FT                   YLAIDIFPSPQKEGLLEQYADCISSYYEKPNEDLGNAFSFIFKGINDREFLTTKLNLVT
FT                   KKLEVKIVSGTPHSGFKRTYAVLRYFNADGNELLNLDIIGSKKQAGQEWVFPISGYGGE
FT                   KLYLQHVEPKNRLVITNIMQGIRLSSRTSIQTYEIESLGLSRCT"
FT   misc_feature    346490..346519
FT                   /note="PS00142 Neutral zinc metallopeptidases, zinc-binding
FT                   region signature."
FT                   /inference="protein motif:ProSite:PS00142"
FT   mRNA            complement(<348349..>348483)
FT                   /locus_tag="YPO0340"
FT                   /product="transposase (fragment)"
FT                   /note="Gene remnant which is similar to Escherichia coli
FT                   transposase YdcA TR:Q9Z4D1 (EMBL:AB021078) (393 aa) fasta
FT                   scores: E(): 2.4e-06, 51.1% id in 45 aa"
FT                   /note="was marked partial"
FT                   /inference="similar to sequence:INSDC:AB021078"
FT   tRNA            complement(348756..348831)
FT                   /note="tRNA Phe anticodon GAA, Cove score 84.11"
FT   CDS_pept        complement(348976..349551)
FT                   /transl_table=11
FT                   /locus_tag="YPO0341"
FT                   /product="putative TetR-family regulatory protein"
FT                   /note="Similar to Escherichia coli hypothetical protein
FT                   YjdC SW:YJDC_ECOLI (P36656) (191 aa) fasta scores: E():
FT                   0,64.4% id in 191 aa"
FT                   /db_xref="GOA:A0A384LFJ5"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384LFJ5"
FT                   /protein_id="CAL19023.1"
FT                   /translation="MQREQVLSNALNLLEQQGLANTTLEMLAKALSVEVSDLTRFWPDR
FT                   EALLYDCLRYHSQQIDTWRRQLQLDETLSPQQKLLARYQTLSEQVQNQRYPGCLFIAAC
FT                   SFYPDTEHPIHQLAEQQKQASLHYTKALLQEMDADDADMVAQQMELILEGCLSKLLIKR
FT                   QLADVEVAKCLAEDILTVAQCRKNGALS"
FT   misc_feature    complement(349396..349536)
FT                   /note="Pfam match to entry PF00440 tetR, Bacterial
FT                   regulatory proteins, tetR family, score 21.20, E-value
FT                   0.00097"
FT                   /inference="protein motif:PF00440"
FT   CDS_pept        349971..351986
FT                   /transl_table=11
FT                   /locus_tag="YPO0342"
FT                   /product="putative oxidoreductase"
FT                   /note="Similar over whole length to Escherichia coli AegA
FT                   protein expressed in E. coli under anaerobic conditions
FT                   SW:AEGA_ECOLI (P37127) (659 aa) fasta scores: E(): 0, 56.6%
FT                   id in 670 aa. The C-terminal portion of the product of this
FT                   CDS is similar to many glutamate synthases e.g. Escherichia
FT                   coli glutamate synthase [NADPH] small chain GltD
FT                   SW:GLTD_ECOLI (P09832) (471 aa) fasta scores: E(): 0, 68.9%
FT                   id in 470 aa"
FT                   /db_xref="GOA:Q0WJW8"
FT                   /db_xref="InterPro:IPR006006"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR028261"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q0WJW8"
FT                   /protein_id="CAL19024.1"
FT                   /translation="MNPFIVADAESCIGCRSCEVACVVAHHEGQFPDKPEYFTPRVKVF
FT                   KGDQCATAVFCHHCEDAPCASTCPNGAIVELNNRVQVIQEKCIGCKTCMIACPFGMMTV
FT                   VTETVQPASHRLADVYRRTEAQKCDLCLDQPDGPACIKTCPTQALTLVDQQYLLHQQQQ
FT                   KRQHMALNEHNGRLFSRAVVQAASASSNKSIRDATPVNLLQRPRAPRLEPKKIPLAERK
FT                   TGFAEIYLPFTESQIHEQAERCLECGDKTICQWTCPLHNAIPKWISLAHQGRIHEAAEL
FT                   SHQTSSLPEVCGRVCPQDRLCEQSCTLNDHDGAVTIGQIERHITETALATGWRPDLSQV
FT                   KPSGKRVAIIGAGPAGLGCADILVRNGITPVVFDRYPEIGGLLTFGIPAFKLEKSVMTR
FT                   RREIFTEMGVEFCLNTEIGRDITMENLLHDFDALFLGVGTYRSMRSGLENEDAQGVYDA
FT                   LPFLIGNTQHLMGYTANGAHPYVSMQDQRVVVLGGGDTAMDCVRTSLRQGASRVVCAYR
FT                   RDEKNMPGSKREVKNAREEGAEFMFNLQPMSIVVDESGQVTGIKMVRTEMGQADAQGRR
FT                   QALPITGSEHLIPADAVIMAFGFSPHRMSWLAEHNVVLDKHGRVVAPTISGYPYQTSNP
FT                   KIFAGGDIVRGADLIVTAIAEGRKAAESIAYYLNVL"
FT   misc_feature    350208..350279
FT                   /note="Pfam match to entry PF00037 fer4, 4Fe-4S binding
FT                   domain, score 35.60, E-value 1.1e-06"
FT                   /inference="protein motif:PF00037"
FT   misc_feature    350229..350264
FT                   /note="PS00198 4Fe-4S ferredoxins, iron-sulfur binding
FT                   region signature."
FT                   /inference="protein motif:ProSite:PS00198"
FT   CDS_pept        352009..352566
FT                   /transl_table=11
FT                   /gene="hydN"
FT                   /locus_tag="YPO0343"
FT                   /product="4Fe-4S ferrodoxin"
FT                   /note="Similar to Escherichia coli electron transport
FT                   protein HydN SW:HYDN_ECOLI (P30132) (175 aa) fasta scores:
FT                   E(): 0, 50.0% id in 176 aa"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384LCK6"
FT                   /protein_id="CAL19025.1"
FT                   /translation="MNRFVIADMTQCIGCRTCEIACVVAHSADNKVSTLMPEQFHPRLS
FT                   VMKSFAVSTPILCHQCEDAPCENACPNGAIITGSHGVQLLASRCIGCKTCMLVCPFGAM
FT                   SIIERPADGQQAADSQPVMASGSGRAQAHKCDLCHQRESGPACIEVCPTNALKLVTPGV
FT                   LEALQREKQLRAARGSAPGIAR"
FT   misc_feature    352252..352323
FT                   /note="Pfam match to entry PF00037 fer4, 4Fe-4S binding
FT                   domain, score 32.90, E-value 7.4e-06"
FT                   /inference="protein motif:PF00037"
FT   misc_feature    352273..352308
FT                   /note="PS00198 4Fe-4S ferredoxins, iron-sulfur binding
FT                   region signature."
FT                   /inference="protein motif:ProSite:PS00198"
FT   misc_feature    352411..352428
FT                   /note="PS00190 Cytochrome c family heme-binding site
FT                   signature."
FT                   /inference="protein motif:ProSite:PS00190"
FT   CDS_pept        352589..354736
FT                   /transl_table=11
FT                   /gene="b4079"
FT                   /gene_synonym="fdhF"
FT                   /locus_tag="YPO0344"
FT                   /product="formate dehydrogenase H"
FT                   /EC_number="1.2.1.2"
FT                   /note="Similar to Escherichia coli formate dehydrogenase
FT                   H,FdhF SW:FDHF_ECOLI (P07658) (715 aa) fasta scores: E():
FT                   0,63.4% id in 715 aa. Interestingly, unlike in E. coli and
FT                   Salmonella, the Yersinia fdhF gene lacks the opal UGA
FT                   selenocysteine codon."
FT                   /db_xref="GOA:A0A0H2W329"
FT                   /db_xref="InterPro:IPR006478"
FT                   /db_xref="InterPro:IPR006655"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006657"
FT                   /db_xref="InterPro:IPR006963"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="InterPro:IPR027467"
FT                   /db_xref="InterPro:IPR041924"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2W329"
FT                   /protein_id="CAL19026.1"
FT                   /translation="MKKILTVCPYCGSGCKLNLLVEDGEIVGAEPADGVTNQGALCLKG
FT                   YYGWDFLNDTRLLTPRLTTPLLRRQRGEAFQPVSWEAAIAFITAKLSAIKERHGPDAIM
FT                   MTGSSRGPGNEANYVMQKFARAAIGTNNIDCCARLCHGPSVAGLQQTLGNGAMSNSIGE
FT                   IENTDCILVFGYNAADSHPIVARRILKAKNKGAKLIVCDPRHIETARIADQWLPLKNGA
FT                   NMALVNAFIHVLIEEKLYDANYVRDHTRGFDELKAGVAAYRPEDVEPITGLSAKAVRQA
FT                   MRTYAAAPAATLLWGMGVTQWGQAVDVVKGLSSLALLTGNLGRPNVGVGPVRGQNNVQG
FT                   ACDMGVLPNTFPGYEKVTDSEARARFAHAWGVAELPAHVGYSITDVPHKVAEGKLKAYY
FT                   VFGEDPIQTEPDLAAMRAAFAALDLVVVQDIFMTKTAELADVVLPATSWGEHEGVYTSA
FT                   DRGFQHFNKAIEPKGDVKPDWEIISLISTAMGYPMAYQNTQQIWDEMRGLCPPFAGVTY
FT                   EKLAGLGYVQWPCPTEDHPGTPYLYTDNQFATADGKGLLSCAPWQPPHEQTDSDYPLAL
FT                   CTVREVGHYSCRSMTGNCGTLKILADEPGYVQIHPEDASYLGVIDQALIWISSRRGKVI
FT                   ARASVTERANRGAVYMTYQWWIGACNELTVDHVDPVSKTPEFKHCAVKVEAISDQTAAE
FT                   QYVEQQYSQLKKRLSDAAVVP"
FT   misc_feature    352604..352657
FT                   /note="PS00551 Prokaryotic molybdopterin oxidoreductases
FT                   signature 1."
FT                   /inference="protein motif:ProSite:PS00551"
FT   misc_feature    353858..354046
FT                   /note="Pfam match to entry PF00384
FT                   molybdopterin,Prokaryotic molybdopterin oxidoreductases,
FT                   score 98.80,E-value 2.9e-31"
FT                   /inference="protein motif:PF00384"
FT   misc_feature    353885..353938
FT                   /note="PS00490 Prokaryotic molybdopterin oxidoreductases
FT                   signature 2."
FT                   /inference="protein motif:ProSite:PS00490"
FT   misc_feature    354308..354631
FT                   /note="Pfam match to entry PF01568
FT                   Molydop_binding,Molydopterin dinucleotide binding domain,
FT                   score 97.50,E-value 2.6e-25"
FT                   /inference="protein motif:PF01568"
FT   misc_feature    354536..354568
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:ProSite:PS00013"
FT   CDS_pept        complement(354798..356585)
FT                   /transl_table=11
FT                   /gene="cycZ"
FT                   /gene_synonym="dsbD"
FT                   /locus_tag="YPO0345"
FT                   /product="thiol:disulfide interchange protein"
FT                   /note="Similar to many including: Haemophilus influenzae
FT                   thiol:disulfide interchange protein DsbD SW:DSBD_HAEIN
FT                   (P44919) (579 aa) fasta scores: E(): 0, 47.1% id in 592 aa
FT                   and Pantoea citrea thiol disulfide interchange protein DsbC
FT                   TR:Q9XDB2 (EMBL:AF102175) (578 aa) fasta scores: E():
FT                   0,61.1% id in 594 aa. Note the large overlap with the
FT                   upstream CDS"
FT                   /db_xref="GOA:Q8ZIY9"
FT                   /db_xref="InterPro:IPR003834"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR022910"
FT                   /db_xref="InterPro:IPR028250"
FT                   /db_xref="InterPro:IPR035671"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036929"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZIY9"
FT                   /inference="protein motif:TMHMM:2.0"
FT                   /inference="similar to sequence:INSDC:AF102175"
FT                   /protein_id="CAL19027.1"
FT                   /translation="MAQRFITLILLLCSVLLAPHSAQSSLFGENASFGTKNSQSRFIPV
FT                   DQAFAFDFHQQGDQLNLSWQIHPGYYLYRQQIKIVPQQAALGAFTLPEGITHHDEFYGE
FT                   VEIFKQQLTLKIPITQAAEQASVSVTYQGCAEAGFCYPPETRVIPLDVVVAASTASGTA
FT                   AVNSSATVNPPATTQPEGDATPVPSTLPFSPLWALLIGIGIAFTPCVLPMYPLISAVIL
FT                   GREKPHSQRRILILAVVYVQGMALTYTLLGLVVAAAGLQFQAALQHPYVLIGLSVLFVL
FT                   LALSMFGLYSLQLPSSLQTRLTQWSNSQRGGSLAGVFAMGALAGLICSPCTTAPLSAIL
FT                   LYIAQSGNMLAGGGTLYLYALGMGIPLVVVTLFGNKLIPRSGPWMQYVKEAFGFVILAL
FT                   PVFLLERVLGDVWGLRLWSLLAVAFFGWAFVLSLKAHAGWVRVCQLLLLAALLIVARPL
FT                   QDWAFNGNTQQNAVKHINFQPVANLPQLQAVLAQAQGKPVMLDLYADWCVACKEFEKYT
FT                   FSDDKVQRQLANTLLLQADVTANNAEHATLLKKFNVLGLPTILFFDSQGNEITAARVTG
FT                   FMDAAQFLQHLQNTPAVTK"
FT   misc_feature    complement(355035..355091)
FT                   /note="PS00194 Thioredoxin family active site."
FT                   /inference="protein motif:ProSite:PS00194"
FT   misc_feature    complement(355221..355271)
FT                   /gene="cycZ"
FT                   /gene_synonym="dsbD"
FT                   /locus_tag="YPO0345"
FT                   /note="one of 8 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    complement(355293..355349)
FT                   /gene="cycZ"
FT                   /gene_synonym="dsbD"
FT                   /locus_tag="YPO0345"
FT                   /note="one of 8 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    complement(355362..355412)
FT                   /gene="cycZ"
FT                   /gene_synonym="dsbD"
FT                   /locus_tag="YPO0345"
FT                   /note="one of 8 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    complement(355452..355517)
FT                   /gene="cycZ"
FT                   /gene_synonym="dsbD"
FT                   /locus_tag="YPO0345"
FT                   /note="one of 8 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    complement(355578..355643)
FT                   /gene="cycZ"
FT                   /gene_synonym="dsbD"
FT                   /locus_tag="YPO0345"
FT                   /note="one of 8 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    complement(355707..355772)
FT                   /gene="cycZ"
FT                   /gene_synonym="dsbD"
FT                   /locus_tag="YPO0345"
FT                   /note="one of 8 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    complement(355818..355883)
FT                   /gene="cycZ"
FT                   /gene_synonym="dsbD"
FT                   /locus_tag="YPO0345"
FT                   /note="one of 8 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    complement(355920..355985)
FT                   /gene="cycZ"
FT                   /gene_synonym="dsbD"
FT                   /locus_tag="YPO0345"
FT                   /note="one of 8 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        complement(356561..356920)
FT                   /transl_table=11
FT                   /locus_tag="YPO0346"
FT                   /product="putative cation tolerance protein"
FT                   /note="Similar to Escherichia coli periplasmic divalent
FT                   cation tolerance protein, CutA SW:CUTA_ECOLI (P36654) (112
FT                   aa) fasta scores: E(): 0, 73.2% id in 112 aa"
FT                   /db_xref="GOA:Q74XD3"
FT                   /db_xref="InterPro:IPR004323"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="InterPro:IPR023700"
FT                   /db_xref="PDB:3GSD"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q74XD3"
FT                   /protein_id="CAL19028.1"
FT                   /translation="MSDSDAMTDPNAVSYSNAIVVLCTAPDEASAQNLAAQVLGEKLAA
FT                   CVTLLPGATSLYYWEGKLEQEYEVQLLFKSNTDHQQALLTYIKQHHPYQTPELLVLPVR
FT                   DGDKDYLSWLNASLL"
FT   CDS_pept        complement(357105..358406)
FT                   /transl_table=11
FT                   /gene="b4138"
FT                   /gene_synonym="dcuA"
FT                   /gene_synonym="genA"
FT                   /locus_tag="YPO0347"
FT                   /product="anaerobic C4-dicarboxylate transporter"
FT                   /note="Similar to Escherichia coli anaerobic
FT                   C4-dicarboxylate transporter DcuA SW:DCUA_ECOLI (P04539)
FT                   (433 aa) fasta scores: E(): 0, 85.0% id in 433 aa"
FT                   /db_xref="GOA:A0A384L434"
FT                   /db_xref="InterPro:IPR004668"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384L434"
FT                   /inference="protein motif:TMHMM:2.0"
FT                   /protein_id="CAL19029.1"
FT                   /translation="MIAVELVIVLLAIFLGARLGGIGIGFAGGIGVLVLAIIGVKPGSI
FT                   PFDVISIIMAVIAAISAMQVAGGMDYLVQQTEKLLRKNPKHITILAPLVTYFLTIFAGT
FT                   GNISLSALPVIAEVAKEQGIKPCRPLSTAVVSAQIAITASPISAAVVYMSSVMEGQGVS
FT                   YLHLLMIVIPSTLCAVFVMSLIVSWCFSSKLSDDPIYLKRLEEGLVTLRGDTVKVIKPR
FT                   AKTSVLLFLAGVLCVVAYAIINSPSVGLVETPLMNTTNAILIIMLSVATITTLVCSVDT
FT                   DSILNSSTFKAGMSACICILGVAWLGDTFVQHNLEWIKETAGSLIQAHSWLLAVIFFFC
FT                   SALLYSQAATAKALMPMALALNVSPLAAIASFAAVSGLFILPTYPTLVAAVQMDDTGTT
FT                   RIGRFVFNHPFFIPGTIGVALAVCFGFVMGGLVL"
FT   misc_feature    complement(357111..357176)
FT                   /gene="b4138"
FT                   /gene_synonym="dcuA"
FT                   /gene_synonym="genA"
FT                   /locus_tag="YPO0347"
FT                   /note="one of 11 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    complement(357267..357332)
FT                   /gene="b4138"
FT                   /gene_synonym="dcuA"
FT                   /gene_synonym="genA"
FT                   /locus_tag="YPO0347"
FT                   /note="one of 11 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    complement(357372..357428)
FT                   /gene="b4138"
FT                   /gene_synonym="dcuA"
FT                   /gene_synonym="genA"
FT                   /locus_tag="YPO0347"
FT                   /note="one of 11 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    complement(357489..357554)
FT                   /gene="b4138"
FT                   /gene_synonym="dcuA"
FT                   /gene_synonym="genA"
FT                   /locus_tag="YPO0347"
FT                   /note="one of 11 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    complement(357576..357632)
FT                   /gene="b4138"
FT                   /gene_synonym="dcuA"
FT                   /gene_synonym="genA"
FT                   /locus_tag="YPO0347"
FT                   /note="one of 11 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    complement(357678..357728)
FT                   /gene="b4138"
FT                   /gene_synonym="dcuA"
FT                   /gene_synonym="genA"
FT                   /locus_tag="YPO0347"
FT                   /note="one of 11 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    complement(357840..357905)
FT                   /gene="b4138"
FT                   /gene_synonym="dcuA"
FT                   /gene_synonym="genA"
FT                   /locus_tag="YPO0347"
FT                   /note="one of 11 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    complement(357951..358016)
FT                   /gene="b4138"
FT                   /gene_synonym="dcuA"
FT                   /gene_synonym="genA"
FT                   /locus_tag="YPO0347"
FT                   /note="one of 11 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    complement(358080..358145)
FT                   /gene="b4138"
FT                   /gene_synonym="dcuA"
FT                   /gene_synonym="genA"
FT                   /locus_tag="YPO0347"
FT                   /note="one of 11 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    complement(358191..358256)
FT                   /gene="b4138"
FT                   /gene_synonym="dcuA"
FT                   /gene_synonym="genA"
FT                   /locus_tag="YPO0347"
FT                   /note="one of 11 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    complement(358296..358361)
FT                   /gene="b4138"
FT                   /gene_synonym="dcuA"
FT                   /gene_synonym="genA"
FT                   /locus_tag="YPO0347"
FT                   /note="one of 11 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        complement(358526..359962)
FT                   /transl_table=11
FT                   /gene="aspA"
FT                   /locus_tag="YPO0348"
FT                   /product="aspartate ammonia-lyase"
FT                   /EC_number="4.3.1.1"
FT                   /note="Similar to Escherichia coli aspartate ammonia-lyase
FT                   AspA SW:ASPA_ECOLI (P04422) (478 aa) fasta scores: E():
FT                   0,89.3% id in 478 aa"
FT                   /db_xref="GOA:Q0WJW2"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR004708"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR018951"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="UniProtKB/TrEMBL:Q0WJW2"
FT                   /protein_id="CAL19030.1"
FT                   /translation="MSNNIRIEEDLLGTREVPAEAYYGVHTLRAIENFYISNSKISDVP
FT                   EFVRGMVMVKKAAAMANKELHTIPRKIADIIIQACDEVLDKGKCMDQFPVDVFQGGAGT
FT                   SLNMNTNEVLANIGLELMGHQKGEYQYLNPNDHLNKCQSTNDAYPTGFRIAVYASILKL
FT                   IDAINQLGEGFGRKSKEFEKILKMGRTQLQDAVPMTLGQEFRAFQVLLNEETKNLQRTA
FT                   ELLLEVNLGATAIGTALNTPEGYSQLAVQKLAEISGLACVPAEDLIEATSDCGAYVMVH
FT                   SALKRLAVKMSKICNDLRLLSSGPRTGLNEINLPELQAGSSIMPAKVNPVIPEVVNQVC
FT                   FKVIGNDTCITMAAEAGQLQLNLMEPVIGQAMFESIHILTNACYNLLEKCINGITANKE
FT                   VCERYVFNSIGIVTYLNPFIGHHNGDIVGKICAETGKNVREVVLERGLLTEAELDDIFS
FT                   VENLMHPAYKAKRYTDENEQ"
FT   misc_feature    complement(358583..359926)
FT                   /note="Pfam match to entry PF00206 lyase_1, Lyase, score
FT                   685.70, E-value 2.2e-202"
FT                   /inference="protein motif:PF00206"
FT   misc_feature    complement(358976..359005)
FT                   /note="PS00163 Fumarate lyases signature."
FT                   /inference="protein motif:ProSite:PS00163"
FT   CDS_pept        360410..360988
FT                   /transl_table=11
FT                   /locus_tag="YPO0349"
FT                   /product="putative membrane protein"
FT                   /note="Highly similar to Escherichia coli FxsA protein that
FT                   suppresses F exclusion of bacteriophage T7 SW:FXSA_ECOLI
FT                   (P37147) (158 aa) fasta scores: E(): 1.5e-29, 61.9% id in
FT                   176 aa"
FT                   /db_xref="GOA:A0A384L2K1"
FT                   /db_xref="InterPro:IPR007313"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384L2K1"
FT                   /inference="protein motif:TMHMM:2.0"
FT                   /protein_id="CAL19031.1"
FT                   /translation="MRWLPFALIFLLAYIEISIFIKVAAVLGVPITLLLVIISSCVGIS
FT                   LVRNQGIKTFIQMQQKLAAGESPAAEMIKSVSLVLAGILLLIPGFFTDFLGLLLLLPWV
FT                   QKTLTLKLMPHLNIYRGGSFGGAGFGNGGFGNDSFGNRHGSGPMSGGDTFDGEFQRKDD
FT                   DRFTVEHRPDKNEQVANSRSNDDSFKDDK"
FT   misc_feature    360413..360472
FT                   /locus_tag="YPO0349"
FT                   /note="one of 3 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    360482..360550
FT                   /locus_tag="YPO0349"
FT                   /note="one of 3 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    360653..360721
FT                   /locus_tag="YPO0349"
FT                   /note="one of 3 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        361243..361536
FT                   /transl_table=11
FT                   /gene="crpB"
FT                   /gene_synonym="groES"
FT                   /gene_synonym="hsp10"
FT                   /locus_tag="YPO0350"
FT                   /product="10 kDa chaperonin"
FT                   /note="Similar to Yersinia enterocolitica 10 kDa
FT                   chaperonin, GroES SW:CH10_YEREN (P48228) (97 aa) fasta
FT                   scores: E(): 3.1e-32, 95.9% id in 97 aa"
FT                   /db_xref="GOA:Q8ZIY4"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR018369"
FT                   /db_xref="InterPro:IPR020818"
FT                   /db_xref="InterPro:IPR037124"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZIY4"
FT                   /protein_id="CAL19032.1"
FT                   /translation="MKIRPLHDRVIVKRKEVESKSAGGIVLTGTAAGKSTRGEVLAVGN
FT                   GRILDNGEIKPLDVKVGDVVIFNDGYGVKAEKIDNEEVLIMSESDILAIVEA"
FT   misc_feature    361243..361530
FT                   /note="Pfam match to entry PF00166 cpn10, Chaperonins 10 Kd
FT                   subunit, score 187.90, E-value 1.7e-52"
FT                   /inference="protein motif:PF00166"
FT   misc_feature    361249..361323
FT                   /note="PS00681 Chaperonins cpn10 signature."
FT                   /inference="protein motif:ProSite:PS00681"
FT   CDS_pept        361583..363229
FT                   /transl_table=11
FT                   /gene="crpA"
FT                   /gene_synonym="groEL"
FT                   /gene_synonym="hsp60"
FT                   /gene_synonym="mopA"
FT                   /locus_tag="YPO0351"
FT                   /product="60 kDa chaperonin"
FT                   /note="Similar to Yersinia enterocolitica 60 kDa chaperonin
FT                   GroEL SW:CH60_YEREN (P48219) (550 aa) fasta scores: E():
FT                   0,98.4% id in 550 aa"
FT                   /db_xref="GOA:Q8ZIY3"
FT                   /db_xref="InterPro:IPR001844"
FT                   /db_xref="InterPro:IPR002423"
FT                   /db_xref="InterPro:IPR018370"
FT                   /db_xref="InterPro:IPR027409"
FT                   /db_xref="InterPro:IPR027410"
FT                   /db_xref="InterPro:IPR027413"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZIY3"
FT                   /protein_id="CAL19033.1"
FT                   /translation="MAAKDVKFGNDARIKMLRGVNILADAVKVTLGPKGRNVVLDKSFG
FT                   SPTITKDGVSVAREIELEDKFENMGAQMVKEVASKANDAAGDGTTTATVLAQSIITEGL
FT                   KAVAAGMNPMDLKRGIDKAVIAAVEELKKLSVPCSDSKAIAQVGTISANSDSTVGELIA
FT                   QAMEKVGKEGVITVEEGSGLQDELDVVEGMQFDRGYLSPYFINKPETGSIELESPFILL
FT                   ADKKISNIREMLPVLEAVAKAGKPLLIIAEDVEGEALATLVVNTMRGIVKVAAVKAPGF
FT                   GDRRKAMLQDIATLTAGTVISEEIGLELEKTTLEDLGQAKRVVINKDTTIIIDGVGDEA
FT                   AIQGRVAQIRQQIEDATSDYDKEKLQERVAKLAGGVAVIKVGAATEVEMKEKKARVEDA
FT                   LHATRAAVEEGVVAGGGVALIRAAHAIAGLKGDNEDQNVGIKVALRAMESPLRQIVVNA
FT                   GEEASVIANKVKAGEGSFGYNAYTEEYGDMIAMGILDPTKVTRSALQYAASIAGLMITT
FT                   ECMVTDLPRDDKGADMGAGGMGGMGGMGGMM"
FT   misc_feature    361649..363157
FT                   /note="Pfam match to entry PF00118 cpn60_TCP1, TCP-1/cpn60
FT                   chaperonin family, score 867.20, E-value 5.1e-257"
FT                   /inference="protein motif:PF00118"
FT   misc_feature    362795..362830
FT                   /note="PS00296 Chaperonins cpn60 signature."
FT                   /inference="protein motif:ProSite:PS00296"
FT   CDS_pept        363865..364251
FT                   /transl_table=11
FT                   /locus_tag="YPO0352"
FT                   /product="putative lipoprotein"
FT                   /note="Similar to Escherichia coli hypothetical 13.1 kDa
FT                   protein in mopA-efp intergenic region precursor YjeI
FT                   SW:YJEI_ECOLI (P39278) (128 aa) fasta scores: E():
FT                   1.6e-27,61.9% id in 126 aa"
FT                   /db_xref="InterPro:IPR025294"
FT                   /db_xref="UniProtKB/TrEMBL:Q0WJV8"
FT                   /protein_id="CAL19034.1"
FT                   /translation="MLLRSHILLKSNVLLKIKTLLGLSAVLVLAGCSSSNTLSSAGEQV
FT                   KFSDTQPGSECQLVGQVTGTQSNWLSGQGGESSSMRGAANDLRNKAAAMGGNVIYGATS
FT                   PSETFLSSFAPLESKMVGQVYKCP"
FT   misc_feature    363928..363960
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:ProSite:PS00013"
FT   CDS_pept        complement(364536..365564)
FT                   /transl_table=11
FT                   /locus_tag="YPO0353"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to many proteins of undefined function e.g.
FT                   Escherichia coli hypothetical protein YjeK SW:YJEK_ECOLI
FT                   (P39280) (342 aa) fasta scores: E(): 0, 71.3% id in 341 aa.
FT                   Also similar to several L-lysine 2,3-aminomutases e.g. from
FT                   Clostridium subterminale KamA TR:Q9XBQ8 (EMBL:AF159146)
FT                   (416 aa) fasta scores: E(): 0, 34.6% id in 324 aa"
FT                   /db_xref="GOA:A0A384KUJ5"
FT                   /db_xref="InterPro:IPR003739"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR022462"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384KUJ5"
FT                   /inference="similar to sequence:INSDC:AF159146"
FT                   /protein_id="CAL19035.1"
FT                   /translation="MASIVTRNMPIREDWLQQLADVITDPDELLRILFLNEHPHLQQGS
FT                   GARRLFPLRVPRAFVARMQPGNASDPLLLQVLTAREEFITAPGFTHDPLDEQRSVVPGL
FT                   LHKYRNRALLLVKGGCAVNCRYCFRRHFPYQDNQGNKANWLQALDYIRQHPELDEIIFS
FT                   GGDPLMAKDHELSWLLDQLEDIKHIRRLRIHTRLPVVIPARITATLCQRLGSSRLQVLM
FT                   VTHINHANEIDPPLRDSMARLKQAGVTLLNQSVLLRGVNNDADVLATLSNALFDAGILP
FT                   YYIHVLDKVQGAAHFMVDDDEARQLMKGLLSRVSGYLVPRLTREVGGEPSKTPLDLRLT
FT                   QN"
FT   CDS_pept        365600..366166
FT                   /transl_table=11
FT                   /gene="b4147"
FT                   /gene_synonym="efp"
FT                   /locus_tag="YPO0354"
FT                   /product="elongation factor P"
FT                   /note="Similar to Escherichia coli elongation factor P EF-P
FT                   SW:EFP_ECOLI (P33398) (187 aa) fasta scores: E(): 0, 90.9%
FT                   id in 187 aa"
FT                   /db_xref="GOA:Q8ZIY0"
FT                   /db_xref="InterPro:IPR001059"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR011768"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013185"
FT                   /db_xref="InterPro:IPR013852"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR015365"
FT                   /db_xref="InterPro:IPR020599"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZIY0"
FT                   /protein_id="CAL19036.1"
FT                   /translation="MASYYSNDFRPGLKIMFEGEPYAVESSEFVKPGKGQAFARVKMRR
FT                   LLTGGRVEKTFKSTDSLEGADVNDMNLTYLYNDGEFWHFMNNETYEQLQADAKAVGDNG
FT                   KWLIDQAECIVTLWNGQPIAVTPPNFVELEIVDTDPGLKGDTAGTGGKPATLSTGAVVK
FT                   VPLFVQVGEIIKVDTRSGEYVSRVK"
FT   misc_feature    365606..366160
FT                   /note="Pfam match to entry PF01132 EFP, Elongation factor P
FT                   (EF-P), score 398.20, E-value 8e-116"
FT                   /inference="protein motif:PF01132"
FT   misc_feature    366053..366112
FT                   /note="PS01275 Elongation factor P signature."
FT                   /inference="protein motif:ProSite:PS01275"
FT   CDS_pept        366413..366727
FT                   /transl_table=11
FT                   /gene="sugE"
FT                   /locus_tag="YPO0355"
FT                   /product="putative chaperone"
FT                   /note="Similar to Citrobacter freundii SugE protein, a
FT                   supressor of groEL SW:SUGE_CITFR (O69279) (105 aa) fasta
FT                   scores: E(): 6e-27, 75.0% id in 104 aa and to Escherichia
FT                   coli protein SugE SW:SUGE_ECOLI (P30743) (105 aa) fasta
FT                   scores: E(): 4.7e-26, 76.0% id in 104 aa"
FT                   /db_xref="GOA:Q8D1E4"
FT                   /db_xref="InterPro:IPR000390"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8D1E4"
FT                   /inference="protein motif:TMHMM:2.0"
FT                   /protein_id="CAL19037.1"
FT                   /translation="MAWIILVIAGLLEVIWAIGLKYSHGFSRLTPSIITLVAMAASVFL
FT                   LAYAMKSLPAGTAYAVWTGIGAVGTAILGIVLLGESASLARILSLGLILAGIIGLKLAS
FT                   "
FT   misc_feature    366413..366691
FT                   /note="Pfam match to entry PF00893 DUF7, Integral membrane
FT                   protein DUF7, score 170.50, E-value 2.8e-47"
FT                   /inference="protein motif:PF00893"
FT   misc_feature    366413..366472
FT                   /gene="sugE"
FT                   /locus_tag="YPO0355"
FT                   /note="one of 4 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    366509..366562
FT                   /gene="sugE"
FT                   /locus_tag="YPO0355"
FT                   /note="one of 4 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    366575..366643
FT                   /gene="sugE"
FT                   /locus_tag="YPO0355"
FT                   /note="one of 4 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    366662..366721
FT                   /gene="sugE"
FT                   /locus_tag="YPO0355"
FT                   /note="one of 4 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   repeat_region   complement(366838..367549)
FT                   /note="Contains a 'G' at nucleotide position 315"
FT                   /note="IS200-like insertion sequence:IS1541"
FT   CDS_pept        complement(366946..367404)
FT                   /transl_table=11
FT                   /gene="tnp"
FT                   /locus_tag="YPO0356"
FT                   /product="transposase for the IS1541 insertion element"
FT                   /note="Similar to Salmonella typhimurium, and Salmonella
FT                   typhi transposase for insertion sequence IS200 TnpA
FT                   SW:T200_SALTY (Q57334) (152 aa) fasta scores: E(): 0, 94.1%
FT                   id in 152 aa. Identical to the Yersinia pseudotuberculosis
FT                   IS1541 element transposase Tnp TR:Q9X9F5 (EMBL:AJ238014)
FT                   (152 aa) fasta scores: E(): 0, 100.0% id in 152 aa"
FT                   /db_xref="GOA:Q74YM6"
FT                   /db_xref="InterPro:IPR002686"
FT                   /db_xref="InterPro:IPR036515"
FT                   /db_xref="UniProtKB/TrEMBL:Q74YM6"
FT                   /inference="similar to sequence:INSDC:AJ238014"
FT                   /protein_id="CAL19038.1"
FT                   /translation="MRDEKSLAHTRWNCKYHIVFAPKYRRQVFYREKRRAIGSILRKLC
FT                   EWKNVNILEAECCVDHIHMLLEIPPKMSVSGFMGYLKGKSSLMLYEQFGDLKFKYRNRE
FT                   FWCRGYYVDTVGKNTARIQEYIKHQLEEDKMGEQLSIPYPGSPFTGRK"
FT   misc_feature    complement(367039..367350)
FT                   /note="Pfam match to entry PF01797
FT                   Transposase_17,Transposase IS200 like, score 236.10,
FT                   E-value 5.1e-67"
FT                   /inference="protein motif:PF01797"
FT   CDS_pept        complement(367602..367958)
FT                   /transl_table=11
FT                   /gene="b4151"
FT                   /gene_synonym="frdD"
FT                   /locus_tag="YPO0357"
FT                   /product="fumarate reductase hydrophobic protein"
FT                   /note="Similar to Escherichia coli fumarate reductase
FT                   hydrophobic protein FrdD SW:FRDD_ECOLI (P03806) (119 aa)
FT                   fasta scores: E(): 0, 85.6% id in 118 aa"
FT                   /db_xref="GOA:Q8ZIX8"
FT                   /db_xref="InterPro:IPR003418"
FT                   /db_xref="InterPro:IPR034804"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZIX8"
FT                   /inference="protein motif:TMHMM:2.0"
FT                   /protein_id="CAL19039.1"
FT                   /translation="MNQVPKRSDEPIFWGLFGAGGMWGAIIAPVIILLVAILLPLGAFP
FT                   GDALSYERILAFCQSFIGRVFLLLMIILPLWCGLHRIHHAMHDLKIHVPAGKWVFYGLA
FT                   AILSVVTFIGVLTL"
FT   misc_feature    complement(367605..367943)
FT                   /note="Pfam match to entry PF02313 Fumarate_red_D, , score
FT                   270.30, E-value 2.5e-77"
FT                   /inference="protein motif:PF02313"
FT   misc_feature    complement(367608..367664)
FT                   /gene="b4151"
FT                   /gene_synonym="frdD"
FT                   /locus_tag="YPO0357"
FT                   /note="one of 3 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    complement(367728..367793)
FT                   /gene="b4151"
FT                   /gene_synonym="frdD"
FT                   /locus_tag="YPO0357"
FT                   /note="one of 3 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    complement(367854..367919)
FT                   /gene="b4151"
FT                   /gene_synonym="frdD"
FT                   /locus_tag="YPO0357"
FT                   /note="one of 3 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        complement(367975..368367)
FT                   /transl_table=11
FT                   /gene="b4152"
FT                   /gene_synonym="frdC"
FT                   /locus_tag="YPO0358"
FT                   /product="fumarate reductase hydrophobic protein"
FT                   /note="Similar to Escherichia coli fumarate reductase
FT                   hydrophobic protein FrdC SW:FRDC_ECOLI (P03805) (131 aa)
FT                   fasta scores: E(): 0, 72.1% id in 129 aa"
FT                   /db_xref="GOA:Q8ZIX7"
FT                   /db_xref="InterPro:IPR003510"
FT                   /db_xref="InterPro:IPR034804"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZIX7"
FT                   /inference="protein motif:TMHMM:2.0"
FT                   /protein_id="CAL19040.1"
FT                   /translation="MTTKRKAYVRTMAPNWWQQLGFYRFYMLREGTSIPAVWFSVLLIY
FT                   GVFALKSGPAGWEGFVSFLQNPLVLFLNILTLFAALLHTKTWFELAPKAVNIIVKSEKM
FT                   GPEPMIKALWVVTVVASAIILAVALL"
FT   misc_feature    complement(367981..368346)
FT                   /note="Pfam match to entry PF02300 Fumarate_red_C, Fumarate
FT                   reductase subunit C, score 259.10, E-value 6.1e-74"
FT                   /inference="protein motif:PF02300"
FT   misc_feature    complement(367981..368031)
FT                   /gene="b4152"
FT                   /gene_synonym="frdC"
FT                   /locus_tag="YPO0358"
FT                   /note="one of 3 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    complement(368122..368187)
FT                   /gene="b4152"
FT                   /gene_synonym="frdC"
FT                   /locus_tag="YPO0358"
FT                   /note="one of 3 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    complement(368218..368274)
FT                   /gene="b4152"
FT                   /gene_synonym="frdC"
FT                   /locus_tag="YPO0358"
FT                   /note="one of 3 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        complement(368384..369118)
FT                   /transl_table=11
FT                   /gene="b4153"
FT                   /gene_synonym="frdB"
FT                   /locus_tag="YPO0359"
FT                   /product="fumarate reductase iron-sulfur protein"
FT                   /EC_number="1.3.99.1"
FT                   /note="Similar to Escherichia coli fumarate reductase
FT                   iron-sulfur protein FrdB SW:FRDB_ECOLI (P00364) (243 aa)
FT                   fasta scores: E(): 0, 85.5% id in 242 aa"
FT                   /db_xref="GOA:A0A384LAG3"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR004489"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR025192"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384LAG3"
FT                   /protein_id="CAL19041.1"
FT                   /translation="MTDMKVLKMEVMRYNPERDSEPHFETFEVPYDEQTSLLDALGYIK
FT                   DNLAPDLSYRWSCRMAICGSCGMMVNKVPKLACKTFLREYTAGMKVEALGNFPIERDLV
FT                   VDMTHFIESLEAIKPYIIGNERLPKDGPNKQTPAQMAKYHQFSGCINCGLCYAACPQFG
FT                   LNPEFIGPAAITLAHRYNLDNRDHGKKERMPQLNGKNGVWSCTFVGYCSEVCPKHVDPA
FT                   AAIQQGKIDSAKDFMIAMLKPQ"
FT   misc_feature    complement(368624..368695)
FT                   /note="Pfam match to entry PF00037 fer4, 4Fe-4S binding
FT                   domain, score 16.60, E-value 0.0069"
FT                   /inference="protein motif:PF00037"
FT   misc_feature    complement(368639..368674)
FT                   /note="PS00198 4Fe-4S ferredoxins, iron-sulfur binding
FT                   region signature."
FT                   /inference="protein motif:ProSite:PS00198"
FT   misc_feature    complement(368867..369061)
FT                   /note="Pfam match to entry PF00111 fer2, 2Fe-2S iron-sulfur
FT                   cluster binding domains, score 26.90, E-value 0.00047"
FT                   /inference="protein motif:PF00111"
FT   misc_feature    complement(368921..368947)
FT                   /note="PS00197 2Fe-2S ferredoxins, iron-sulfur binding
FT                   region signature."
FT                   /inference="protein motif:ProSite:PS00197"
FT   CDS_pept        complement(369111..370934)
FT                   /transl_table=11
FT                   /gene="b4154"
FT                   /gene_synonym="frdA"
FT                   /locus_tag="YPO0360"
FT                   /product="fumarate reductase flavoprotein subunit"
FT                   /EC_number="1.3.99.1"
FT                   /note="Similar to Escherichia coli fumarate reductase
FT                   flavoprotein subunit FrdA SW:FRDA_ECOLI (P00363) (601 aa)
FT                   fasta scores: E(): 0, 85.3% id in 605 aa"
FT                   /db_xref="GOA:A0A384KTG5"
FT                   /db_xref="InterPro:IPR003952"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR005884"
FT                   /db_xref="InterPro:IPR014006"
FT                   /db_xref="InterPro:IPR015939"
FT                   /db_xref="InterPro:IPR027477"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR037099"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384KTG5"
FT                   /protein_id="CAL19042.1"
FT                   /translation="MQTFNADLAIIGAGGAGLRAAIAAAEANPQLKIALISKVYPMRSH
FT                   TVAAEGGSAAVTQDHDTFDYHFHDTVAGGDWLCEQDVVDHFVHSCPEEMAQLEIWGCPW
FT                   SRKEDGSVNVRRFGGMKIERTWFAADKTGFHMLHTLFQTSLKYPQIQRFDEHFVLDILV
FT                   DEGQARGVVAMNMMEGTRVQIRANAVIMATGGAGRVYRYNTNGGIVTGDGMGMAFHHGV
FT                   PLRDMEFVQYHPTGLPGSGILMTEGCRGEGGILVNKDGYRYLQDYGMGPETPLGEPKNK
FT                   YMELGPRDKVSQAFWHEWRAGRTVATPRGDVVYLDLRHLGEKKLLERLPFICELAKAYV
FT                   GVDPVKEPIPVRPTAHYTMGGIETNPQCETRIKGLFAVGECSSVGLHGANRLGSNSLAE
FT                   LVVFGRVAGEQAALRAMESGPANGSALDAQTRDVETRLSNLMKQEGTENWSKIRDEMGL
FT                   SMEEGCGIYRTPELMQKTVDKLAELKERFKRVKITDHSSVFNTDLLYTIELGYGLDVAE
FT                   CMAHSALNRKESRGAHQRLDEGCTERDDVNFLKHTLAFHTPGGAPRIEYSDVKITKLVP
FT                   AKRVYGGEATAQDAKDAKDAQDLKDKEQAND"
FT   misc_feature    complement(369636..370619)
FT                   /note="Pfam match to entry PF00890 FAD_binding_2, FAD
FT                   binding domain, score 682.80, E-value 1.7e-201"
FT                   /inference="protein motif:PF00890"
FT   misc_feature    complement(370779..370808)
FT                   /note="PS00504 Fumarate reductase / succinate dehydrogenase
FT                   FAD-binding site."
FT                   /inference="protein motif:ProSite:PS00504"
FT   CDS_pept        371041..371232
FT                   /transl_table=11
FT                   /locus_tag="YPO0361"
FT                   /product="putative membrane protein"
FT                   /note="Doubtful CDS with no significant database hits. Note
FT                   the low G+C content (29%)"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384KQM6"
FT                   /protein_id="CAL19043.1"
FT                   /translation="MSHYSLGILNIIIPLTYFSAVNLMILRIAISYFLYGIIILNDKSQ
FT                   KFDVIDCFVLFEPPQMHY"
FT   misc_feature    371083..371151
FT                   /note="1 probable transmembrane helix predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        371392..372369
FT                   /transl_table=11
FT                   /gene="b4155"
FT                   /gene_synonym="genX"
FT                   /gene_synonym="poxA"
FT                   /locus_tag="YPO0362"
FT                   /product="putative lysyl-tRNA synthetase"
FT                   /EC_number="6.1.1.6"
FT                   /note="Similar to lysyl-tRNA synthetases from Escherichia
FT                   coli putative PoxA SW:SYK3_ECOLI (P03812) (325 aa) fasta
FT                   scores: E(): 0, 84.0% id in 325 aa and to Vibrio cholerae
FT                   vc2655 TR:Q9KNS6 (EMBL:AE004331) (349 aa) fasta scores:
FT                   E(): 0, 63.4% id in 317 aa"
FT                   /db_xref="GOA:Q8ZIX3"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004525"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR018149"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZIX3"
FT                   /inference="similar to sequence:INSDC:AE004331"
FT                   /protein_id="CAL19044.1"
FT                   /translation="MSDTASWQPSAPIANLLKRAAIMAEIRRFFADRGVLEVETPTMSQ
FT                   ATVTDIHLVPFETRFVGPGAADGLTLYMMTSPEYHMKRLLAAGSGPIYQLGRSFRNEEA
FT                   GRYHNPEFTMLEWYRPHYDMYRLMNEVDDLLQQILDCNSAETLSYQQAFLRHLNIDPLS
FT                   AEKAQLREVAAKLDLSNIADTEEDRDTLLQLLFTVGVEPYIGRDKPAFIYHFPASQASL
FT                   AEISTEDHRVAERFEVYFKGIELANGFRELTDGDEQLQRFEQDNRNRAKRGLPQNPIDM
FT                   NLIAALKQGLPDCSGVALGVDRLVMLALNAERLSDVIAFPVNIA"
FT   misc_feature    371392..372366
FT                   /note="Pfam match to entry PF00152 tRNA-synt_2, tRNA
FT                   synthetases class II (D, K and N), score 436.20, E-value
FT                   2.8e-127"
FT                   /inference="protein motif:PF00152"
FT   misc_feature    371686..371739
FT                   /note="PS00179 Aminoacyl-transfer RNA synthetases class-II
FT                   signature 1."
FT                   /inference="protein motif:ProSite:PS00179"
FT   misc_feature    372283..372312
FT                   /note="PS00339 Aminoacyl-transfer RNA synthetases class-II
FT                   signature 2."
FT                   /inference="protein motif:ProSite:PS00339"
FT   CDS_pept        complement(372490..375849)
FT                   /transl_table=11
FT                   /locus_tag="YPO0363"
FT                   /product="putative membrane transport protein"
FT                   /note="Similar to Escherichia coli potassium efflux system
FT                   protein, KefA SW:KEFA_ECOLI (P77338) (1120 aa) fasta
FT                   scores: E(): 0, 29.1% id in 1100 aa. Also similar to
FT                   several proteins of undefined function e.g. Escherichia
FT                   coli hypothetical 123.8 kDa protein in genX-psd intergenic
FT                   region precursor YjeP SW:YJEP_ECOLI (P39285) (1107 aa)
FT                   fasta scores: E(): 0, 68.1% id in 1105 aa"
FT                   /db_xref="GOA:Q0WJU7"
FT                   /db_xref="InterPro:IPR006685"
FT                   /db_xref="InterPro:IPR006686"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR011014"
FT                   /db_xref="InterPro:IPR011066"
FT                   /db_xref="InterPro:IPR023408"
FT                   /db_xref="InterPro:IPR024393"
FT                   /db_xref="InterPro:IPR025692"
FT                   /db_xref="UniProtKB/TrEMBL:Q0WJU7"
FT                   /inference="protein motif:TMHMM:2.0"
FT                   /protein_id="CAL19045.1"
FT                   /translation="MLRSSYVRPIISWSFGLLLSFFLLMPLHAATQPNEEQVRQELKLA
FT                   ESNKTTPNQAEIVQALQGALSWLADAKESDIRAQQYQKAIDDFPKLTRELRQQLAQEGD
FT                   KPLPVPSNLSTSDLEQQVLQVSSQLLELNRLSQQEQDRAREISESLGQLPQQQSEARRM
FT                   LAEIGPRIQSQSNPSTPVAQAQLTLLQAEAVARKAKVNELELSQLSANNRQELSRLQVE
FT                   LYKKREARVQAQLQSLRNNLNNQRQQAAEQALERTELLAEQGGDLPESITQQLQRNREL
FT                   SQALNQQVQRIDLISSQQRQAVAQTQQVRQALNTIREQAQWLGVSTALGETLRAQVARL
FT                   PEMPKSQQLDRDMAQLRVQRLQYEDMLEKLQQQKTTLKQDDGTPLTPDQQRILDAQWRT
FT                   QSELLNSLLSGYDTQILELTKLKVANSQLVDALNGVREATHRYLFWVADVSPISLSYPL
FT                   AVAQDLTRLLSLDTLSQLSGAFVMMMTNQETLLPIIAALLFVGFSVSSRRHYHAFLERA
FT                   SSRVGKVTQDHFSLTLRTVFWSILMALPLPVLWAALGYGLQNAWSYPMAIAIGNAVTAT
FT                   VPVLWVFMISASFAHPHGLFITHFRWSPTQVARAMRFYRLSVWLIVPLMMALITFENYN
FT                   DREFAGTLGRLCFILLCIALSLVTNSLKRAGIPLYLDKKGSGENMINVALWGLLLSAPL
FT                   IAALASALGYLTTSQALLARLETSVAIWFFLLVVYHIIRHWMLIQRRRIAFDRAKQRRA
FT                   DILAQRARGEEDSPHSNSTEGSIDVEEPIIDLDVISAQSLRLVRSILTMIALVSVIVLW
FT                   SEIHSAFGFLENIRLWDVSSTINGIESVQPITMGSLLIAVLVLIITAQLVRNLPALLEL
FT                   ALLQHLDLTPGTGYAISTITKYLVILFGGLLGFSLLGIEWAKFQWLVAALGLGLGFGLQ
FT                   EIFANFVSGLIILFEKPIRIGDTVTIRDLTGSVTKINTRATTISDWDRKEIIVPNKAFI
FT                   TEQFINWSLSDSITRVVLTVPAPAETSSEEVTNVLMTAAQRCTLVLDTPPPEVYLVDLQ
FT                   QGIQIFELRIYAAEMGHRMPLRHEIHQLILAGYREHGITLPFPPFQARLETLGRGTGRT
FT                   ISSGRSRTPGSL"
FT   misc_feature    complement(372583..373188)
FT                   /note="Pfam match to entry PF00924 UPF0003, Uncharacterized
FT                   protein family UPF0003, score 248.80, E-value 7.3e-71"
FT                   /inference="protein motif:PF00924"
FT   misc_feature    complement(372865..372969)
FT                   /note="PS01246 Uncharacterized protein family UPF0003
FT                   signature."
FT                   /inference="protein motif:ProSite:PS01246"
FT   misc_feature    complement(373114..373170)
FT                   /locus_tag="YPO0363"
FT                   /note="one of 10 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    complement(373264..373329)
FT                   /locus_tag="YPO0363"
FT                   /note="one of 10 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    complement(373390..373455)
FT                   /locus_tag="YPO0363"
FT                   /note="one of 10 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    complement(373654..373719)
FT                   /locus_tag="YPO0363"
FT                   /note="one of 10 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    complement(373735..373800)
FT                   /locus_tag="YPO0363"
FT                   /note="one of 10 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    complement(373864..373929)
FT                   /locus_tag="YPO0363"
FT                   /note="one of 10 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    complement(373960..374016)
FT                   /locus_tag="YPO0363"
FT                   /note="one of 10 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    complement(374080..374145)
FT                   /locus_tag="YPO0363"
FT                   /note="one of 10 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    complement(374176..374241)
FT                   /locus_tag="YPO0363"
FT                   /note="one of 10 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    complement(374332..374382)
FT                   /locus_tag="YPO0363"
FT                   /note="one of 10 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        complement(375873..376754)
FT                   /transl_table=11
FT                   /gene="psd"
FT                   /locus_tag="YPO0364"
FT                   /product="phosphatidylserine decarboxylase proenzyme"
FT                   /EC_number="4.1.1.65"
FT                   /note="Similar to Haemophilus influenzae phosphatidylserine
FT                   decarboxylase proenzyme Psd SW:DPSD_HAEIN (P43789) (290 aa)
FT                   fasta scores: E(): 0, 58.9% id in 280 aa and to Escherichia
FT                   coli phosphatidylserine decarboxylase proenzyme Psd
FT                   SW:DPSD_ECOLI (P10740) (322 aa) fasta scores: E(): 0, 73.0%
FT                   id in 293 aa"
FT                   /db_xref="GOA:Q8ZIX1"
FT                   /db_xref="InterPro:IPR003817"
FT                   /db_xref="InterPro:IPR033177"
FT                   /db_xref="InterPro:IPR033178"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZIX1"
FT                   /protein_id="CAL19046.1"
FT                   /translation="MLDSIKIKLQYLLPKQGLTQLAGWGANKQGGWLTQLVIKAFARYY
FT                   KVDMKEAQDPEFSAYRTFNEFFVRPLRAGVRPVVAEENLLAQPADGAISQLGAIREGQI
FT                   LQAKGHNYSLEALLAGNYLLAAEFQNGQFVTTYLAPRDYHRVHMPCDGVLREMIYVPGD
FT                   LFSVNPLTAANVPNLFARNERVICIFDTAFGPMAQILVGATIVGSIETVWAGTITPPRE
FT                   GVIRRWTYPQAGCEGAITLEKGQEMGRFKLGSTVINLFAEGKVYFAPQLNSGAVTRMGE
FT                   VLAEAVPTTPSY"
FT   CDS_pept        complement(377079..378131)
FT                   /transl_table=11
FT                   /locus_tag="YPO0365"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Escherichia coli hypothetical protein
FT                   YjeQ SW:YJEQ_ECOLI (P39286) (350 aa) fasta scores: E():
FT                   0,78.9% id in 351 aa"
FT                   /db_xref="GOA:Q8ZIX0"
FT                   /db_xref="InterPro:IPR004881"
FT                   /db_xref="InterPro:IPR010914"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030378"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZIX0"
FT                   /protein_id="CAL19047.1"
FT                   /translation="MSKNKLSKGQQRRVQANHQRRLRTDRKPELDDSQLGDAQEGIVIS
FT                   RFGQHADVEAVDGTQHRCNIRRTIKSLVTGDRVVWRPGLQAQEGVRVKGIVEAVHERTS
FT                   VLTRPDLYDGVKPIAANIDQIVIVSAILPELSLNIIDRYLVACETLEVEPLIVLNKIDL
FT                   LDADGRKFVDGMMDIYRRIGYDVLEVSSQTREGMEAFENALTGRISIFAGQSGVGKSSL
FT                   LNALLPPTDNEILVNTVSGNSGLGQHTTTAARLYHFQHGGDVIDSPGVREFGLWHLAPE
FT                   QITQGFVEFRDYLGHCKFRDCSHTNDPGCALREAVEQGKIAEERFDNYHRILESMEQAK
FT                   PRKTSDSDEK"
FT   misc_feature    complement(377472..377495)
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:ProSite:PS00017"
FT   CDS_pept        378331..378876
FT                   /transl_table=11
FT                   /gene="b4162"
FT                   /gene_synonym="orn"
FT                   /locus_tag="YPO0366"
FT                   /product="oligoribonuclease"
FT                   /EC_number="3.1.-.-"
FT                   /note="Similar to Escherichia coli oligoribonuclease Orn
FT                   SW:ORN_ECOLI (P39287) (180 aa) fasta scores: E(): 0, 87.6%
FT                   id in 177 aa"
FT                   /db_xref="GOA:Q8ZIW9"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR013520"
FT                   /db_xref="InterPro:IPR022894"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZIW9"
FT                   /protein_id="CAL19048.1"
FT                   /translation="MAENQNNLIWIDLEMTGLDPERDRIIEIATLVTDANLNILAEGPV
FT                   LAVHQSAEQLGLMDEWNVRTHTGSGLVERVKASPFNDRDAELQTIEFLKQWVPAGVSPI
FT                   CGNSVGQDRRFLFRYMPELEAYFHYRYVDVSTLKELARRWKPEILAGFKKQNTHQALDD
FT                   IRESVAELAYYREHFIQS"
FT   misc_feature    378352..378867
FT                   /note="Pfam match to entry PF00929 Exonuclease,Exonuclease,
FT                   score 126.60, E-value 4.4e-34"
FT                   /inference="protein motif:PF00929"
FT   tRNA            379434..379509
FT                   /note="tRNA Gly anticodon GCC, Cove score 93.74"
FT   CDS_pept        complement(379821..381056)
FT                   /transl_table=11
FT                   /locus_tag="YPO0367"
FT                   /product="putative iron-sulfur cluster-binding protein"
FT                   /note="Similar to several including: Vibrio cholerae
FT                   iron-sulfur cluster-binding protein VC0342 TR:Q9KV16
FT                   (EMBL:AE004123) (369 aa) fasta scores: E(): 0, 58.7% id in
FT                   407 aa and Escherichia coli hypothetical protein YjeS or
FT                   B4166 SW:YJES_ECOLI (P39288) (379 aa) fasta scores: E():
FT                   0,74.7% id in 411 aa"
FT                   /db_xref="GOA:Q7CKM4"
FT                   /db_xref="InterPro:IPR004453"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR013542"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7CKM4"
FT                   /inference="similar to sequence:INSDC:AE004123"
FT                   /protein_id="CAL19049.1"
FT                   /translation="MAHPLDLNQLAQHIKQWGQSLGFQQVGICDTDLTAEEPRLQAWLD
FT                   KQYHGEMAWMARHGMLRARPHELLPGTLRVISVRMNYLPAKAAFASTLNNPELGYVSRY
FT                   ALGRDYHKLLRQRLKKLGDQIQHYCLEQNNLDRHDLELHDLEQHDSERQGQPEQHTASE
FT                   INFRPFVDSAPIMERSLAAKAGIGWVGKHSLILNRDAGSWFFLGELLIDLPLPVDKPQE
FT                   EQCGRCVACMTTCPTGAIVAPYTVDARRCISYLTIELEGAIPEEFRPLMGNRIYGCDDC
FT                   QLICPWNRFSQLTDEDDFSPRAVLHTPQLLDLFAWNEEKFLRVTEGSAIRRIGHLRWLR
FT                   NISVALGNAPYLDSIVLALETRRGLHPMLDEHIEWAISQQLARRATQAVEVQLPQKKRL
FT                   IRAIEKGLPRDA"
FT   misc_feature    complement(380334..380405)
FT                   /note="Pfam match to entry PF00037 fer4, 4Fe-4S binding
FT                   domain, score 16.90, E-value 0.0062"
FT                   /inference="protein motif:PF00037"
FT   misc_feature    complement(380349..380384)
FT                   /note="PS00198 4Fe-4S ferredoxins, iron-sulfur binding
FT                   region signature."
FT                   /inference="protein motif:ProSite:PS00198"
FT   CDS_pept        381055..382569
FT                   /transl_table=11
FT                   /locus_tag="YPO0368"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to many proteins of unknown function e.g.
FT                   Escherichia coli hypothetical protein YjeF or B4167
FT                   SW:YJEF_ECOLI (P31806) (515 aa) fasta scores: E(): 0, 61.0%
FT                   id in 502 aa"
FT                   /db_xref="GOA:A0A0H2W2L0"
FT                   /db_xref="InterPro:IPR000631"
FT                   /db_xref="InterPro:IPR004443"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="InterPro:IPR030677"
FT                   /db_xref="InterPro:IPR036652"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2W2L0"
FT                   /protein_id="CAL19050.1"
FT                   /translation="MTDHSKKQTRVSLPHSVFSADWVRQNEAAAAAHFSLTLFDLMVRA
FT                   GNAAFELAHKQYPIARHWLILCGHGNNGGDGYIVANRALAAGIDVTLIACPGNRPLPAE
FT                   AKEAQSQWLAIGGVIHQPDTQWPQDIDLIIDGLLGIGLRAAPQGIYETLIDMANRHRAA
FT                   KVALDIPSGLCADNGAALGSVLRADHTLTFVALKPGLLTGQARDWVGQLHYDDLGLATW
FT                   LDTQSAQIERITADHLPQWLKPRRPCAHKGDYGRLLLVGGDRGFGGAIRMAGEAALRSG
FT                   AGLVRVLTHFEHVAPILAARPELMVQALTAETLEQSMQWADVLVVGPGLGQSDWSRNAL
FT                   KRLQQSDKPTLWDADALNLLALNPHRRQNWVLTPHPGEAARLLGCRVVDIESDRLLSAR
FT                   NIVKQYGGVVVLKGAGTLIANEQGEMAIADVGNAGMASGGMGDILSGIIGGLIAQKLAL
FT                   YDAACAGCVVHGVAADKLAEVQGTRGLLATDLLPVIPKYINPELAK"
FT   misc_feature    381823..382542
FT                   /note="Pfam match to entry PF01256 UPF0031, Uncharacterized
FT                   protein family UPF0031, score 300.70, E-value 1.7e-86"
FT                   /inference="protein motif:PF01256"
FT   CDS_pept        382580..383050
FT                   /transl_table=11
FT                   /locus_tag="YPO0369"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to several proteins of undefined function
FT                   e.g. Escherichia coli hypothetical protein YjeE or B4168
FT                   SW:YJEE_ECOLI (P31805) (153 aa) fasta scores: E():
FT                   3.5e-41,73.026% id in 152 aa"
FT                   /db_xref="GOA:A0A384LGG4"
FT                   /db_xref="InterPro:IPR003442"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384LGG4"
FT                   /protein_id="CAL19051.1"
FT                   /translation="MKELVLLLPDEAATVALGATLAQAFGGASVIYLFGDLGAGKTTFS
FT                   RGFLQALGHNGHVKSPTYTLVEPYTLTPRPVYHFDLYRLADPEELEFMGIRDYFDPQAI
FT                   CLVEWPQQGAGFLPQADVELHLTYQAAGREARLVAISEAGADVLRRLAAVQG"
FT   misc_feature    382640..382987
FT                   /note="Pfam match to entry PF02367 UPF0079, , score
FT                   187.60,E-value 2e-52"
FT                   /inference="protein motif:PF02367"
FT   misc_feature    382682..382705
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:ProSite:PS00017"
FT   CDS_pept        383190..384971
FT                   /transl_table=11
FT                   /locus_tag="YPO0370"
FT                   /product="putative N-acetylmuramoyl-L-alanine
FT                   amidase-family protein"
FT                   /note="Similar to Escherichia coli cell wall hydrolase:
FT                   N-acetylmuramoyl-L-alanine amidase amiB precursor
FT                   SW:AMIB_ECOLI (P26365) (445 aa) fasta scores: E():
FT                   4e-86,61.247% id in 449 aa. Also similar to Vibrio cholerae
FT                   N-acetylmuramoyl-L-alanine amidase vc0344 TR:Q9KV14
FT                   (EMBL:AE004123) (581 aa) fasta scores: E(): 2.5e-41,37.605%
FT                   id in 593 aa. Note that like the Vibrio cholerae hit the Y.
FT                   pestis predicted product also possesses an additional LysM
FT                   domain which may be involved in peptidoglycan binding."
FT                   /db_xref="GOA:A0A384KJW9"
FT                   /db_xref="InterPro:IPR002508"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR021731"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384KJW9"
FT                   /inference="similar to sequence:INSDC:AE004123"
FT                   /protein_id="CAL19052.1"
FT                   /translation="MIIGLLTLSLFALPPAFAMKLTDIKVTNGASESKVTLSFDGKPIY
FT                   AFFSLNSPERVVLDVRQSGNISGLPLEFSGQNLLKRIRSSTPKDEQSTRLVLELTQKVK
FT                   TRAVTQQSGNNYTVVLTMTAVASAPVRQAQASLNQTNTPSPNAGRVVPQVTSKDSVAKN
FT                   PFNNKPVVVVSSENVTTNTARPIKTVSAANSSRVVVAIDAGHGGQDPGAIGQNGLKEKN
FT                   VTISIARRLEALLNRDPMFKPVLTRNGDYFISVMGRSDVARKQGANVLISIHADAAPNR
FT                   SATGASVWVLSNRRANSEMGNWLEQHEKQSELLGGAGDVLANTASDPYLSQAVLDLQFG
FT                   HSQRVGYDVATKVLRELQTVGDIHKRKPEHASLGVLRSPDIPSLLVETGFISNSTEERL
FT                   LGSSAYQEKIAQAIYKGLRSYFLANPLQSDPKVESRPLIETAAVDSSTQRSGISQPEPI
FT                   VNNISSNAQSGRSSATLPAGKSKIHNVQRGETLSGIASQYGVSMAVLRQNNTLKNDVVW
FT                   VGQRLKVPASGSTVTAVKPKTAAVAKSKPIKHQVKRGDTLSAIAARYGVSMSEIERVNK
FT                   IKSGNVQLGQTLTIPQS"
FT   misc_feature    383964..384455
FT                   /note="Pfam match to entry PF01520
FT                   Amidase_3,N-acetylmuramoyl-L-alanine amidase, score 268.20,
FT                   E-value 1.1e-76"
FT                   /inference="protein motif:PF01520"
FT   misc_feature    384606..384629
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:ProSite:PS00017"
FT   misc_feature    384636..384764
FT                   /note="Pfam match to entry PF01476 LysM, Putative
FT                   peptidoglycan binding domain, score 59.30, E-value 8.5e-14"
FT                   /inference="protein motif:PF01476"
FT   misc_feature    384834..384962
FT                   /note="Pfam match to entry PF01476 LysM, Putative
FT                   peptidoglycan binding domain, score 71.40, E-value 1.9e-17"
FT                   /inference="protein motif:PF01476"
FT   misc_feature    384852..384917
FT                   /note="Predicted helix-turn-helix motif with score 1170
FT                   (+3.17 SD) at aa 599-620, sequence DTLSAIAARYGVSMSEIERVNK"
FT   CDS_pept        384987..386894
FT                   /transl_table=11
FT                   /gene="b4170"
FT                   /gene_synonym="mutL"
FT                   /locus_tag="YPO0371"
FT                   /product="DNA mismatch repair protein"
FT                   /note="Similar to Escherichia coli DNA mismatch repair
FT                   protein MutL SW:MUTL_ECOLI (P23367) (615 aa) fasta scores:
FT                   E(): 0, 65.0% id in 637 aa"
FT                   /db_xref="GOA:Q8ZIW4"
FT                   /db_xref="InterPro:IPR002099"
FT                   /db_xref="InterPro:IPR013507"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR014762"
FT                   /db_xref="InterPro:IPR014790"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020667"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR037198"
FT                   /db_xref="InterPro:IPR038973"
FT                   /db_xref="InterPro:IPR042120"
FT                   /db_xref="InterPro:IPR042121"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZIW4"
FT                   /protein_id="CAL19053.1"
FT                   /translation="MPIQILPPQLANQIAAGEVVERPASVVKELVENSLDAGATRIDID
FT                   IERGGAKLIRIRDNGCGISKDDLALALARHATSKISSLEDLEAILSMGFRGEALASISS
FT                   VSRLILTSRTAEQSEAWQAYAEGRDMAVTIKPAAHPVGSTLEVLDLFYNTPARRKFMRT
FT                   EKTEFGHIDEVVRRIALARFDVAINLNHNGKLIRQYRAAPDPAQHERRLASICGPAFLQ
FT                   HALAIAWQHGDLNIHGWVADPAASHTLSEMQYCYVNNRMMRDRLINHAIRQAYQDRLND
FT                   AQQPAYVLYLDIDPHQVDVNVHPAKHEVRFHQARLVHDFIYQAVTAVLQQTNAPILNIS
FT                   EEGEVDAPRWQQENRVAAGTNKYAQPEAAKSSAAEQAVARERSSARERAAPAYKEDHPY
FT                   QKQQGELYRQLLQPSAAAKPATSPAAIPASSVSSPSIPVQRITQAEEPLHGDNYSFGRV
FT                   LTVFPPCYALIEYQGGVALLSLAVAERWLKQAQLSPPEEGLRPQPLLIPLKITLDKNEI
FT                   AACQNHEKLLITMGIELSVEQGRATLRAVSLPLRQQNLQKLIPELLGYLSQHEEISPDT
FT                   LATWLARHLGSEHEVWNVSQAIQLLTEVERLCPQLVQSPPAGLLQPIDIKAALATLTHE
FT                   "
FT   misc_feature    384993..385952
FT                   /note="Pfam match to entry PF01119 DNA_mis_repair, DNA
FT                   mismatch repair protein, score 569.50, E-value 2.1e-167"
FT                   /inference="protein motif:PF01119"
FT   misc_feature    385263..385283
FT                   /note="PS00058 DNA mismatch repair proteins mutL / hexB /
FT                   PMS1 signature."
FT                   /inference="protein motif:ProSite:PS00058"
FT   CDS_pept        386887..387828
FT                   /transl_table=11
FT                   /gene="b4171"
FT                   /gene_synonym="miaA"
FT                   /gene_synonym="trpX"
FT                   /locus_tag="YPO0372"
FT                   /product="tRNA delta(2)-isopentenylpyrophosphate
FT                   transferase"
FT                   /EC_number="2.5.1.8"
FT                   /note="Similar to Escherichia coli, and Shigella flexneri
FT                   tRNA delta(2)-isopentenylpyrophosphate transferase MiaA
FT                   SW:MIAA_ECOLI (P16384) (316 aa) fasta scores: E(): 0, 80.2%
FT                   id in 313 aa"
FT                   /db_xref="GOA:Q8ZIW3"
FT                   /db_xref="InterPro:IPR018022"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR039657"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZIW3"
FT                   /protein_id="CAL19054.1"
FT                   /translation="MNDIENLDRPPAIFIMGPTASGKTALSIALRQRLPVELVSVDSAL
FT                   IYRGMDIGTAKPSAQELALAPHRLIDIRDPAESYSAADFRKDALKEMADITAAGRIPLL
FT                   VGGTMLYFKALLDGLSPLPSADPQVRQRIEQQASELGWGALHQQLAVIDPVAAARIHPN
FT                   DPQRLSRALEVFFISGKTLTELTKISGETLPYRVHQFAIAPASRELLHQRIELRFHQML
FT                   DAGFEAEARVLFDRGDLHTDLPAIRCVGYRQMWSYLSGEIDYNDMVYRGVCATRQLAKR
FT                   QMTWLRGWSSVQWLDSDKPGEALDSVIQVVSA"
FT   misc_feature    386935..386958
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:ProSite:PS00017"
FT   misc_feature    387016..387780
FT                   /note="Pfam match to entry PF01715 IPPT, IPP
FT                   transferase,score 506.50, E-value 2e-148"
FT                   /inference="protein motif:PF01715"
FT   CDS_pept        387944..388249
FT                   /transl_table=11
FT                   /gene="ymr"
FT                   /locus_tag="YPO0373"
FT                   /product="yersinia multiple regulator"
FT                   /note="Similar to many regulatory proteins including:
FT                   Yersinia enterocolitica multiple regulator Ymr TR:Q56928
FT                   (EMBL:D28762) (101 aa) fasta scores: E(): 0, 99.0% id in
FT                   101 aa and to Erwinia carotovora bacteriocin gene regulator
FT                   TR:Q9ZI76 (EMBL:AF039142) (99 aa) fasta scores: E():
FT                   5.2e-32, 88.1% id in 101 aa and to Escherichia coli host
FT                   factor-I protein Hfq SW:HFQ_ECOLI (P25521) (101 aa) fasta
FT                   scores: E(): 1.7e-28, 80.2% id in 101 aa"
FT                   /db_xref="GOA:Q8ZIW2"
FT                   /db_xref="InterPro:IPR005001"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZIW2"
FT                   /inference="similar to sequence:INSDC:D28762"
FT                   /inference="similar to sequence:INSDC:AF039142"
FT                   /protein_id="CAL19055.1"
FT                   /translation="MAKGQSLQDPFLNALRRERVPVSIYLVNGIKLQGQVESFDQFVIL
FT                   LKNTVSQMVYKHAISTVVPSRPVSHHSNTPSGSTNNYHGSNPSAPQQPQQDSDDAE"
FT   CDS_pept        388348..389634
FT                   /transl_table=11
FT                   /gene="hflX"
FT                   /locus_tag="YPO0374"
FT                   /product="GTP-binding protein"
FT                   /note="Similar to Escherichia coli GTP-binding protein
FT                   which lies within the high frequency of lysogenization
FT                   locus governing the stability of the lambda cII
FT                   protein,HflX SW:HFLX_ECOLI (P25519) (426 aa) fasta scores:
FT                   E(): 0,84.7% id in 425 aa"
FT                   /db_xref="GOA:A0A384LJ00"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR016496"
FT                   /db_xref="InterPro:IPR025121"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030394"
FT                   /db_xref="InterPro:IPR032305"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR042108"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384LJ00"
FT                   /protein_id="CAL19056.1"
FT                   /translation="MFDRYEAGEQAVLVHIYFSQNKDTEDLREFEALVSSAGVEALQIV
FT                   TGSRKAPHPKYFVGEGKAEEIADAVKASGASVVLFDHALSAAQERNLERLCQCRVIDRT
FT                   GLILDIFAQRARTHEGKLQVELAQLRHIATRLVRGWTHLERQKGGIGLRGPGETQLETD
FT                   RRLLRDRISLILSRLERVAKQREQGRRARTRADIPTVSLVGYTNAGKSSLFNKITAADV
FT                   YAADQLFATLDPTLRRINVADVGDTVLADTVGFIRHLPHDLVAAFKATLQETRQASLLL
FT                   HIIDAADPRVAENMAAVDTVLAEIEADEIPTLLVMNKIDLLDDFVPRIDRNEDNLPVRV
FT                   WLSAQTGAGIPLLFQALTERLSGEIAHFELRLPPQAGRLRSRFYQLQAIEKEWIDEDGN
FT                   VGMVVRMPIVDWRRLCKQEQELVSYIQNN"
FT   misc_feature    388957..388980
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:ProSite:PS00017"
FT   CDS_pept        389875..391134
FT                   /transl_table=11
FT                   /gene="hflA"
FT                   /gene_synonym="hflK"
FT                   /locus_tag="YPO0375"
FT                   /product="putative membrane protein"
FT                   /note="Similar to Escherichia coli HflK protein which lies
FT                   within the high frequency of lysogenization locus governing
FT                   the stability of the lambda cII protein SW:HFLK_ECOLI
FT                   (P25662) (419 aa) fasta scores: E(): 0, 80.5% id in 420 aa"
FT                   /db_xref="GOA:A0A384LHJ8"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR001972"
FT                   /db_xref="InterPro:IPR010201"
FT                   /db_xref="InterPro:IPR020980"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384LHJ8"
FT                   /protein_id="CAL19057.1"
FT                   /translation="MAWNQPGNNGQDRDPWGSSNNNGGNSGGNNNKGGRDQGPPDLDDI
FT                   FRKLSKKLSSLGGKGSGSGGNGASHGPGFSGRVVGIAVVAVVVIWAASGFYTIKEAERG
FT                   VVTRLGKLSHIVQPGLNWKPTFIDEVVPVNVEAVRELAASGVMLTSDENVVRVEMNVQY
FT                   RVTDPAAYLFSVTNPDDSLRQATDSAVRGVIGKYTMDKILTEGRTIVRSDTQRVLEETI
FT                   RPYQMGITLLDVNFQAARPPEEVKAAFDDAIAARENEQQYIREAEAYTNEVQPRANGQA
FT                   QRLLEDARAYAARKVLEAQGEVAGFAKLLPEYKAAPEITRERLYIETMEKVLGKTNKVL
FT                   ANDKGNNLMVLPLDQMLRGQGAANKVDGNKDTSLIRLNPAPSSQQTGASNSNTSSGSGS
FT                   IMDQRRVNAQRDTSTRVGRE"
FT   misc_feature    390100..390168
FT                   /note="1 probable transmembrane helix predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    390112..390690
FT                   /note="Pfam match to entry PF01145 Band_7, SPFH domain /
FT                   Band 7 family, score 275.80, E-value 5.8e-79"
FT                   /inference="protein motif:PF01145"
FT   CDS_pept        391138..392142
FT                   /transl_table=11
FT                   /gene="hflA"
FT                   /gene_synonym="hflC"
FT                   /locus_tag="YPO0376"
FT                   /product="putative membrane protein"
FT                   /note="Similar to Escherichia coli HflC protein which lies
FT                   within the high frequency of lysogenization locus governing
FT                   the stability of the lambda cII protein SW:HFLC_ECOLI
FT                   (P25661) (334 aa) fasta scores: E(): 0, 81.7% id in 334 aa"
FT                   /db_xref="GOA:A0A384KXZ6"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR010200"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384KXZ6"
FT                   /protein_id="CAL19058.1"
FT                   /translation="MRKSFLLIVVVVLIALFASLFVVEEGQRGIVLRFGKVLRDSDNKP
FT                   LVYAPGLHFKIPFIETVKRLDARIQTMDNQADRFVTNEKKDLIVDSYLKWRISDFSRYY
FT                   LATGGGDVSQAEVLLKRKFSDRLRSEIGRLNVRDIVTDSRGRLTSDVRDALNTGSVGDE
FT                   AATTEADDAIASAAARVEQETRGKQPAVNPNSMAALGIEVVDVRIKQINLPAEVSDAIF
FT                   QRMRAEREAVARRHRSQGQEEAEKLRATADYEVTRTLAEAERQARITRGGGDAEAARLF
FT                   AEAFSQDPDFYAFIRSLRAYENSFSSGNDVMVLSPDSDFFRYMKSPDNSSKRP"
FT   misc_feature    391150..391869
FT                   /note="Pfam match to entry PF01145 Band_7, SPFH domain /
FT                   Band 7 family, score 295.90, E-value 5e-85"
FT                   /inference="protein motif:PF01145"
FT   misc_feature    391150..391206
FT                   /note="1 probable transmembrane helix predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        392314..392514
FT                   /transl_table=11
FT                   /locus_tag="YPO0377"
FT                   /product="putative membrane protein"
FT                   /note="Similar to several proteins of unknown function
FT                   including: Escherichia coli hypothetical 7.2 kDa protein in
FT                   hflC-purA intergenic region YjeT SW:YJET_ECOLI (P39289) (65
FT                   aa) fasta scores: E(): 3.7e-20, 81.538% id in 65 aa and
FT                   Escherichia coli O157:H7 hypothetical 7.2 kDa protein
FT                   ecs5152 TR:BAB38575 (EMBL:AP002568) (65 aa) fasta scores:
FT                   E(): 3.7e-20, 81.538% id in 65 aa"
FT                   /db_xref="InterPro:IPR019201"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384L2Y0"
FT                   /inference="protein motif:TMHMM:2.0"
FT                   /inference="similar to sequence:INSDC:AP002568"
FT                   /protein_id="CAL19059.1"
FT                   /translation="MNSTILLALGLVLVLEGLGPMLYPKAWRKMIQAMTQLPDATLRRF
FT                   GGGLVVAGCVIYYMLRSHMGS"
FT   misc_feature    392326..392394
FT                   /locus_tag="YPO0377"
FT                   /note="one of 2 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    392431..392499
FT                   /locus_tag="YPO0377"
FT                   /note="one of 2 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        392614..393912
FT                   /transl_table=11
FT                   /gene="adeK"
FT                   /gene_synonym="purA"
FT                   /locus_tag="YPO0378"
FT                   /product="adenylosuccinate synthetase"
FT                   /EC_number="6.3.4.4"
FT                   /note="Similar to Escherichia coli adenylosuccinate
FT                   synthetase PurA SW:PURA_ECOLI (P12283) (431 aa) fasta
FT                   scores: E(): 0, 88.6% id in 431 aa, and to Edwardsiella
FT                   ictaluri adenylosuccinate synthetase PurA SW:PURA_EDWIC
FT                   (O31047) (431 aa) fasta scores: E(): 0, 85.4% id in 431 aa"
FT                   /db_xref="GOA:Q8ZIV7"
FT                   /db_xref="InterPro:IPR001114"
FT                   /db_xref="InterPro:IPR018220"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033128"
FT                   /db_xref="InterPro:IPR042109"
FT                   /db_xref="InterPro:IPR042110"
FT                   /db_xref="InterPro:IPR042111"
FT                   /db_xref="PDB:3HID"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZIV7"
FT                   /protein_id="CAL19060.1"
FT                   /translation="MGKNVVVLGTQWGDEGKGKVVDLLTERAKYVVRYQGGHNAGHTLV
FT                   INGEKTVLHLIPSGILRENVISIIGNGVVLAPDALMKEMTELEARGVPVRERLLLSEAC
FT                   PLILPYHVALDNAREKARGAKAIGTTGRGIGPAYEDKVARRGLRVSDLFNKETFAIKLK
FT                   EIVEYHNFQLVHYYKEAAVDYQKVLDDVLAIADILTAMVVDVSELLDNARKQGELIMFE
FT                   GAQGTLLDIDHGTYPYVTSSNTTAGGVATGSGLGPRYVDYVLGIVKAYSTRVGAGPFPT
FT                   ELNDETGEFLRKQGNEYGATTGRSRRTGWLDIVAVRRAVQINSLSGFCMTKLDVLDGLK
FT                   EVKLCVGYRMPDGREVDTTPLAAEGWEGIEPIYETMPGWSETTFGVKEHSKLPQAALNY
FT                   IQRVEELTGVPIDIISTGPDRDETMILRDPFDA"
FT   misc_feature    392629..393798
FT                   /note="Pfam match to entry PF00709
FT                   Adenylsucc_synt,Adenylosuccinate synthetase, score 943.30,
FT                   E-value 6.3e-280"
FT                   /inference="protein motif:PF00709"
FT   misc_feature    392644..392667
FT                   /note="PS01266 Adenylosuccinate synthetase GTP-binding
FT                   site."
FT                   /inference="protein motif:ProSite:PS01266"
FT   misc_feature    393010..393045
FT                   /note="PS00513 Adenylosuccinate synthetase active site."
FT                   /inference="protein motif:ProSite:PS00513"
FT   CDS_pept        394281..394706
FT                   /transl_table=11
FT                   /locus_tag="YPO0379"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Escherichia coli and Shigella flexneri
FT                   hypothetical protein YjeB SW:YJEB_ECOLI (P21498) (141 aa)
FT                   fasta scores: E(): 0, 84.4% id in 141 aa, and to Vibrio
FT                   parahaemolyticus hypothetical protein YjeB SW:YJEB_VIBPA
FT                   (P40610) (141 aa) fasta scores: E(): 1.4e-31, 61.6% id in
FT                   138 aa"
FT                   /db_xref="GOA:Q0WJT1"
FT                   /db_xref="InterPro:IPR000944"
FT                   /db_xref="InterPro:IPR023761"
FT                   /db_xref="InterPro:IPR030489"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0WJT1"
FT                   /protein_id="CAL19061.1"
FT                   /translation="MQLTSFTDYGLRALIYMASLPDGQMTSISQVTEVYGVSRNHMVKI
FT                   INQLSRVGLVTAVRGKNGGIRLGKPADQILIGDVVRQMEPLTLVNCSSDFCHITPACRL
FT                   KQVLNQAVQSFLKELDNYTLADMVKDNSPLYKLLLVE"
FT   misc_feature    394281..394637
FT                   /note="Pfam match to entry PF02082 UPF0074, Uncharacterized
FT                   protein family UPF0074, score 191.10, E-value 1.8e-53"
FT                   /inference="protein motif:PF02082"
FT   misc_feature    394356..394421
FT                   /note="Predicted helix-turn-helix motif with score 1116
FT                   (+2.99 SD) at aa 26-47, sequence TSISQVTEVYGVSRNHMVKIIN"
FT   misc_feature    394425..394481
FT                   /note="PS01332 Uncharacterized protein family UPF0074
FT                   signature."
FT                   /inference="protein motif:ProSite:PS01332"
FT   CDS_pept        394947..397481
FT                   /transl_table=11
FT                   /gene="rnr"
FT                   /gene_synonym="vacB"
FT                   /locus_tag="YPO0380"
FT                   /product="ribonuclease R"
FT                   /EC_number="3.1.-.-"
FT                   /note="Similar to Escherichia coli ribonuclease R Rnr
FT                   SW:RNR_ECOLI (P21499) (813 aa) fasta scores: E(): 0,77.936%
FT                   id in 843 aa, and to Shigella flexneri ribonuclease R Rnr
FT                   SW:RNR_SHIFL (P30851) (770 aa) fasta scores: E(): 0,78.994%
FT                   id in 795 aa"
FT                   /db_xref="GOA:A0A384LB40"
FT                   /db_xref="InterPro:IPR001900"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR004476"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR011805"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013223"
FT                   /db_xref="InterPro:IPR013668"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR040476"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384LB40"
FT                   /protein_id="CAL19062.1"
FT                   /translation="MSQDPFLEREAEKYESPIPSREFILAHLAKRETPASREELANELN
FT                   LTGEEPLEALRRRLRAMERDGQLVFTRRQCYALPERLDLLRGTVIGHRDGYGFLRVEGS
FT                   KDDLYLSAEQMKMAIHGDVVLAQVVGADRKGRREARIVRVLVPKTSQIVGRYFTDAGTG
FT                   FVVPDDSRLSFDILIPAEATCGARMGFVVVVELTQRPTRRTKAVGKIVEVLGENMGTSM
FT                   AVDIALRTHEIPHTWPPQVEKQVADLKEQVPEEAKKGRVDLRDLPLVTIDGEDARDFDD
FT                   AVYCEKKRGGGWRLWVAIADVSYYVRPQTALDDEARSRGNSVYFPSQVIPMLPEVLSNG
FT                   LCSLNPQVDRLCMVCEMTISSQGKLSSYKFYEAVMSSHARLTYTKVWRIIDGEESLREQ
FT                   YKPLVPHLEELHAMYKVLDQARAERGGIAFETEEAKFIFNAERRIERIEPTVRNDAHKL
FT                   IEECMILANIAAARFVEKHEEPALFRVHDRPSDDHIVALRSVLNELGLTLGGGLKPQPK
FT                   DYSVLMDEISDRPDHEMLQTMLLRSMKQAVYDPENRGHFGLALASYGHFTSPIRRYPDL
FT                   AMHRAIKYQLAKEHGNLKDRWTPTGGWHSDFEDMLQLGQHCSMTERRADEATRDVADWL
FT                   KCDFMLDQVGNVFTGIIASVTGFGFFVRLDDLFIDGLVHVSSLDNDYYRYDNIGQRLIG
FT                   ESSGVVYRLGDTVEIRVDAVHMDERKIDFALVSSTRKPRGEGKTARDKAKNNGQRTLRS
FT                   NSAGRGSSSGSSRRDGAPTAGGQKRPRRAKKPVNFEPDSAFRPDAAAAKPDDKALAEKK
FT                   AKAKAKRASAKTKKIAAATKAKRAKKKTTSDQ"
FT   misc_feature    395490..396596
FT                   /note="Pfam match to entry PF00773 RNB, RNB-like
FT                   proteins,score 528.90, E-value 3.6e-155"
FT                   /inference="protein motif:PF00773"
FT   misc_feature    396867..397124
FT                   /note="Pfam match to entry PF00575 S1, S1 RNA binding
FT                   domain, score 68.80, E-value 2.2e-17"
FT                   /inference="protein motif:PF00575"
FT   CDS_pept        397600..398340
FT                   /transl_table=11
FT                   /locus_tag="YPO0381"
FT                   /product="putative methylase"
FT                   /note="Similar to Escherichia coli hypothetical tRNA/rRNA
FT                   methyltransferase YjfH SW:YJFH_ECOLI (P39290) (243 aa)
FT                   fasta scores: E(): 0, 81.8% id in 242 aa, and to
FT                   Haemophilus influenzae hypothetical tRNA/rRNA
FT                   methyltransferase HI0860 SW:YJFH_HAEIN (P44906) (246 aa)
FT                   fasta scores: E(): 0, 70.4% id in 243 aa"
FT                   /db_xref="GOA:Q8ZIV4"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR004441"
FT                   /db_xref="InterPro:IPR013123"
FT                   /db_xref="InterPro:IPR024915"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZIV4"
FT                   /protein_id="CAL19063.1"
FT                   /translation="MSEIIYGIHAVKALLERDPQRFLEVFILKGRDDRRLQPLIAELEA
FT                   AGLVIQVASRQWLDSQVEGGVHQGIVARVREGRQYQENDLPALLESVETPFLLVLDGVT
FT                   DPHNLGACLRSADAAGVHAVIVPRDRSAQLNAIAKKVASGAAENVPLIKVTNLARTLRV
FT                   LQEHNVWIVGTAGEADHTLYQSKMTGPMALVMGAEGEGMRRLTREHCDELISIPMAGSV
FT                   SSLNVSVATGVCLFEVVRQRGLKA"
FT   misc_feature    397882..398307
FT                   /note="Pfam match to entry PF00588 SpoU_methylase, SpoU
FT                   rRNA Methylase family, score 215.80, E-value 6.6e-61"
FT                   /inference="protein motif:PF00588"
FT   CDS_pept        398748..400391
FT                   /transl_table=11
FT                   /gene="aidB"
FT                   /locus_tag="YPO0383"
FT                   /product="putative acyl-CoA dehydrogenase"
FT                   /note="Similar to Escherichia coli probable CoA
FT                   dehydrogenase protein AidB SW:AIDB_ECOLI (P33224) (546 aa)
FT                   fasta scores: E(): 0, 69.5% id in 541 aa, and to
FT                   Pseudomonas aeruginosa probable acyl-CoA dehydrogenase
FT                   PA3972 TR:AAG07359 (EMBL:AE004815) (549 aa) fasta scores:
FT                   E(): 0, 44.8% id in 542 aa. Possible alternative
FT                   translational start site"
FT                   /db_xref="GOA:Q0WJS8"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR041504"
FT                   /db_xref="UniProtKB/TrEMBL:Q0WJS8"
FT                   /inference="similar to sequence:INSDC:AE004815"
FT                   /protein_id="CAL19064.1"
FT                   /translation="MGKGMDWQTHLVFNQPEPLSNSNLFLSDLALREAVVREHAGWDGE
FT                   NLSLIGLQLGSLESLELGRLANAHPPELLRYDGAGQRLGQVRFHPAWHVLMQGLIHHRV
FT                   HNLPWQEDARNGSFVARAARFILHAQVDAGALCPITMTFGAIPLLQQTLPPLFQNWLSP
FT                   LLSDRYDPHLSLGNQKRGLLIGMGMTEKQGGSDVLSNTTRAEPLSIRGQGEVYRLIGHK
FT                   WFFSVPQSDAHLVLAQAEGGLSCFFLPKILPDGTHNAIRFERLKEKLGNCSNASSEVEF
FT                   DNATAWLLGEEGDGIRQILKMGGYTRFDCALGSHGLMRRAFSVALYHALQRQVFGKALV
FT                   EQPLMRQVLSRMALRLEGHTALLLRLARAWEASGEVHEQIFSRLLTPAAKYRVCGQGSA
FT                   FVAEAMEVLGGIGYCEQSELPRLYREMPVNSIWEGSGNIMCLDVLRTLRKLPTAVEMLQ
FT                   QEFYPVRGQNRLFDRAWRQLQQRLKNPKEEQGRALTQQLFDLCCASQLLRFASPRLADA
FT                   WCRMTLDHRDQYMLPEAVCARLLERATGAH"
FT   misc_feature    398907..400082
FT                   /note="Pfam match to entry PF00441 Acyl-CoA_dh, Acyl-CoA
FT                   dehydrogenase, score 422.60, E-value 3.5e-123"
FT                   /inference="protein motif:PF00441"
FT   misc_feature    399306..399344
FT                   /note="PS00072 Acyl-CoA dehydrogenases signature 1."
FT                   /inference="protein motif:ProSite:PS00072"
FT   CDS_pept        complement(400463..400774)
FT                   /transl_table=11
FT                   /locus_tag="YPO0384"
FT                   /product="putative lipoprotein"
FT                   /note="Similar to Escherichia coli hypothetical lipoprotein
FT                   YjfO SW:YJFO_ECOLI (P39297) (142 aa) fasta scores: E():
FT                   1.8e-13, 43.5% id in 108 aa"
FT                   /db_xref="InterPro:IPR010854"
FT                   /db_xref="InterPro:IPR025543"
FT                   /db_xref="InterPro:IPR036275"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384K9H3"
FT                   /inference="protein motif:TMHMM:2.0"
FT                   /protein_id="CAL19065.1"
FT                   /translation="MINIKRTIAFLLLTLGLSGCNAFNITPVPPPAIQPYAQEITRAQS
FT                   LRLQKVGTVSAQVYGSPGDVETEIQRRANASGAPYYLIVMISDSVYPGIWYANALLYR"
FT   misc_feature    complement(400469..400534)
FT                   /locus_tag="YPO0384"
FT                   /note="one of 2 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    complement(400688..400753)
FT                   /locus_tag="YPO0384"
FT                   /note="one of 2 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    complement(400715..400747)
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:ProSite:PS00013"
FT   repeat_region   complement(401048..403001)
FT                   /note="insertion sequence:IS100"
FT   repeat_region   401048..401075
FT                   /rpt_type=INVERTED
FT                   /note="IS100 inverted repeat"
FT   CDS_pept        complement(401114..401896)
FT                   /transl_table=11
FT                   /gene="ypmt1.57c"
FT                   /locus_tag="YPO0385"
FT                   /product="insertion sequence IS100, ATP-binding protein"
FT                   /note="Similar to Escherichia coli insertion sequence IS21
FT                   putative ATP-binding protein, IstB SW:ISTB_ECOLI (P15026)
FT                   (265 aa) fasta scores: E(): 0, 47.4% id in 249 aa. Also
FT                   almost identical to Yersinia pestis and Escherichia coli
FT                   putative IS100 transposase ypmt1.57c TR:Q9R3L5
FT                   (EMBL:AL117211) (260 aa) fasta scores: E(): 0, 99.6% id in
FT                   260 aa."
FT                   /db_xref="GOA:Q7ARK4"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR002611"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028350"
FT                   /db_xref="UniProtKB/TrEMBL:Q7ARK4"
FT                   /inference="similar to sequence:INSDC:AL117211"
FT                   /protein_id="CAL19066.1"
FT                   /translation="MMMELQHQRLMALAGQLQLESLISAAPALSQQAVDQEWSYMDFLE
FT                   HLLHEEKLARHQRKQAMYTRMAAFPAVKTFEEYDFTFATGAPQKQLQSLRSLSFIERNE
FT                   NIVLLGPSGVGKTHLAIAMGYEAVRAGIKVRFTTAADLLLQLSTAQRQGRYKTTLQRGV
FT                   MAPRLLIIDEIGYLPFSQEEAKLFFQVIAKRYEKSAMILTSNLPFGQWDQTFAGDAALT
FT                   SAMLDRILHHSHVVQIKGESYRLRQKRKAGVIAEANPE"
FT   misc_feature    complement(401189..401728)
FT                   /note="Pfam match to entry PF01695 IstB, IstB-like ATP
FT                   binding protein, score 367.20, E-value 1.7e-106"
FT                   /inference="protein motif:PF01695"
FT   misc_feature    complement(401546..401569)
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:ProSite:PS00017"
FT   CDS_pept        complement(401893..402915)
FT                   /transl_table=11
FT                   /gene="y1093"
FT                   /gene_synonym="ypmt1"
FT                   /locus_tag="YPO0386"
FT                   /product="transposase for insertion sequence IS100"
FT                   /note="Similar to Escherichia coli transposase for
FT                   insertion sequence element IS21 IstA SW:ISTA_ECOLI (P15025)
FT                   (390 aa) fasta scores: E(): 3e-27, 33.1% id in 329 aa.
FT                   Identical to the previously sequenced Yersinia
FT                   pestis,Yersinia pseudotuberculosis, and Escherichia coli
FT                   pesticin plasmid insertion sequence transposase Y1055
FT                   TR:P74993 (EMBL:U59875) (340 aa) fasta scores: E(): 0,
FT                   100.0% id in 340 aa"
FT                   /db_xref="GOA:Q7ARN5"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR006120"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR017894"
FT                   /db_xref="UniProtKB/TrEMBL:Q7ARN5"
FT                   /inference="similar to sequence:INSDC:U59875"
FT                   /protein_id="CAL19067.1"
FT                   /translation="MVTFETVMEIKILHKQGMSSRAIARELGISRNTVKRYLQAKSEPP
FT                   KYTPRPAVASLLDEYRDYIRQRIADAHPYKIPATVIAREIRDQGYRGGMTILRAFIRSL
FT                   SVPQEQEPAVRFETEPGRQMQVDWGTMRNGRSPLHVFVAVLGYSRMLYIEFTDNMRYDT
FT                   LETCHRNAFRFFGGVPREVLYDNMKTVVLQRDAYQTGQHRFHPSLWQFGKEMGFSPRLC
FT                   RPFRAQTKGKVERMVQYTRNSFYIPLMTRLRPMGITVDVETANRHGLRWLHDVANQRKH
FT                   ETIQARPCDRWLEEQQSMLALPPEKKEYDVHLDENLVNFDKHPLHHPLSIYDSFCRGVA
FT                   "
FT   misc_feature    complement(402037..402570)
FT                   /note="Pfam match to entry PF00665 rve, Integrase core
FT                   domain, score 81.90, E-value 1.6e-22"
FT                   /inference="protein motif:PF00665"
FT   misc_feature    complement(402799..402864)
FT                   /note="Predicted helix-turn-helix motif with score 2147
FT                   (+6.50 SD) at aa 18-39, sequence MSSRAIARELGISRNTVKRYLQ"
FT   misc_feature    complement(402808..402891)
FT                   /note="Pfam match to entry PF00239
FT                   recombinase,Site-specific recombinases, score 25.70,
FT                   E-value 4.7e-06"
FT                   /inference="protein motif:PF00239"
FT   repeat_region   complement(402974..403001)
FT                   /rpt_type=INVERTED
FT                   /note="IS100 inverted repeat"
FT   CDS_pept        403049..405112
FT                   /transl_table=11
FT                   /locus_tag="YPO0387"
FT                   /product="hypothetical protein"
FT                   /note="C-terminal region is similar to the C-terminus of
FT                   Escherichia coli 5-methylcytosine-specific restriction
FT                   enzyme B McrB SW:MCRB_ECOLI (P15005) (459 aa) fasta scores:
FT                   E(): 9.5e-12, 36.0% id in 211 aa. Internal region of the
FT                   CDS is similar to the C-terminus of Deinococcus radiodurans
FT                   McrB-related protein DRB0143 TR:Q9RZI5 (EMBL:AE001826) (969
FT                   aa) fasta scores: E(): 6.4e-30, 35.5% id in 498 aa.
FT                   Possible gene remnant"
FT                   /db_xref="GOA:A0A384KLQ6"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011704"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384KLQ6"
FT                   /inference="similar to sequence:INSDC:AE001826"
FT                   /protein_id="CAL19068.1"
FT                   /translation="MVQDSSALASFFRSHIAKNNQYSPDWGKHYRQLVEQVQAEKPNFS
FT                   ADTIRQIWYERSNGISSLRQGGMSQFEFETAQKQLLALTRQMADECTQENYDRVIERLV
FT                   KLKTDGILNKVYWALCHRAFAALYPSKITNVVNVSNFFSSYNYCNNHFQLDLSEDQEWF
FT                   ARNLDLKKVLHRALGDDVDPIELNMSLWHLYTQVIQKKNDIGLIGSETALPEDEQDEEV
FT                   TTPQLPKNTILYGPPGTGKTYCTIELAVRACEPAAYSLQEGKEENEKRRELKKVYDRLI
FT                   AEKRVRFITFHQSFGYEEFIEGLRAETTDDGNVRYEVKAGIFKQICEDAAFGHAGVQQK
FT                   LDEALARLQERLSESGSITLETLQGKAFQLAYKSQTTFGIFPSQSKKEDLGQGYNAYLK
FT                   NISLVYQNPQAKVHNPSYVRSILNYLIKQEGLPSNPQESVSEKRQNYVLIIDEINRGNI
FT                   SKIFGELITLIETSKRAGEPEALSVILPYSSSSFSVPNNLYLIGTMNTADRSLTALDTA
FT                   LRRRFEFEAMLPDITVLKETVVKGIDLPRLLQTLNDRIEVLYDREHTLGHAFFIPVVQV
FT                   KEDEDLAFERLKRIMRNKVLPLLEEYFYNDWQKIRMVLGDNQKSGNPQLQFVCEVKDQK
FT                   QFADLFGNNGTEDLHDIGASFHLAPEDDKVWDNPLAWQQIYAPHKGNPVSGE"
FT   misc_feature    403751..403774
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:ProSite:PS00017"
FT   CDS_pept        405109..406425
FT                   /transl_table=11
FT                   /locus_tag="YPO0388"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Deinococcus radiodurans hypothetical
FT                   protein DRB0144 TR:Q9RZI4 (EMBL:AE001826) (442 aa) fasta
FT                   scores: E(): 7.1e-30, 30.4% id in 395 aa, and to
FT                   Campylobacter jejuni hypothetical protein CJ0140 TR:Q9PIY7
FT                   (EMBL:AL139074) (443 aa) fasta scores: E(): 2.9e-21, 28.8%
FT                   id in 382 aa"
FT                   /db_xref="InterPro:IPR019292"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384L519"
FT                   /inference="similar to sequence:INSDC:AE001826"
FT                   /inference="similar to sequence:INSDC:AL139074"
FT                   /protein_id="CAL19069.1"
FT                   /translation="MKSRKDFTVFEYGHLISDKDSGRINNAVSLPPQLFEWLEQRCLKD
FT                   DADNTHRLLTLGSRGGVKTLQVKNYAGVISLPGNAFIEVLPKTGRRDENIDIARQQLLM
FT                   MLRTLKSFRHIATSASRVRTSKMPLMDVFIQQFIDSVQQIVRQGLKRDYLRQQDNLPWM
FT                   KGKLRVSAQISKNCVHRDRFQVEFDDYSSERPENRILKTAIDKIRRQISNPQLLLQVNS
FT                   LQVHFDDITPVGDVRIAFDQVRLDRHMRHYELALAWARLILMGQSPHCMQGDANAISLL
FT                   FPMEAVFESFVTAWMRHRYNDNWHVKAQVDSHTLVRLNGKGVFKLRPDIHLRPRGENGD
FT                   QAMICDVKWKMVESGKATLEQSQADLYQMLAYGVNYQEGIGDMLLIYPSHEGFSQPLPY
FT                   PYEFSHQKENPLRLWVVPFFIGDSLQSSDLRFPDGKILI"
FT   CDS_pept        406492..406722
FT                   /transl_table=11
FT                   /locus_tag="YPO0389"
FT                   /product="hypothetical protein"
FT                   /note="Doubtful CDS. No significant database hits"
FT                   /db_xref="UniProtKB/TrEMBL:Q74PU2"
FT                   /protein_id="CAL19070.1"
FT                   /translation="MRCLMFVRIFVCGYKCGYKLLVLKINNIDISRLYDISESGLRTIS
FT                   MKIKSPQGGFFLPKIQSQQGLTSLISQHKSI"
FT   CDS_pept        406969..407436
FT                   /transl_table=11
FT                   /locus_tag="YPO0390"
FT                   /product="hypothetical protein"
FT                   /note="No significant database hits to the full length CDS.
FT                   Similar to an internal region of Rhizobium sp insertion
FT                   element ISR1 hypothetical protein A SW:YIA_RHISP (P17986)
FT                   (278 aa) fasta scores: E(): 0.033, 37.2% id in 86 aa"
FT                   /db_xref="UniProtKB/TrEMBL:Q7CG33"
FT                   /protein_id="CAL19071.1"
FT                   /translation="MSLQARRCDRPVASHINTQLPASGLSSVLSAQGHLKRLLIQHGFG
FT                   QQLLESGVLFLKRLQTLNLGHLHTAILFTQGVKRGVGNGVLAAEFTGGYPGFSLAENTD
FT                   DLLVGKTLLHGDVLMWFMKTLLTSGSVNQRGAGQGGWYEVLASARVSFKGK"
FT   misc_feature    407444..411230
FT                   /note="Region of low GC% content, 30.41%. Possible
FT                   horizontal gene transfer"
FT   CDS_pept        407449..408774
FT                   /transl_table=11
FT                   /locus_tag="YPO0391"
FT                   /product="modification methylase"
FT                   /note="Similar to Micrococcus varians modification
FT                   methylase MvaI SW:MTMV_MICVA (P14244) (454 aa) fasta
FT                   scores: E(): 0, 29.6% id in 456 aa, and to Pyrococcus sp
FT                   GI-H PspGI restriction-modification system methylase
FT                   TR:O93645 (EMBL:AF067805) (433 aa) fasta scores: E():
FT                   1.6e-21, 30.3% id in 458 aa"
FT                   /db_xref="GOA:A0A384L594"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384L594"
FT                   /inference="similar to sequence:INSDC:AF067805"
FT                   /protein_id="CAL19072.1"
FT                   /translation="MNDIDKDNMLLNKVISNSKGDKAYWSFKGRAKRQYCHALIQYPAM
FT                   MVPAMQGELIDAVLEIDSNVTSIIDPFVGSGTTLGEAMRRGLDFVGMDINPLSILACEV
FT                   KSGPLYIDSFKEKFIFLLDKIRADLRVDIAVQIKNIDKWFTKEVQLDLSKIYRAIQDES
FT                   SKWARKVFWLCMSNTVRTVCNSRSSTFKLHIKSFNQIENIPNTLEVFTKNIEKSIVALC
FT                   EQKNILTEMGSLKRSISKSKIKIIHADTSKKMKKNIQCDLLVSSPPYGDNNTTVTYGQF
FT                   SYLSLKWIDEKDIDNLKIKGLLETQNKIDSSSLGGSLKGANEKMELLKYKSPTLLNTVK
FT                   EISKVNSENVKKLITFIFDLDLALDNALLYLRKNAYMIWTLGNRRISNIEVPLDRIMRE
FT                   ILEYKGCVFIHQIEREILSKRMAMKNSIANTMDKELILIMRK"
FT   CDS_pept        408824..409546
FT                   /transl_table=11
FT                   /locus_tag="YPO0392"
FT                   /product="hypothetical protein"
FT                   /note="Similar to N-terminal regions of Neisseria
FT                   meningitidis hypothetical protein NMA0428 TR:Q9JWD7
FT                   (EMBL:AL162753) (548 aa) fasta scores: E(): 6.4e-07, 27.7%
FT                   id in 260 aa, and to Campylobacter jejuni Hsp90 family heat
FT                   shock protein HtpG TR:Q9PHZ3 (EMBL:AL139075) (608 aa) fasta
FT                   scores: E(): 0.23, 25.1% id in 251 aa"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q7CG35"
FT                   /inference="similar to sequence:INSDC:AL162753"
FT                   /inference="similar to sequence:INSDC:AL139075"
FT                   /protein_id="CAL19073.1"
FT                   /translation="MVSTSLKFGGKIIEELSQKIPSSLFALNELVKNSYDAFSPDVTIT
FT                   VIPSELKIIISDYGNGMSVDEIHSLFHISKSTKKYGCEVSQNGIKRIVQGSKGLGFLSA
FT                   FKFGDKVEWKTCQNGICSVFSVKKSDLIYKDDVSGIKIPITTDSSNKNGTEIRIFTNQQ
FT                   DMDELLSDLSDEKIARKLAASMLDESFNVKIKIENKDKIISTSKLKSFLFECEQSQLFY
FT                   VKYNFSKEEIEFFHKGDK"
FT   CDS_pept        409656..410891
FT                   /transl_table=11
FT                   /locus_tag="YPO0393"
FT                   /product="hypothetical protein"
FT                   /note="Poor database hits, similar to internal regions of
FT                   Caenorhabditis elegans hypothetical protein ZC53.4
FT                   TR:Q23371 (EMBL:U47144) (1410 aa) fasta scores: E():
FT                   1.3,21.6% id in 375 aa, and Ureaplasma parvum hypothetical
FT                   protein UU293 TR:Q9PQJ8 (EMBL:AE002126) (1447 aa) fasta
FT                   scores: E(): 4.8, 21.4% id in 415 aa"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384K8I6"
FT                   /inference="similar to sequence:INSDC:U47144"
FT                   /inference="similar to sequence:INSDC:AE002126"
FT                   /protein_id="CAL19074.1"
FT                   /translation="MHDNALYPLVYINNNLFNNTIIFDPDLLRKKSSGASLPQMIGYVS
FT                   IQSQNKNIEFNSDRTYFVDNSITKNLVNSLKKLNETIQTKGSDLKNELKVGTPSSLTGK
FT                   SYPTEDVTSIRNKPASISIDRKKTIKFHIPSEQIDLNEYIYAVKDSSGNDINKNDVVTS
FT                   IEGSVTNSRILEAIEEPCELRVVFRYEDSVTGLVSADVFLCFEKKISNISGSKEEKSLF
FT                   TIQSASGYTVNTGTVSSIIYAIDKLYSLRERDGFLPLIACSIRSVFEISQDKLFRTHRF
FT                   LFPTFKTKIFTPETNKEMKDKLLGNIIHIIFLVKKNPKLLTKIAERLDISYSTFTNSLN
FT                   LDEFKSAVKYSHIGAHQSTKFLSKPKIEVCADTCGLFAVICDVLINMKKNDIIDLNATI
FT                   VNEADLNNFFRI"
FT   misc_feature    410610..410675
FT                   /note="Predicted helix-turn-helix motif with score 1280
FT                   (+3.55 SD) at aa 319-340, sequence KLLTKIAERLDISYSTFTNSLN"
FT   CDS_pept        complement(411235..411522)
FT                   /transl_table=11
FT                   /locus_tag="YPO0394"
FT                   /product="hypothetical protein"
FT                   /note="No significant database hits"
FT                   /db_xref="InterPro:IPR010732"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2W7Y5"
FT                   /protein_id="CAL19075.1"
FT                   /translation="MLTEDTAEAKGWLSSGQLREDVFTLLRVYLGCDYDASLTLTIPMN
FT                   LAPLPRMGDPLLMAGYNVMLGLREDNLDERPEKVTMKLGRIRDKSKLQKH"
FT   CDS_pept        <411962..>412054
FT                   /transl_table=11
FT                   /locus_tag="YPO0395"
FT                   /product="transposase (partial)"
FT                   /note="Probable gene remnant. Similar to N-terminal region
FT                   of Yersinia pestis probable transposase remnant protein
FT                   YPCD1.03C TR:Q9RI27 (EMBL:AL117189) (83 aa) fasta scores:
FT                   E(): 2.5e-09, 96.0% id in 25 aa, and to Escherichia coli
FT                   transposase IS21 TR:O82915 (EMBL:AB011549) (136 aa) fasta
FT                   scores: E(): 4.9e-09, 92.0% id in 25 aa"
FT                   /note="was marked partial"
FT                   /db_xref="UniProtKB/TrEMBL:Q7CG37"
FT                   /inference="similar to sequence:INSDC:AL117189"
FT                   /inference="similar to sequence:INSDC:AB011549"
FT                   /protein_id="CAL19076.1"
FT                   /translation="MLSREDFYMIKQMHQQGAYIIDIATLLAPVI"
FT   CDS_pept        412139..413551
FT                   /transl_table=11
FT                   /locus_tag="YPO0396"
FT                   /product="hypothetical protein"
FT                   /note="Similar to C-terminal regions of Xylella fastidiosa
FT                   hypothetical protein XF2734 TR:Q9P9Y6 (EMBL:AE004080) (1144
FT                   aa) fasta scores: E(): 0.00014, 24.4% id in 468 aa, and
FT                   Aeropyrum pernix hypothetical protein APE0110 TR:Q9YFZ1
FT                   (EMBL:AP000058) (919 aa) fasta scores: E(): 0.048, 23.2% id
FT                   in 452 aa. Contains coil-coiled domain at approx. residues
FT                   68 to 97"
FT                   /db_xref="UniProtKB/TrEMBL:Q0WJR5"
FT                   /inference="similar to sequence:INSDC:AE004080"
FT                   /inference="similar to sequence:INSDC:AP000058"
FT                   /protein_id="CAL19077.1"
FT                   /translation="MLSREDFYMIKQMRQQGAYIKLQEQANALAHIQALNFESIDLPTA
FT                   QRQLEELQARLDRLTHPQSDIAIAKAALDEAEARQKELERQYQQEVTACAGLKKDLERA
FT                   AMLSRKVHNIAKQGMTGALQALGAAHFPQVAPEQLDDIQDIEREHARQLQGRLNEVNDR
FT                   LQRLREELIKRMSDAKKEDTGALSEVGRELDDIPNYLARLQTLTEEALPEKLKRFQEYL
FT                   NRSSDDGVTQLLSHIDHEVALIEERLEALNDTMRRVDFQSGRYLCLIAKPVVHDSMRTL
FT                   LRAQRQLNSARFVDDDGESQYKALQALVGLLKDACERNRTQGARALLDPRFRLEFAVSV
FT                   IERETGSVIETRTGSQGGSGGEKEIIASYVLTASLSYALCPDGRTKPLFGTIILDEAFS
FT                   RSSHVVAGRIIAALREFGLHAVFITPNKEMRLLRHHTRSAIVVHRRGPDSSLVSLSWED
FT                   LNEHHQQRNRAI"
FT   CDS_pept        413548..414702
FT                   /transl_table=11
FT                   /locus_tag="YPO0397"
FT                   /product="hypothetical protein"
FT                   /note="Weak database hits to the full length CDS. Similar
FT                   to Xylella fastidiosa hypothetical protein XF2735 TR:Q9P9Y5
FT                   (EMBL:AE004080) (401 aa) fasta scores: E(): 8.3e-09, 27.8%
FT                   id in 389 aa"
FT                   /db_xref="InterPro:IPR014544"
FT                   /db_xref="InterPro:IPR024534"
FT                   /db_xref="InterPro:IPR024537"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384LPL9"
FT                   /inference="similar to sequence:INSDC:AE004080"
FT                   /protein_id="CAL19078.1"
FT                   /translation="MKSPIDIGRQLARQWHQSKVRSERLLTPGCWPLQLPIGKPSAKIF
FT                   TANTQAVQRHVEVWRQVSIGLVEWESVSYRASLTPVSIPVRWCLRPPSEWINAASNRQV
FT                   SQEFQHLEQLVAQVDKSFHALLINQRALWLHKDPHEVITAANLACKLTPGCAQGRPLRL
FT                   LSESGVDTKFFERNYSLLTKLLDERFEGEASGQGLATFLDAFEESSHWVLVTPLAPGIL
FT                   PFNMSKVTTTELTSVDLPCSRILIVENEHCIHQLPQLPDTIAILGSGLDLQWLISPNLK
FT                   SKSIGYWGDMDTWGLLMLARARAFQPAITALLMGRLLFEHYASGSAVAEPVNAQQAVPE
FT                   GLHHHEADFYRYLLSQPRGRLEQEYLPRDVVEMALTEWVGHISL"
FT   CDS_pept        complement(414848..415894)
FT                   /transl_table=11
FT                   /locus_tag="YPO0398"
FT                   /product="M48 peptidase family protein"
FT                   /note="Similar to Deinococcus radiodurans conserved
FT                   hypothetical protein DR0190 TR:Q9RXW5 (EMBL:AE001881) (402
FT                   aa) fasta scores: E(): 1.2e-07, 26.6% id in 379 aa.
FT                   C-terminal region is similar to the N-terminus of
FT                   Myxococcus xanthus hypothetical protein TR:O30615
FT                   (EMBL:AF013216) (478 aa) fasta scores: E(): 4.6e-07, 23.7%
FT                   id in 253 aa"
FT                   /db_xref="GOA:Q0WJR3"
FT                   /db_xref="InterPro:IPR001915"
FT                   /db_xref="UniProtKB/TrEMBL:Q0WJR3"
FT                   /inference="similar to sequence:INSDC:AE001881"
FT                   /inference="similar to sequence:INSDC:AF013216"
FT                   /protein_id="CAL19079.1"
FT                   /translation="MIVEGYYQYPGRAAREAARLLLNEIGDNVTLLRDGEQHYFSLSQL
FT                   NVSSSLGSIPLNLTFPDGGRFVPSDDALFRKWLYQQRSPGVVHRLERHKSGVLLTLLIT
FT                   PLLILAYIYWLLPWASSEIALRIPTTAEQKLGEHSLEWLQQSGFKPSALPAERQEAIQQ
FT                   LFLQVMPPQMRQERTPLKLVLMTAPTTANAFMLPDGTMVISDDLIKLTTSDDALAAVML
FT                   HEMGHHAHRHSMQMVVRSSLVALTFMWMTGDVNGIGDTLLQSAAFIHEMQFSRTIESEA
FT                   DSWAIAEMQREKRSLLAMEDIYHALQQTTTPEEAETRAGIPEWLSSHPDMPARLDVIRA
FT                   AREKMAQE"
FT   misc_feature    complement(414881..415393)
FT                   /note="Pfam match to entry PF01435 Peptidase_M48, Peptidase
FT                   family M48, score -12.20, E-value 3.6e-05"
FT                   /inference="protein motif:PF01435"
FT   misc_feature    complement(415541..415606)
FT                   /note="1 probable transmembrane helix predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        complement(415905..417101)
FT                   /transl_table=11
FT                   /locus_tag="YPO0399"
FT                   /product="putative membrane protein"
FT                   /note="Similar to Escherichia coli hypothetical protein
FT                   YjgN SW:YJGN_ECOLI (P39338) (393 aa) fasta scores: E():
FT                   2.5e-30, 30.9% id in 379 aa, and to Salmonella typhimurium
FT                   hypothetical protein YjgN SW:YJGN_SALTY (Q08022) (314 aa)
FT                   fasta scores: E(): 1.8e-26, 30.7% id in 316 aa. S.
FT                   typhimurium protein appears to be truncated at the
FT                   C-terminus in comparison to E. coli and Y. pestis proteins"
FT                   /db_xref="InterPro:IPR010295"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384LMU6"
FT                   /inference="protein motif:TMHMM:2.0"
FT                   /protein_id="CAL19080.1"
FT                   /translation="MADNASQNKSLHRVAFKGEGGEYFSIWLVNLLLTIITLGVYSAWA
FT                   TVRRRRYFYGNTELNGDRFDYHAEPIEILKGRLMVIGGVILFYILLAIAPTLGLLVALV
FT                   LLALIPWIIIRSWRYNAIMTSYRGVRFNYHCQTGQAYWALLFCPLLLILGLYAVIIVMA
FT                   MFLGSVASTPSTAITLIVVSAILLVPLLAVINGIVSTLQHSLYVNNLYFGNSSFISTLK
FT                   KSAFIKIAFFSVLIFIPFFFVAMMFAGAFFADLFQSALNGSIANENKTAMLIIQNASNL
FT                   LFMMLMLLLGTMVSSSYRIVAQRNYLFSQTTLQGDIKLRSSMKLLSYMGLLMTNSLITV
FT                   CSLGLATPIAEVRHARYMANATEIEGDLSLLNIHAHQDTANSALAEEAVQALDLGTGF"
FT   misc_feature    complement(416052..416117)
FT                   /locus_tag="YPO0399"
FT                   /note="one of 8 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    complement(416220..416285)
FT                   /locus_tag="YPO0399"
FT                   /note="one of 8 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    complement(416346..416411)
FT                   /locus_tag="YPO0399"
FT                   /note="one of 8 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    complement(416505..416570)
FT                   /locus_tag="YPO0399"
FT                   /note="one of 8 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    complement(416616..416681)
FT                   /locus_tag="YPO0399"
FT                   /note="one of 8 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    complement(416745..416810)
FT                   /locus_tag="YPO0399"
FT                   /note="one of 8 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    complement(416826..416882)
FT                   /locus_tag="YPO0399"
FT                   /note="one of 8 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    complement(416967..417032)
FT                   /locus_tag="YPO0399"
FT                   /note="one of 8 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        417807..418343
FT                   /transl_table=11
FT                   /locus_tag="YPO0400"
FT                   /product="hypothetical protein"
FT                   /note="No significant database hits"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384KJ03"
FT                   /protein_id="CAL19081.1"
FT                   /translation="MPIPERLTPGKATKNRTQRLLKLLDEISSTLEDNGDQENDRVREL
FT                   ILQWNEIACREHDFHEFRDFHAYTSKDDFIISAQRKAKYIEDFQYIESIELVNVIAQAE
FT                   GTEPDIHYAVDLLDKNFPDGDASDLIFWPNYWFQDENMLHIELTPEETVGYLMARSGRT
FT                   LQGAPEIELRYPYYN"
FT   CDS_pept        418345..419220
FT                   /transl_table=11
FT                   /locus_tag="YPO0401"
FT                   /product="putative transcriptional regulator"
FT                   /note="Similar to Salmonella typhimurium regulatory protein
FT                   PocR SW:POCR_SALTY (Q05587) (303 aa) fasta scores: E():
FT                   2.8e-09, 38.4% id in 112 aa and to Escherichia coli
FT                   hypothetical transcriptional regulator YioO SW:YIJO_ECOLI
FT                   (P32677) (283 aa) fasta scores: E(): 0, 53.9% id in 280 aa"
FT                   /db_xref="GOA:A0A0H2W8M6"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2W8M6"
FT                   /protein_id="CAL19082.1"
FT                   /translation="MTIKLISQLTALVSEPNSIHHVYFAKSLRAAPLLAQQVNFPRMEL
FT                   IIEGSQAMIWDRLYDDFHHKDEYIMHRGDILFIPSGGWNIPQWEQPVITLSILFGKQSL
FT                   GFSLLSWDGESVVHKEMESVLRRGPRVGAYILQALNEMSLMQREQTTVQLIVRSLISHC
FT                   IDLLRNQVKTPSRSQTLFESIREYIERNYSEPLTRESVAHVFHISPNYLSHLFRNAGNI
FT                   GFNESVNSARLENAKILLKFYEMKIKEVANVCGFIDSNYFCRLFRKETELTPSEYRQQY
FT                   RSNMMERDVI"
FT   misc_feature    418927..419187
FT                   /note="Pfam match to entry PF00165 HTH_AraC, Bacterial
FT                   regulatory helix-turn-helix proteins, araC family, score
FT                   111.60, E-value 1.5e-29"
FT                   /inference="protein motif:PF00165"
FT   misc_feature    418930..418995
FT                   /note="Predicted helix-turn-helix motif with score 1868
FT                   (+5.55 SD) at aa 196-217, sequence LTRESVAHVFHISPNYLSHLFR"
FT   misc_feature    419038..419166
FT                   /note="PS00041 Bacterial regulatory proteins, araC family
FT                   signature."
FT                   /inference="protein motif:ProSite:PS00041"
FT   CDS_pept        complement(419213..419557)
FT                   /transl_table=11
FT                   /locus_tag="YPO0402"
FT                   /product="PTS system, IIB component"
FT                   /EC_number="2.7.1.69"
FT                   /note="Similar to many carbohydrate phosphotransferase
FT                   system IIB components e.g. Escherichia coli PTS
FT                   system,fructose-like-2 IIB component 2 FrwD SW:PTWX_ECOLI
FT                   (P32676) (113 aa) fasta scores: E(): 3.2e-23, 52.7% id in
FT                   110 aa"
FT                   /db_xref="GOA:A0A384LJ86"
FT                   /db_xref="InterPro:IPR003353"
FT                   /db_xref="InterPro:IPR003501"
FT                   /db_xref="InterPro:IPR013011"
FT                   /db_xref="InterPro:IPR036095"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384LJ86"
FT                   /protein_id="CAL19083.1"
FT                   /translation="MTIKLVAVTACVSGVAHTYMVAERLDKLCLQLKWQLKVETQGALG
FT                   VEYSLTEDDILQADAVILINDVAIKEQERFQNCRCVQADIQTFLCHPEKILAATKKVIS
FT                   SPKTVSIVIK"
FT   misc_feature    complement(419237..419548)
FT                   /note="Pfam match to entry PF02379 PTS_IIB_fruc, , score
FT                   143.20, E-value 4.7e-39"
FT                   /inference="protein motif:PF02379"
FT   CDS_pept        complement(419650..419970)
FT                   /transl_table=11
FT                   /locus_tag="YPO0403"
FT                   /product="PTS system, IIB component"
FT                   /note="Similar to many carbohydrate phosphotransferase IIB
FT                   components e.g. Escherichia coli PTS system,fructose-like-2
FT                   IIB component 1 FrwB, SW:PTWB_ECOLI (P32673) (106 aa) fasta
FT                   scores: E(): 0, 82.7% id in 104 aa. Similar to part of
FT                   Rhodobacter capsulatus PTS system,fructose-specific IIBC
FT                   component FruA SW:PTFB_RHOCA (P23387) (578 aa) fasta
FT                   scores: E(): 6.3e-16, 47.4% id in 97 aa and to Escherichia
FT                   coli PTS system, fructose-specific IIBC component FruA,
FT                   PtsF, SW:PTFB_ECOLI (P20966) (563 aa) fasta scores: E():
FT                   1e-15, 49.5% id in 97 aa"
FT                   /db_xref="GOA:A0A384L5K2"
FT                   /db_xref="InterPro:IPR003353"
FT                   /db_xref="InterPro:IPR003501"
FT                   /db_xref="InterPro:IPR013011"
FT                   /db_xref="InterPro:IPR036095"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384L5K2"
FT                   /protein_id="CAL19084.1"
FT                   /translation="MTNIIAITACPSGVAHTYMAAEALERAARAKGWECKVETQGSIGV
FT                   ENKLTAEDVAAADMVILTKDIGILFEERFAGKVIVRIAVSDAVKRADAIMDKIAAYLEK
FT                   NT"
FT   misc_feature    complement(419653..419964)
FT                   /note="Pfam match to entry PF02379 PTS_IIB_fruc, , score
FT                   196.20, E-value 5e-55"
FT                   /inference="protein motif:PF02379"
FT   CDS_pept        complement(420311..421396)
FT                   /transl_table=11
FT                   /locus_tag="YPO0404"
FT                   /product="PTS system, IIC component"
FT                   /EC_number="2.7.1.69"
FT                   /note="Similar to many carbohydrate phosphotransferase IIC
FT                   components e.g. part of Escherichia coli PTS
FT                   system,fructose-specific IIBC component FruA SW:PTFB_ECOLI
FT                   (P20966) (563 aa) fasta scores: E(): 0, 40.7% id in 329 aa
FT                   and to Escherichia coli PTS system, fructose-like-2 IIC
FT                   component FrwC SW:PTWC_ECOLI (P32672) (359 aa) fasta
FT                   scores: E(): 0, 76.5% id in 358 aa"
FT                   /db_xref="GOA:A0A384KPQ0"
FT                   /db_xref="InterPro:IPR003352"
FT                   /db_xref="InterPro:IPR006327"
FT                   /db_xref="InterPro:IPR013014"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384KPQ0"
FT                   /inference="protein motif:TMHMM:2.0"
FT                   /protein_id="CAL19085.1"
FT                   /translation="MMKELINILKNTRQHLMTGVSYMIPFVVAGGILLALSVMLYGKGA
FT                   VPEVASDPNLKKLFDIGVVGLTLMVPFLAAYIGYAIADRAALAPAAIGAWVGASFGAGF
FT                   FGAIIAGLLGGIIVFYLKKISVPKTLRSVMPIFVIPIVGTLLTAGIMMWGLGEPIGILT
FT                   ANLTQWLQGMQQGSVILLAIIMGLMLAFDMGGPVNKVAYAFMLICVAQGVYTLVAVAAV
FT                   AIATPPLGMGLATLIGRKYYSVEEREAGKAAMLMGCVGITEGAIPFAAADPLRVIPANM
FT                   IGSACAAVTAVLFGVQCYAAWGGLIVLPVVDGKLGFVVALLVGMVVTALIANLLKRFTA
FT                   QKQPGRSSAEGDVNMDFDIKN"
FT   misc_feature    complement(420392..420448)
FT                   /locus_tag="YPO0404"
FT                   /note="one of 8 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    complement(420479..420544)
FT                   /locus_tag="YPO0404"
FT                   /note="one of 8 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    complement(420539..420571)
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:ProSite:PS00013"
FT   misc_feature    complement(420548..421342)
FT                   /note="Pfam match to entry PF02378 PTS_EIIC, , score
FT                   86.60,E-value 5.2e-22"
FT                   /inference="protein motif:PF02378"
FT   misc_feature    complement(420686..420751)
FT                   /locus_tag="YPO0404"
FT                   /note="one of 8 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    complement(420812..420868)
FT                   /locus_tag="YPO0404"
FT                   /note="one of 8 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    complement(420932..420997)
FT                   /locus_tag="YPO0404"
FT                   /note="one of 8 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    complement(421043..421108)
FT                   /locus_tag="YPO0404"
FT                   /note="one of 8 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    complement(421148..421213)
FT                   /locus_tag="YPO0404"
FT                   /note="one of 8 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    complement(421274..421339)
FT                   /locus_tag="YPO0404"
FT                   /note="one of 8 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        421758..424316
FT                   /transl_table=11
FT                   /locus_tag="YPO0405"
FT                   /product="putative phosphoenolpyruvate-protein
FT                   phosphotransferase"
FT                   /EC_number="2.7.3.9"
FT                   /note="Similar to e.g. Escherichia coli
FT                   phosphoenolpyruvate-protein phosphotransferase
FT                   PtsI,SW:PT1_ECOLI (P08839) (575 aa) fasta scores: E(): 0,
FT                   36.0% id in 583 aa, but has both N- and C-terminal
FT                   extensions. Also similar to Escherichia coli
FT                   phosphoenolpyruvate-protein phosphotransferase
FT                   PtsA,SW:PT1A_ECOLI (P32670) (711 aa) fasta scores: E(): 0,
FT                   64.5% id in 726 aa and to Escherichia coli putative
FT                   phosphoenolpyruvate-protein phosphotransferase
FT                   YpdD,SW:YPDD_ECOLI (P77439) (831 aa) fasta scores: E(): 0,
FT                   41.5% id in 853 aa"
FT                   /db_xref="GOA:Q0WJQ6"
FT                   /db_xref="InterPro:IPR000032"
FT                   /db_xref="InterPro:IPR000121"
FT                   /db_xref="InterPro:IPR001020"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR006318"
FT                   /db_xref="InterPro:IPR008279"
FT                   /db_xref="InterPro:IPR008731"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="InterPro:IPR018274"
FT                   /db_xref="InterPro:IPR023151"
FT                   /db_xref="InterPro:IPR035895"
FT                   /db_xref="InterPro:IPR036618"
FT                   /db_xref="InterPro:IPR036637"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:Q0WJQ6"
FT                   /protein_id="CAL19086.1"
FT                   /translation="MTKQVTFICGLLNGVHARPASHIERVCNRFQSRFHWYNPRSGIVG
FT                   DGKSVLSLIAANILLGDECQVTIEGEDEQVAFERLSIFIEHELPHADPILPKREESAEW
FT                   EPLPASLAHLHPTLLRARSVSPGTACGKLLSLIRADLNALGDLPVAQGIEREQQMLADG
FT                   VAQLGKAWESLLVANSSTAANSSTTENNSTTENNSTTRAIREVHRSLLRDGTFRQRLLS
FT                   HIVAGESCATAIVATAAYFSQQLALAANTYLRERELDIRDVSFQLLQQIYGEQRFPSQQ
FT                   ALSEDSLCIADELTPSQFLALDKRYLKGLLLGRGGSTSHTVILARSFNIPTLVGVDAAA
FT                   LQPYINQSLQIDGELGLVVCLLDEPVRRYYRQEQWLHDQLREQQSRYQNMPGRTLDGVR
FT                   MVVAANITHAVEVEGAFNQGAESIGLFRTEILYMDRAAAPSEEELYTLYAQALGAAKGK
FT                   PIIIRTIDIGGDKPVSYLNIPAESNPFLGYRAVRIYHEFLSLFHTQLRAILRASMHGPL
FT                   KIMIPMISSMEEILWVKDQLAEVKQSLRISHLQFDETVPLGMMLEVPSVMFIIDQCCEE
FT                   MDFLSIGSNDLTQYLLAVDRDNAKVSEHYHCLPPALLRALDYAVCEVHRHGKWIGLCGE
FT                   LAAKDSVLPLLVAMGLDEISMSASFIGATKARLAKLDRGECRLLLNRVMACRTSREVEY
FT                   LLVQYDGEQRDEPLIIPECITLGADWRSKEEVIKGMVDNLLLAGRCRYPRKLAADVWAR
FT                   EALFSTGLGFGFAIPHAQSEHIEQSTISVAKLAKPVNWGEEDALFVMMLTLNKQASGDQ
FT                   HMRIFSKLARRIMHEGFRDALVSAGTAQQVEMLLKHELEL"
FT   misc_feature    421797..421820
FT                   /note="PS00369 PTS HPR component histidine phosphorylation
FT                   site signature."
FT                   /inference="protein motif:ProSite:PS00369"
FT   misc_feature    421881..421904
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:ProSite:PS00017"
FT   misc_feature    422619..423662
FT                   /note="Pfam match to entry PF00391
FT                   PEP-utilizers,PEP-utilizing enzymes, score 499.90, E-value
FT                   2e-146"
FT                   /inference="protein motif:PF00391"
FT   misc_feature    422700..422735
FT                   /note="PS00370 PEP-utilizing enzymes phosphorylation site
FT                   signature."
FT                   /inference="protein motif:ProSite:PS00370"
FT   misc_feature    423489..423545
FT                   /note="PS00742 PEP-utilizing enzymes signature 2."
FT                   /inference="protein motif:ProSite:PS00742"
FT   misc_feature    424011..424121
FT                   /note="Pfam match to entry PF00359
FT                   PTS_EIIA_2,phosphoenolpyruvate-dependent sugar
FT                   phosphotransferase system, EIIA 2, score 18.20, E-value
FT                   0.0015"
FT                   /inference="protein motif:PF00359"
FT   CDS_pept        complement(424378..424869)
FT                   /transl_table=11
FT                   /locus_tag="YPO0406"
FT                   /product="putative exported protein"
FT                   /note="Similar to Escherichia coli hypothetical protein
FT                   YjjA SW:YJJA_ECOLI (P18390) (165 aa) fasta scores: E():
FT                   4.3e-21, 45.6% id in 158 aa"
FT                   /db_xref="InterPro:IPR019637"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384KII1"
FT                   /protein_id="CAL19087.1"
FT                   /translation="MDNIHRLFLALAFSAPLVTGAAHANSLLDSVKSTAEQYGKSAGSS
FT                   SSLPSMSSLTNLLNGGDKALSAGTMNNATGILQYCVQNNVLSSDGTTAIKDQLMSKLGI
FT                   SGTEAAKSTDYEEGLGGLLKTSEGKSVNLNDLGTGQITEKIKTKACDLVLKQGKSFLLK
FT                   "
FT   CDS_pept        complement(425170..425460)
FT                   /transl_table=11
FT                   /locus_tag="YPO0407"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to e.g. Escherichia coli hypothetical
FT                   protein YneC SW:YNEC_ECOLI (P76144) (96 aa) fasta scores:
FT                   E(): 2.6e-30, 75.0% id in 96 aa and to Pseudomonas
FT                   aeruginosa hypothetical protein PA0709 TR:AAG04098
FT                   (EMBL:AE004506) (98 aa) fasta scores: E(): 1.5e-05, 40.2%
FT                   id in 87 aa"
FT                   /db_xref="GOA:Q7CG46"
FT                   /db_xref="InterPro:IPR007138"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR033672"
FT                   /db_xref="PDB:2GFF"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7CG46"
FT                   /inference="similar to sequence:INSDC:AE004506"
FT                   /protein_id="CAL19088.1"
FT                   /translation="MHVTLVEINVKEDKVDQFIEVFRANHLGSIREAGNLRFDVLRDEH
FT                   IPTRFYIYEAYTDEAAVAIHKTTPHYLQCVEQLAPLMTGPRKKTVFIGLMP"
FT   CDS_pept        complement(425524..426399)
FT                   /transl_table=11
FT                   /locus_tag="YPO0408"
FT                   /product="putative aldolase"
FT                   /note="Similar to many putative aldolases e.g. Escherichia
FT                   coli putative aldolase YneB, SW:YNEB_ECOLI (P76143) (291
FT                   aa) fasta scores: E(): 0, 83.8% id in 290 aa"
FT                   /db_xref="GOA:Q7CG47"
FT                   /db_xref="InterPro:IPR002915"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR033673"
FT                   /db_xref="InterPro:IPR041720"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7CG47"
FT                   /protein_id="CAL19089.1"
FT                   /translation="MADLDDIKDGKDFGIGIPQQNPAFTLKGSGSLDWGMQSRLARIFN
FT                   PKTNRTVMLAFDHGYFQGPTTGLERIDINIAPLFEYADVLMCTRGILRSVVPAAANRPV
FT                   VLRASGANSILTYLSNEAVAVAMEDAVRLNACAVAAQVYIGTEHEHQSIKNIIQLIDQG
FT                   MRYGMPTMAVTGVGKDMVRDQRYFSLASRIAAEMGAQVIKTYYVDSGFERIAAGCPVPI
FT                   VIAGGKKLPERDALEMCYQAIDQGASGVDMGRNIFQSDAPIAMLKAVHAIVHKNENAAA
FT                   AYQLFLHEQN"
FT   misc_feature    complement(425578..426252)
FT                   /note="Pfam match to entry PF01791
FT                   DeoC,Deoxyribose-phosphate aldolase, score -1.80, E-value
FT                   8.7e-07"
FT                   /inference="protein motif:PF01791"
FT   CDS_pept        complement(426455..427474)
FT                   /transl_table=11
FT                   /locus_tag="YPO0409"
FT                   /product="putative periplasmic solute-binding protein"
FT                   /note="Similar to many ABC transport binding proteins e.g.
FT                   Escherichia coli D-allose-binding periplasmic protein
FT                   precursor AlsB SW:ALSB_ECOLI (P39265) (311 aa) fasta
FT                   scores: E(): 3.4e-06, 24.4% id in 299 aa and to Escherichia
FT                   coli hypothetical protein TR:P76142 (EMBL:AE000249) (340
FT                   aa) fasta scores: E(): 0, 84.4% id in 340 aa"
FT                   /db_xref="GOA:Q74PW2"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="InterPro:IPR030159"
FT                   /db_xref="PDB:3T95"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q74PW2"
FT                   /inference="similar to sequence:INSDC:AE000249"
FT                   /protein_id="CAL19090.1"
FT                   /translation="MRTQRLKKLALVCALGFACITTAQAAERIAFIPKLVGVGFFTSGG
FT                   KGAVDAGKALGVDVTYDGPTEPSVSGQVQLINNFVNQGYNAIVVSAVSPDGLCPALKRA
FT                   MQRGVKILTWDSDTKPECRSVYINQGTPNQLGSMLVDMAANQVKKEQAKVAFFYSSPTV
FT                   TDQNQWVNEAKKKIQQEHPGWEIVTTQFGYNDATKSLQTAEGILKAYADLDAIIAPDAN
FT                   ALPAAAQAAENLKRANVAIVGFSTPNVMRPYVERGTVKEFGLWDVVNQGKISVYVANEM
FT                   LKKGDLNVGDKIDIPNIGVVEVSPNRVQGYDYEAKGNGIVLLPQRVIFTKENISKYDF"
FT   misc_feature    complement(427382..427447)
FT                   /note="1 probable transmembrane helix predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    complement(427418..427450)
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:ProSite:PS00013"
FT   regulatory      complement(427481..427484)
FT                   /note="possible RBS"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(427540..428541)
FT                   /transl_table=11
FT                   /locus_tag="YPO0410"
FT                   /product="putative ABC transporter permease protein"
FT                   /note="Similar to many ABC transporter permeases e.g.
FT                   Bacillus subtilis ribose transport system permease protein
FT                   RbsC SW:RBSC_BACSU (P36948) (323 aa) fasta scores: E():
FT                   7.1e-26, 32.7% id in 300 aa and to Escherichia coli
FT                   hypothetical ABC transporter permease protein YdeZ
FT                   SW:YDEZ_ECOLI (P77651) (330 aa) fasta scores: E(): 0, 81.3%
FT                   id in 321 aa"
FT                   /db_xref="GOA:Q7CG48"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7CG48"
FT                   /inference="protein motif:TMHMM:2.0"
FT                   /protein_id="CAL19091.1"
FT                   /translation="MNLYRRYGWELTLAALLVLEILLFGLSNSRMLDINVLLFSTSDFI
FT                   CIGIVALPLTMVIVSGGIDISFGSTIGLCAIFLGIVFQAGVPMSVAIPLTVLVGALCGL
FT                   INAGLILYTGVNPLVITLGTLYLFGGSALLLSGLSGATGYEGIGGFPAAFTDFANQTLF
FT                   GLPIPLVIFMLCVLLFWLLMHRTHSGRHVFLIGQSSRVARYSALPIARTLCMLYAMTGV
FT                   ASAISAILLVSYFGSARSDLGASFLMPAITAVVLGGANIYGGSGSILGTALAVLLVGYL
FT                   QQGLQMIGTPNQISSALSGALLILVVVGRSISLHRHLIYEWLQRRRSRKASA"
FT   misc_feature    complement(427603..427659)
FT                   /locus_tag="YPO0410"
FT                   /note="one of 9 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    complement(427699..427791)
FT                   /locus_tag="YPO0410"
FT                   /note="one of 9 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    complement(427837..427902)
FT                   /locus_tag="YPO0410"
FT                   /note="one of 9 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    complement(427993..428058)
FT                   /locus_tag="YPO0410"
FT                   /note="one of 9 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    complement(428119..428184)
FT                   /locus_tag="YPO0410"
FT                   /note="one of 9 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    complement(428206..428271)
FT                   /locus_tag="YPO0410"
FT                   /note="one of 9 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    complement(428284..428346)
FT                   /locus_tag="YPO0410"
FT                   /note="one of 9 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    complement(428368..428433)
FT                   /locus_tag="YPO0410"
FT                   /note="one of 9 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    complement(428464..428520)
FT                   /locus_tag="YPO0410"
FT                   /note="one of 9 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        complement(428538..429593)
FT                   /transl_table=11
FT                   /locus_tag="YPO0411"
FT                   /product="putative ABC transporter permease protein"
FT                   /note="Similar to many ABC transporter permeases e.g.
FT                   Escherichia coli ribose transport system permease protein
FT                   RbsC SW:RBSC_ECOLI (P04984) (321 aa) fasta scores: E():
FT                   2.3e-25, 33.2% id in 307 aa and to Escherichia coli
FT                   hypothetical ABC transporter permease protein YdeY
FT                   SW:YDEY_ECOLI (P77672) (342 aa) fasta scores: E(): 0, 75.7%
FT                   id in 350 aa"
FT                   /db_xref="GOA:Q7CG49"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7CG49"
FT                   /inference="protein motif:TMHMM:2.0"
FT                   /protein_id="CAL19092.1"
FT                   /translation="MLKFIQNNREGTALLAILTLFALLGIIDRNYFSLQTFTMIFSSAQ
FT                   ILILLAIGATLVMLTRNIDVSVGSITGLCAVTVGMALNAGFGLAASCLFALLVGMVAGF
FT                   FNGILVTWLRIPAIVATLGTLGLYRGLMLLLTGGKWIEGLPADLKSLSTPILFSISPIG
FT                   WLTMLLILAMAWLLGKTAFGRSFYATGDNLQGARQLGVRTDSLRIFAFSMNGVMAALAG
FT                   IVFASQIGFIPNQTGNGLEMKAIAACVLGGISLLGGTGTIIGAILGAFLLTQIDSVLVL
FT                   LRLPAWWNDFIAGLVLLGVLVFDGRLRCAVERNIRQQKYARFTAQAIISDKKPTVSDNN
FT                   PAASNKKKAAL"
FT   misc_feature    complement(428691..428756)
FT                   /locus_tag="YPO0411"
FT                   /note="one of 9 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    complement(428778..428843)
FT                   /locus_tag="YPO0411"
FT                   /note="one of 9 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    complement(428904..428969)
FT                   /locus_tag="YPO0411"
FT                   /note="one of 9 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    complement(429063..429128)
FT                   /locus_tag="YPO0411"
FT                   /note="one of 9 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    complement(429189..429254)
FT                   /locus_tag="YPO0411"
FT                   /note="one of 9 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    complement(429270..429335)
FT                   /locus_tag="YPO0411"
FT                   /note="one of 9 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    complement(429318..429350)
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:ProSite:PS00013"
FT   misc_feature    complement(429348..429398)
FT                   /locus_tag="YPO0411"
FT                   /note="one of 9 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    complement(429420..429485)
FT                   /locus_tag="YPO0411"
FT                   /note="one of 9 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    complement(429498..429554)
FT                   /locus_tag="YPO0411"
FT                   /note="one of 9 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        complement(429587..431170)
FT                   /transl_table=11
FT                   /locus_tag="YPO0412"
FT                   /product="putative ABC transporter ATP-binding protein"
FT                   /note="Similar to many ABC transporter ATP-binding proteins
FT                   e.g. Escherichia coli putative ABC transporter ATP-binding
FT                   protein Ego SW:EGO_ECOLI (P77257) (511 aa) fasta scores:
FT                   E(): 0, 66.0% id in 497 aa and to Bacillus
FT                   stearothermophilus L-arabinose transport, ATP binding
FT                   protein AraG TR:Q9S472 (EMBL:AF160811) (513 aa) fasta
FT                   scores: E(): 0, 35.7% id in 507 aa"
FT                   /db_xref="GOA:Q0WJP9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030281"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0WJP9"
FT                   /inference="similar to sequence:INSDC:AF160811"
FT                   /protein_id="CAL19093.1"
FT                   /translation="MPHTVATPPPLLQVRGISKQFSGVVVLKSIDFTLQPGQVHALLGG
FT                   NGAGKSTLMKIIAGILPPDTGVIEMNGQPCFNLTPAKAHQLGIYLVPQEPMLFANLSVQ
FT                   ENILFRLPKHQADKKKMAQLLKNLGCHLDLSVSAGSLEVADQQLVEIMRGLIRDSHILI
FT                   LDEPTASLTPAETHRLFSQIRMLLQQGVGVVFISHKLPEIRQLADWVSVMRDGGIALSG
FT                   ATADFSTEDMIQAMTPEAQKGALTDSQKLWLELPGNRRAQSHAQSQQPVIHVHDLSGEG
FT                   FAHISFHVQAGEILGLAGVVGAGRTELAETLYGLRPASTGNVILEEVNITAMKTANRLA
FT                   AGLVYLPEDRQASGLYLDAPLSWNVCALAHDRQGLWTQPAQEAAVLERYRRALNIKFSH
FT                   LEQPVRTLSGGNQQKLLIAKCLEANPLLLIIDEPTRGVDVSARSDIYQLIRSIAEQQVA
FT                   IIFISSDLEEVVQMADRVLVMHQGEINGALSGAAMNVDTIMHMAFGEHRSASEPQGGTA
FT                   SSAENKGASC"
FT   misc_feature    complement(429725..430297)
FT                   /note="Pfam match to entry PF00005 ABC_tran, ABC
FT                   transporter, score 101.80, E-value 1.4e-26"
FT                   /inference="protein motif:PF00005"
FT   misc_feature    complement(429908..429952)
FT                   /note="PS00211 ABC transporters family signature."
FT                   /inference="protein motif:ProSite:PS00211"
FT   misc_feature    complement(430523..431062)
FT                   /note="Pfam match to entry PF00005 ABC_tran, ABC
FT                   transporter, score 165.90, E-value 6.8e-46"
FT                   /inference="protein motif:PF00005"
FT   misc_feature    complement(431018..431041)
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:ProSite:PS00017"
FT   CDS_pept        complement(431280..431591)
FT                   /transl_table=11
FT                   /locus_tag="YPO0413"
FT                   /product="putative membrane protein"
FT                   /note="Doubtfull CDS. No significant database matches"
FT                   /db_xref="GOA:Q74PW6"
FT                   /db_xref="UniProtKB/TrEMBL:Q74PW6"
FT                   /inference="protein motif:TMHMM:2.0"
FT                   /protein_id="CAL19094.1"
FT                   /translation="MLLPGYLYSSLDDRGFSFTAGFSFIIADCSLIAAFLPVDLSYLFI
FT                   FLICLSFLPAYLFSHCPSVRHRLKPLRNECLILIDNHAISLMIIIEHILIKIFLFIKL"
FT   misc_feature    complement(431289..431354)
FT                   /locus_tag="YPO0413"
FT                   /note="one of 3 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    complement(431400..431465)
FT                   /locus_tag="YPO0413"
FT                   /note="one of 3 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    complement(431481..431546)
FT                   /locus_tag="YPO0413"
FT                   /note="one of 3 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        431515..432502
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="YPO0414"
FT                   /product="putative transcriptional regulator (pseudogene)"
FT                   /note="Similar to Bacillus subtilis deoxyribonucleoside
FT                   regulator DeoR SW:DEOR_BACSU (P39140) (313 aa) fasta
FT                   scores: E(): 5.9e-18, 29.936% id in 314 aa, and to
FT                   Escherichia coli hypothetical transcriptional regulator in
FT                   hipB-uxaB intergenic region YdeW SW:YDEW_ECOLI (P76141)
FT                   (317 aa) fasta scores: E(): 1.7e-78, 66.997% id in 303 aa.
FT                   There is a frameshift around codon 73. The sequence has
FT                   been checked and is believed to be correct"
FT   CDS_pept        432673..434265
FT                   /transl_table=11
FT                   /locus_tag="YPO0415"
FT                   /product="putative carbohydrate kinase"
FT                   /note="Similar to carbohydrate kinases e.g. Bacillus
FT                   subtilis gluconokinase GntK, SW:GNTK_BACSU (P12011) (513
FT                   aa) fasta scores: E(): 1.2e-26, 26.250% id in 480 aa and
FT                   Escherichia coli hypothetical sugar kinase
FT                   YdeV,SW:YDEV_ECOLI (P77432) (530 aa) fasta scores: E():
FT                   2.7e-181, 78.302% id in 530 aa"
FT                   /db_xref="GOA:Q0WJP7"
FT                   /db_xref="InterPro:IPR000577"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="InterPro:IPR033676"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0WJP7"
FT                   /protein_id="CAL19096.1"
FT                   /translation="MSQLDTTTPSGDYLMALDAGTGSVRAVIFDLNGNQIAAGQAEWLH
FT                   LPVPDVPGSMEFDLTTNWQLTCQCIRQALHLAKLPASAIRAVAACSMREGIVLYDRSGT
FT                   PIWACANVDARASREVSELKELHNNGFELEVYQCSGQTLALSAMPRLLWLAHYRPDIYR
FT                   QAGTLTMISDWLANMLSGELAVDPSNAGTTGMLDLVTRNWQPNLLEMAGLRADILSPVK
FT                   ETGTLLGHVTAKAAQECGLLAGTPVVMGGGDVQLGCLGLGVVHAGQTAVLGGTFWQQVV
FT                   NLPQPIIDPNMNTRINPHVIPGMVQAESISFFTGLTMRWFRDAFCAEEKLLAQRLGIDT
FT                   YSLLEDMAARVPAGAYGVMPIFSDVMRFKSWYHAAPSFINLSLDPEKCNKATLFRALEE
FT                   NAAIVSACNLAQIAEFSGVKASSVVFAGGGAKGKLWSQILADVTGVPVKVPVVKEATAL
FT                   GCAIAAGVGVGLYEALDKTGERLVRWEREYIPNTEHKALYQAAKTNWQAVYTDQLGLVD
FT                   CGLTTSLWKAPCL"
FT   misc_feature    433117..433485
FT                   /note="Pfam match to entry PF00370 FGGY, FGGY family of
FT                   carbohydrate kinases, score 119.30, E-value 7.3e-32"
FT                   /inference="protein motif:PF00370"
FT   misc_feature    433918..434055
FT                   /note="Pfam match to entry PF00370 FGGY, FGGY family of
FT                   carbohydrate kinases, score 49.10, E-value 1.4e-11"
FT                   /inference="protein motif:PF00370"
FT   CDS_pept        434734..435774
FT                   /transl_table=11
FT                   /locus_tag="YPO0416"
FT                   /product="putative lipopolysaccharide core biosynthesis
FT                   protein"
FT                   /note="Similar to Escherichia coli lipopolysaccharide core
FT                   biosynthesis protein RfaQ or WaaQ SW:RFAQ_ECOLI (P25742)
FT                   (344 aa) fasta scores: E(): 2.3e-45, 40.356% id in 337 aa
FT                   and to Salmonella typhimurium lipopolysaccharide core
FT                   biosynthesis protein RfaQ or WaaQ TR:O68270 (EMBL:AF026386)
FT                   (344 aa) fasta scores: E(): 3.8e-46, 41.246% id in 337 aa"
FT                   /db_xref="GOA:Q0WJP6"
FT                   /db_xref="InterPro:IPR002201"
FT                   /db_xref="InterPro:IPR011916"
FT                   /db_xref="UniProtKB/TrEMBL:Q0WJP6"
FT                   /inference="similar to sequence:INSDC:AF026386"
FT                   /protein_id="CAL19097.1"
FT                   /translation="MIKLRHFGDVLLTTPLLSTLKANYPQAKIDVLLYGGTQDMLRENK
FT                   AINHTFIVDRGLKHAGLKAQISGEKALFSALKKQHYDLILNLSDQWRAAAYCRLLKPTF
FT                   SIGFHYPKRDNWLWRYCHSTLVEIPNAAERHTVLNNLDILSPLQLTDIRTDVTMSYGPH
FT                   DIERAKQLCQQHNIEHYILIQPSARWKFKTWASESFSELINHLTQQGETVLLTGSKDQA
FT                   ELDYIAEIIAGCTQPEKVINLSGQLALPELAVLIDNAKLFIGVDSVAMHMAAALQTPAV
FT                   VLFGPSNLNQWHPWQAPHTLLWAGNYRTLPHPNEIDTDTTDRYLNAIPVSDVIDAVDSW
FT                   RVAKGN"
FT   misc_feature    434938..435708
FT                   /note="Pfam match to entry PF01075
FT                   Heptosyltranf,Heptosyltransferase, score 116.40, E-value
FT                   5.3e-31"
FT                   /inference="protein motif:PF01075"
FT   CDS_pept        435822..437054
FT                   /transl_table=11
FT                   /locus_tag="YPO0417"
FT                   /product="putative O-antigen biosynthesis protein"
FT                   /note="Shows weak similarity to Salmonella typhimurium
FT                   O-antigen ligase RfaL SW:RFAL_SALTY (P26471) (404 aa) fasta
FT                   scores: E(): 0.0056, 24.796% id in 367 aa. Similar to other
FT                   putative O-antigen biosynthesis genes e.g. Haemophilus
FT                   influenzae hypothetical protein HI0874 SW:Y874_HAEIN
FT                   (P44067) (399 aa) fasta scores: E(): 7.4e-06, 25.369% id in
FT                   406 aa"
FT                   /db_xref="InterPro:IPR007016"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384KB11"
FT                   /inference="protein motif:TMHMM:2.0"
FT                   /protein_id="CAL19098.1"
FT                   /translation="MTTLSPAIPVNRRSEMLCSIAALLLGISMPTNNQLMSVSLVLIII
FT                   SLIINRKSLDFKPLLTSPLVYLPAAMFVLLALSLLYQNNSYGPDMVGKYKKLLYILPLA
FT                   LFFMNQPRLIKLFCTGFLVANAVILAGSLAVGVLHIPLSGVDPTNPTIFKLQITQNFFM
FT                   ALAALLWLVLAFQHQGWKRWGYSVLVVAASYSILFLVLGRTGYVALIVGLGVWLFFSLG
FT                   NRQRLTLVVLGALAFAALIFIPNKATDRIVQGVDEIKVCMAASATDAADACNSSMGQRS
FT                   AFVVEAARLIKESPILGHGAGGFYYENKEVDYKVNNPHNQYLLETIQSGVIGLFLFLAW
FT                   VICCYRVIWQQTPALRNVLLAVLTSYMACNFFNSFLLDSSEGHLFMIFVAVLAGYSVSG
FT                   SQSIAGKRLPT"
FT   misc_feature    435879..435968
FT                   /locus_tag="YPO0417"
FT                   /note="one of 10 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    435996..436064
FT                   /locus_tag="YPO0417"
FT                   /note="one of 10 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    436167..436235
FT                   /locus_tag="YPO0417"
FT                   /note="one of 10 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    436278..436346
FT                   /locus_tag="YPO0417"
FT                   /note="one of 10 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    436365..436424
FT                   /locus_tag="YPO0417"
FT                   /note="one of 10 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    436434..436487
FT                   /locus_tag="YPO0417"
FT                   /note="one of 10 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    436500..436553
FT                   /locus_tag="YPO0417"
FT                   /note="one of 10 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    436797..436865
FT                   /locus_tag="YPO0417"
FT                   /note="one of 10 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    436884..436952
FT                   /locus_tag="YPO0417"
FT                   /note="one of 10 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    436965..437033
FT                   /locus_tag="YPO0417"
FT                   /note="one of 10 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        437640..437837
FT                   /transl_table=11
FT                   /locus_tag="YPO0418"
FT                   /product="putative membrane protein"
FT                   /note="Similar to the N-terminal region of Arabidopsis
FT                   thaliana putative ring zinc finger protein At2g42350
FT                   TR:Q9SLC4 (EMBL:AC005956) (217 aa) fasta scores: E():
FT                   5.9,28.814% id in 59 aa"
FT                   /db_xref="UniProtKB/TrEMBL:Q74PX1"
FT                   /inference="similar to sequence:INSDC:AC005956"
FT                   /protein_id="CAL19099.1"
FT                   /translation="MGLSDSNAKGFWDGSYSANALVCVFLMHNIFIGIDSIVAWVSIYQ
FT                   FEFYAFLGKRFWRVVFSVAM"
FT   misc_feature    437700..437768
FT                   /note="1 probable transmembrane helix predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        437864..438097
FT                   /transl_table=11
FT                   /locus_tag="YPO0419"
FT                   /product="putative exported protein"
FT                   /note="Similar to the C-terminal regions of Malawimonas
FT                   jakobiformis ABC transporter channel subunit YejV TR:Q9G873
FT                   (EMBL:AF295546) (218 aa) fasta scores: E(): 3, 32.857% id
FT                   in 70 aa, and to Albinaria coerulea NADH-ubiquinone
FT                   oxidoreductase chain 6 Nd6 SW:NU6M_ALBCO (P48922) (155 aa)
FT                   fasta scores: E(): 3.3, 27.397% id in 73 aa"
FT                   /db_xref="GOA:A0A384KEV8"
FT                   /db_xref="InterPro:IPR010445"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384KEV8"
FT                   /inference="protein motif:TMHMM:2.0"
FT                   /inference="similar to sequence:INSDC:AF295546"
FT                   /protein_id="CAL19100.1"
FT                   /translation="MKYIYGVCFLLIVTLTTLFAFQNSGTVNLSLLFTQITLPMSVLIV
FT                   MIYFLGMFTGGLLITLLRALMRNMTQKTDKKV"
FT   misc_feature    437870..437938
FT                   /locus_tag="YPO0419"
FT                   /note="one of 2 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    437981..438049
FT                   /locus_tag="YPO0419"
FT                   /note="one of 2 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        438149..439231
FT                   /transl_table=11
FT                   /locus_tag="YPO0420"
FT                   /product="putative lipoprotein"
FT                   /note="Similar to Vibrio cholerae putative multidrug
FT                   resistance protein Vc1675 TR:Q9KRG7 (EMBL:AE004245) (343
FT                   aa) fasta scores: E(): 1.2e-22, 30.919% id in 359 aa, and
FT                   to Pseudomonas aeruginosa probable Rnd efflux membrane
FT                   fusion protein precursor Pa4374 TR:Q9HW28 (EMBL:AE004853)
FT                   (376 aa) fasta scores: E(): 2.1e-13, 28.086% id in 324 aa"
FT                   /db_xref="GOA:A0A384LCR2"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384LCR2"
FT                   /inference="similar to sequence:INSDC:AE004245"
FT                   /inference="similar to sequence:INSDC:AE004853"
FT                   /protein_id="CAL19101.1"
FT                   /translation="MKIKTVVTLLITFLLAACDRTPPETVESVRPVKIFMVEDSGQNGT
FT                   RYFPARLQAGDETQLSFKRGGQLQELLVREGEQVKKGQKIAMLNDTDLSLRVRDRQSTF
FT                   NLARDQFNRFNTLQGRSAVSRADLDIRRAEMESAQAALDIARKELSDATIIAPFDGIIA
FT                   NVNVRNHQVMAAGQPVATLSALDTLDVVFSVPERLFTTLDISNRNYKPTVLLNHMPGRE
FT                   FIAEYKEHTTSTTSASQTFQVTLTMKRPADMPLLSGISGRVRINSGNLSGTDHPTIIVP
FT                   VEAVFNPDHAQLNDARVWVIKNDNDQMHVEERKVQVGQLVENGIQVTSGLADGEQIVAA
FT                   GTGELRPQQVVRAWVRERGL"
FT   misc_feature    438170..438202
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:ProSite:PS00013"
FT   CDS_pept        439231..442317
FT                   /transl_table=11
FT                   /locus_tag="YPO0421"
FT                   /product="putative multi-drug efflux protein"
FT                   /note="Similar to Vibrio cholerae transporter, AcrB/D/F
FT                   family Vc1757 TR:Q9KR85 (EMBL:AE004253) (1016 aa) fasta
FT                   scores: E(): 4.3e-157, 40.766% id in 1018 aa, and to
FT                   Xylella fastidiosa cation efflux system protein Xf2083
FT                   TR:Q9PBQ7 (EMBL:AE004023) (1020 aa) fasta scores: E():
FT                   2.1e-106, 30.731% id in 999 aa"
FT                   /db_xref="GOA:A0A384KFS5"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384KFS5"
FT                   /inference="protein motif:TMHMM:2.0"
FT                   /inference="similar to sequence:INSDC:AE004253"
FT                   /inference="similar to sequence:INSDC:AE004023"
FT                   /protein_id="CAL19102.1"
FT                   /translation="MKLTDNFINNNTRIWLTILLLGIGGIIAYLNIGRLEDPAFTIKTA
FT                   VVVTRYDGASAQQVEEEVTLPLENAIQELSYVDDVTSISSAGLSQITINIRAQYGANEL
FT                   PQIWDELWRKISDNSVRLPPGASAPMVNDDFGDVYGFFFSLTGDGYSNQDLRNFAEQLR
FT                   RELVLVPGVGKVGIVGILPEEVQVEISRAQMTAAGITPQQLSDLLSRQNVVSDAGQLQV
FT                   GSESIRLHPTGEFQSVQELGNLLVSQPGSPKSVYLRDIATVTQGFGHSPTNIYRANGQP
FT                   ALALGISFAPNVNVVNVGNAIKSRLAQLEGERPSGMHINVFYDQSKEVEGAVNGFILNF
FT                   LLALLIVVVTLLIFMGVRSGVVIAISLALNVLGTLLIMWLFNIELQRVSLGALIIALSM
FT                   LVDNAIVVVEGVVVGRQRGDSISTAIGNVVKRSKMPLLGATIIAILAFAPIGLSNDATG
FT                   EYCKSLFQVLLISLMLSWITALTLTPVFAKWAFQNQKQPEADADKPVKQPYDGWLFRYY
FT                   RVVLNKLLQHRSITLVLLAALLVASVIGFGHVRQSFFPPSNTPIFFVDIWLPYGTDISY
FT                   TEDIAAKIEQHIKQQKNVADTMTTIGQGAMRFMLTYNGQRHYPNYAQVMVRTEQLEQIP
FT                   GLIDEIESYMHDEYPQVDAQIKRIMFGPSNNSSIEARFIGPDPDVLRTLAAQAEQAIIA
FT                   DPMADGARHDWQDRSKMIRPQFSDYLGRELGVDKREVDGTLRMSFGGLPVGLYRDGTRL
FT                   IPIVLRTPDSERLNAERLNDVMVWSQARQAFIPIDNVVTSFETEWEDPLIMRLDRKRTL
FT                   TVQTDPTHQGGETSSELLQRIKPGVEAITLPRGYELEWGGDYESTKEAQRGIFISLPIA
FT                   FLLMFVVTVLMFSSVRNALAIWLTVPLALIGVTFGFLLTGIPFGFMALLGLLSLSGMLI
FT                   RNGIVLVEEIGLQRQEKPLREAIIDASTARLRPIMLTAFTTVLGLAPLLSDAFFQSMAV
FT                   VIMFGLGFATVLTLLVLPVIYSSMNPEPKEKIHDEPVSE"
FT   misc_feature    439237..439509
FT                   /note="Pfam match to entry PF00873 ACR_tran, AcrB/AcrD/AcrF
FT                   family, score 35.40, E-value 6.2e-09"
FT                   /inference="protein motif:PF00873"
FT   misc_feature    439267..439326
FT                   /locus_tag="YPO0421"
FT                   /note="one of 12 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    439582..440457
FT                   /note="Pfam match to entry PF00873 ACR_tran, AcrB/AcrD/AcrF
FT                   family, score 132.50, E-value 7.8e-36"
FT                   /inference="protein motif:PF00873"
FT   misc_feature    440224..440292
FT                   /locus_tag="YPO0421"
FT                   /note="one of 12 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    440305..440373
FT                   /locus_tag="YPO0421"
FT                   /note="one of 12 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    440401..440469
FT                   /locus_tag="YPO0421"
FT                   /note="one of 12 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    440530..440583
FT                   /locus_tag="YPO0421"
FT                   /note="one of 12 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    440620..440688
FT                   /locus_tag="YPO0421"
FT                   /note="one of 12 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    440761..441036
FT                   /note="Pfam match to entry PF00873 ACR_tran, AcrB/AcrD/AcrF
FT                   family, score 33.30, E-value 2.2e-08"
FT                   /inference="protein motif:PF00873"
FT   misc_feature    440800..440868
FT                   /locus_tag="YPO0421"
FT                   /note="one of 12 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    441394..442272
FT                   /note="Pfam match to entry PF00873 ACR_tran, AcrB/AcrD/AcrF
FT                   family, score 130.10, E-value 4.1e-35"
FT                   /inference="protein motif:PF00873"
FT   misc_feature    441820..441879
FT                   /locus_tag="YPO0421"
FT                   /note="one of 12 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    441898..441966
FT                   /locus_tag="YPO0421"
FT                   /note="one of 12 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    441976..442044
FT                   /locus_tag="YPO0421"
FT                   /note="one of 12 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    442105..442164
FT                   /locus_tag="YPO0421"
FT                   /note="one of 12 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    442192..442260
FT                   /locus_tag="YPO0421"
FT                   /note="one of 12 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        complement(442678..443010)
FT                   /transl_table=11
FT                   /locus_tag="YPO0422"
FT                   /product="hypothetical protein"
FT                   /note="No significant database hits"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384KWW7"
FT                   /protein_id="CAL19103.1"
FT                   /translation="MKCISVPTSQEAMSRLDFDKCIDGDVIDLNITDEQYRSLVELGLI
FT                   RLMNDLFDICIDEFEDEKIVGVDSLTQARLLIENDFHPSENEAVNLLLSQVNKATEYET
FT                   GLFFYF"
FT   CDS_pept        complement(443157..443504)
FT                   /transl_table=11
FT                   /locus_tag="YPO0423"
FT                   /product="hypothetical protein"
FT                   /note="Similar to the C-terminal region of
FT                   Schizosaccharomyces pombe hypothetical protein C23E6.01 in
FT                   chromosome II SPBC23E6.01 TR:O60176 (EMBL:AL023287) (240
FT                   aa) fasta scores: E(): 4, 32.258% id in 93 aa"
FT                   /db_xref="UniProtKB/TrEMBL:Q7CG53"
FT                   /inference="similar to sequence:INSDC:AL023287"
FT                   /protein_id="CAL19104.1"
FT                   /translation="MAGMLQLVMIRLWIIKDCTGASIAAGLTMRRLNPTSEIGQLETLA
FT                   TLPEKLAERAARAQIFSQNWPSGDLGAAVNKFAGSDLFITVTKSGKQIYTNPTTGVQVV
FT                   RGFVRELFSPP"
FT   CDS_pept        443813..444898
FT                   /transl_table=11
FT                   /locus_tag="YPO0424"
FT                   /product="putative pectinesterase"
FT                   /EC_number="3.1.1.11"
FT                   /note="Similar to Erwinia chrysanthemi pectinesterase A
FT                   PemA SW:PMEA_ERWCH (P07863) (366 aa) fasta scores: E():
FT                   4.6e-79, 55.249% id in 362 aa, and to Burkholderia
FT                   solanacearum pectinesterase Pme SW:PME_BURSO (P24791) (396
FT                   aa) fasta scores: E(): 9.3e-16, 30.321% id in 343 aa"
FT                   /db_xref="GOA:A0A384KPY8"
FT                   /db_xref="InterPro:IPR000070"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012334"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384KPY8"
FT                   /protein_id="CAL19105.1"
FT                   /translation="MPINALSKTLLLGLISFAALGEVSAAQYNAVVSAMAQGDEFSSIN
FT                   AALQSAPPDSSPFVIFLKKGVYTERLEVNRDNVTLKGEERDTTVIGANTAAGMLNPQGT
FT                   KWGTSGSSTVLVNAANFTAENLTIRNDFDFPANQAKAEGDPTKLKDTQAVALLLAEKSD
FT                   KARFRQVKLEGYQDTLYSKTGSRSYFTDCDISGHVDFIFGSGVTVFDRCNIIARDRRDI
FT                   SPPYGYITAPSTQNTAPYGLIVLNSRLTKEPGVPAKSFALGRPWHPTTAFDDGRYADPA
FT                   AIGQAVFINTVMDDHIYGWDKMSGKDKQGEKVWFYPQDSRFFEANNQGPGAEINEGRRQ
FT                   LSAEQLKAFTLPMIFPDWTVQ"
FT   misc_feature    443828..444883
FT                   /note="Pfam match to entry PF01095
FT                   Pectinesterase,Pectinesterase, score 381.80, E-value
FT                   7.1e-111"
FT                   /inference="protein motif:PF01095"
FT   CDS_pept        complement(445439..446611)
FT                   /transl_table=11
FT                   /gene="hmsT"
FT                   /locus_tag="YPO0425"
FT                   /product="HmsT protein"
FT                   /note="Identical to the previously sequenced Yersinia
FT                   pestis HmsT protein TR:Q9X5X6 (EMBL:AF129277) (390 aa)
FT                   fasta scores: E(): 4.6e-148, 100.000% id in 390 aa. HmsT
FT                   has been shown to be essential for the expression of the
FT                   hemin storage (Hms+) phenotype"
FT                   /db_xref="GOA:Q9X5X6"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:Q9X5X6"
FT                   /inference="protein motif:TMHMM:2.0"
FT                   /inference="similar to sequence:INSDC:AF129277"
FT                   /protein_id="CAL19106.1"
FT                   /translation="MQSKLNMNSHSYDQFLKSKHRLSLLLFLFLNASSAIFSMLSSSPK
FT                   TPAVTFPVVMIAVISLSAAAYLIFISKNDTGRNNYVDKNNYVDKSNHVDKNNYANKLNL
FT                   FSILIGLLWAWQIILKYEYLETNEDNYLLLSLFTIFFISTIALSDNFLAFCLHTAPSAI
FT                   TVILLDDFHNIFRIIFTIMLPLIGFSLHHLMLRRTDNFTRKLVDHLSNEREKFSDLSMI
FT                   DPLTSLYNRRGLESKLETLLSQSPGNHYVLLLDIDHFKAYNDNYGHTMGDQALVRISAA
FT                   IRDAVRSRDIVVRYGGEEFLVLLTHVSEEYANQLAERVRQRVLGLDIPHVFNHKVSTTV
FT                   TLSAGISPLQAYDLAASLKAADEALYRAKRNGRNNIEFAKDELSNVQSSP"
FT   misc_feature    complement(445487..445975)
FT                   /note="Pfam match to entry PF00990 DUF9, Domain of unknown
FT                   function DUF9, score 199.90, E-value 3.8e-56"
FT                   /inference="protein motif:PF00990"
FT   misc_feature    complement(446027..446092)
FT                   /gene="hmsT"
FT                   /locus_tag="YPO0425"
FT                   /note="one of 5 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    complement(446144..446209)
FT                   /gene="hmsT"
FT                   /locus_tag="YPO0425"
FT                   /note="one of 5 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    complement(446255..446305)
FT                   /gene="hmsT"
FT                   /locus_tag="YPO0425"
FT                   /note="one of 5 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    complement(446402..446467)
FT                   /gene="hmsT"
FT                   /locus_tag="YPO0425"
FT                   /note="one of 5 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    complement(446483..446548)
FT                   /gene="hmsT"
FT                   /locus_tag="YPO0425"
FT                   /note="one of 5 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        446953..447192
FT                   /transl_table=11
FT                   /locus_tag="YPO0426"
FT                   /product="putative membrane protein"
FT                   /note="Similar to Escherichia coli hypothetical 8.7 kDa
FT                   protein in fhuF-leuV intergenic region YjjZ or B4367.1
FT                   SW:YJJZ_ECOLI (P55914) (78 aa) fasta scores: E():
FT                   1.5e-11,49.333% id in 75 aa"
FT                   /db_xref="GOA:Q0WJN6"
FT                   /db_xref="InterPro:IPR009885"
FT                   /db_xref="UniProtKB/TrEMBL:Q0WJN6"
FT                   /inference="protein motif:TMHMM:2.0"
FT                   /protein_id="CAL19107.1"
FT                   /translation="MLSRGMSSGWGILLPFTLLPVLGWVDISIGQLRILIVVAMLATVS
FT                   MLYHVRLRHFLLLPSCLALLGGLVALMLMHGGVS"
FT   misc_feature    446974..447027
FT                   /locus_tag="YPO0426"
FT                   /note="one of 4 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    447046..447102
FT                   /locus_tag="YPO0426"
FT                   /note="one of 4 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    447115..447183
FT                   /locus_tag="YPO0426"
FT                   /note="one of 4 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   tRNA            complement(447362..447448)
FT                   /note="tRNA Leu anticodon CAG, Cove score 64.60"
FT   CDS_pept        complement(447705..448748)
FT                   /transl_table=11
FT                   /gene="b4371"
FT                   /gene_synonym="rsmC"
FT                   /locus_tag="YPO0427"
FT                   /product="ribosomal RNA small subunit methyltransferase C"
FT                   /EC_number="2.1.1.52"
FT                   /note="Similar to Escherichia coli ribosomal RNA small
FT                   subunit methyltransferase C RsmC SW:RSMC_ECOLI (P39406)
FT                   (342 aa) fasta scores: E(): 0, 69.1% id in 340 aa, and to
FT                   Haemophilus influenzae ribosomal RNA small subunit
FT                   methyltransferase C RsmC SW:RSMC_HAEIN (P44453) (330 aa)
FT                   fasta scores: E(): 0, 45.5% id in 330 aa"
FT                   /db_xref="GOA:Q7CG56"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR007848"
FT                   /db_xref="InterPro:IPR013675"
FT                   /db_xref="InterPro:IPR023543"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7CG56"
FT                   /protein_id="CAL19108.1"
FT                   /translation="MSALTPASEVILRHSDEFIARHVLFAGDLQDALPAQFDAAGVRVH
FT                   TNQYHHWQLLSNTLEENVQFGLLATAETLAACDTLIYYWPKSKQEAQFQLANLLSILPV
FT                   GTDIFVVGENRSGVRSAEEMLADFAQLAKIDSARRCGLYHGRLDKQPEFDADAWWESYQ
FT                   VGGVTVKTLPGVFSRDSLDSGSHLLLSTFNEPFKGSVLDVGCGAGVLASVLAQQSPKIK
FT                   WTLSDVSAAAIEASRATLAVNNIEAQVIASNVYSDIKGRFEMIISNPPFHDGIQTSLTA
FT                   AEMLIRGATAHLHVGGKLRIVANSFLPYPALLDAAFGSHEVLAQNGRFKVYQATVGRPP
FT                   RDPKKKR"
FT   misc_feature    complement(447936..447956)
FT                   /note="PS00092 N-6 Adenine-specific DNA methylases
FT                   signature."
FT                   /inference="protein motif:ProSite:PS00092"
FT   CDS_pept        448861..449298
FT                   /transl_table=11
FT                   /gene="b4372"
FT                   /gene_synonym="holD"
FT                   /locus_tag="YPO0428"
FT                   /product="DNA polymerase III, psi subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="Similar to Escherichia coli DNA polymerase III, psi
FT                   subunit HolD SW:HOLD_ECOLI (P28632) (137 aa) fasta scores:
FT                   E(): 2.1e-30, 59.701% id in 134 aa, and to Haemophilus
FT                   influenzae DNA polymerase III, psi subunit HolD or Hi0011
FT                   SW:HOLD_HAEIN (P43750) (134 aa) fasta scores: E():
FT                   1.5e-10,38.168% id in 131 aa"
FT                   /db_xref="GOA:A0A384KKB3"
FT                   /db_xref="InterPro:IPR004615"
FT                   /db_xref="InterPro:IPR036654"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384KKB3"
FT                   /protein_id="CAL19109.1"
FT                   /translation="MASRRDLLLQQLGITQWVLRRPAVLQGEIAIHLPEDTRLLIVAQQ
FT                   LPEHGDPLLCDVLRSLGLTPHQVYALTPDQVAMLPEDTQCNSWRLGISEPLAVAGAQLH
FT                   SPELAGLYQDAGAKRALWQQICHYEADFYPDASRSGHSIPN"
FT   CDS_pept        449243..449686
FT                   /transl_table=11
FT                   /gene="b4373"
FT                   /gene_synonym="rimI"
FT                   /locus_tag="YPO0429"
FT                   /product="ribosomal-protein-alanine acetyltransferase"
FT                   /EC_number="2.3.1.128"
FT                   /note="Similar to Escherichia coli
FT                   ribosomal-protein-alanine acetyltransferase RimI or B4373
FT                   SW:RIMI_ECOLI (P09453) (148 aa) fasta scores: E():
FT                   7.7e-44,72.109% id in 147 aa, and to Haemophilus influenzae
FT                   ribosomal-protein-alanine acetyltransferase RimI or Hi0010
FT                   SW:RIMI_HAEIN (P44305) (146 aa) fasta scores: E():
FT                   8.1e-28,54.861% id in 144 aa. Note the large overlap with
FT                   the upstream CDS."
FT                   /db_xref="GOA:A0A384LPG1"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR006464"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384LPG1"
FT                   /protein_id="CAL19110.1"
FT                   /translation="MKQISILTPADLATAYQIEQASHAFPWTEKTFASNQGDRYLNFKL
FT                   SIGQEMAGFAITQIVLDEATLFNIAIDPQYQRQGYGRLLLEHLIEQLEARNIVTLWLEV
FT                   RASNARAIALYESLGFNEVSVRRNYYPSANGREDAIMMALPMA"
FT   misc_feature    449381..449605
FT                   /note="Pfam match to entry PF00583
FT                   Acetyltransf,Acetyltransferase (GNAT) family, score 78.30,
FT                   E-value 1.6e-19"
FT                   /inference="protein motif:PF00583"
FT   CDS_pept        449865..451454
FT                   /transl_table=11
FT                   /gene="b4375"
FT                   /gene_synonym="miaD"
FT                   /gene_synonym="prfC"
FT                   /gene_synonym="tos"
FT                   /locus_tag="YPO0430"
FT                   /product="peptide chain release factor 3"
FT                   /note="Similar to Escherichia coli peptide chain release
FT                   factor 3 PrfC SW:RF3_ECOLI (P33998) (528 aa) fasta scores:
FT                   E(): 0, 89.4% id in 526 aa, and to Salmonella typhimurium
FT                   peptide chain release factor 3 PrfC SW:RF3_SALTY (Q56121)
FT                   (528 aa) fasta scores: E(): 0, 90.1% id in 526 aa"
FT                   /db_xref="GOA:Q8ZIR0"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004548"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR032090"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR038467"
FT                   /db_xref="InterPro:IPR041732"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZIR0"
FT                   /protein_id="CAL19111.1"
FT                   /translation="MSPSEYALEVAKRRTFAIISHPDAGKTTITEKVLLFGHAIQTAGT
FT                   VKGRGSSHHAKSDWMEMEKQRGISITTSVMQFPYGGCLVNLLDTPGHEDFSEDTYRTLT
FT                   AVDCCLMVIDAAKGVEDRTRKLMEVTRLRDTPILTFMNKLDREIRDPMEVLDEVERELN
FT                   IACSPITWPIGCGKSFKGVYHLHKDETYLYQSGKGHTIQEVRIVKGLNNPDLDVAVGED
FT                   LAKQFRQELELVQGASHEFDHEAFLSGDLTPVFFGTALGNFGVDHMLDGLVEWAPAPMP
FT                   RKTDTRVVVASEEKFTGFVFKIQANMDPKHRDRVAFMRVVSGRFEKGMKLRQVRTKKDV
FT                   VISDALTFMAGDRSHVEEAYAGDIIGLHNHGTIQIGDTFTQGEDMKFTGIPNFAPELFR
FT                   RIRLRDPLKQKQLLKGLVQLSEEGAVQVFRPLSNNDLIVGAVGVLQFEVVSSRLKSEYN
FT                   VEAVYESVNVSTARWVECHDVKKFEEFKRKNELNLALDGGDNLSYIAPTMVNLNITQER
FT                   YPDVIFRKTREH"
FT   misc_feature    449895..451283
FT                   /note="Pfam match to entry PF00009 GTP_EFTU, Elongation
FT                   factor Tu family, score 263.10, E-value 2.7e-77"
FT                   /inference="protein motif:PF00009"
FT   misc_feature    450036..450083
FT                   /note="PS00301 GTP-binding elongation factors signature."
FT                   /inference="protein motif:ProSite:PS00301"
FT   CDS_pept        451781..452395
FT                   /transl_table=11
FT                   /gene="b4376"
FT                   /gene_synonym="osmY"
FT                   /locus_tag="YPO0431"
FT                   /product="osmotically inducible protein Y"
FT                   /note="Similar to Escherichia coli osmotically inducible
FT                   protein Y OsmY SW:OSMY_ECOLI (P27291) (201 aa) fasta
FT                   scores: E(): 0, 64.0% id in 203 aa"
FT                   /db_xref="InterPro:IPR007055"
FT                   /db_xref="InterPro:IPR014004"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384L9Y2"
FT                   /protein_id="CAL19112.1"
FT                   /translation="MKSTQFSRSVMAVVLGSALISGSVLAEDTLLNKAASTVDSTGAKI
FT                   DSSMKKVDNYMSDSAVTAKVKSALLEEKSLKSTDISVETSNGVVTLSGFLNSQAEIETA
FT                   VEIAGNVEGVKSVSDKLHVKDQKSQSVSEYAGDAATTSSVKAKLLADDIVPSRKIKVET
FT                   TDGVVQLSGDVENKAQSERAESIAKAVNGVKSVKNDLNIKP"
FT   CDS_pept        452562..452723
FT                   /transl_table=11
FT                   /locus_tag="YPO0432"
FT                   /product="putative exported protein"
FT                   /note="Similar to Pseudomonas aeruginosa hypothetical
FT                   protein Pa5482 TR:AAG08867 (EMBL:AE004961) (53 aa) fasta
FT                   scores: E(): 1.6e-08, 55.8% id in 52 aa"
FT                   /db_xref="GOA:Q7CG59"
FT                   /db_xref="InterPro:IPR009760"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7CG59"
FT                   /inference="protein motif:TMHMM:2.0"
FT                   /inference="similar to sequence:INSDC:AE004961"
FT                   /protein_id="CAL19113.1"
FT                   /translation="MFRWGIIFLIIALIEAALGFGGLAGTAAWAAKVVFVVGIILFLIS
FT                   LFTGRKRL"
FT   misc_feature    452574..452630
FT                   /locus_tag="YPO0432"
FT                   /note="one of 2 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    452640..452708
FT                   /locus_tag="YPO0432"
FT                   /note="one of 2 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        452797..454068
FT                   /transl_table=11
FT                   /locus_tag="YPO0433"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Escherichia coli hypothetical protein
FT                   YjjU SW:YJJU_ECOLI (P39407) (357 aa) fasta scores: E():
FT                   0,63.5% id in 348 aa, and to Vibrio cholerae hypothetical
FT                   protein VC2009 TR:Q9KQI9 (EMBL:AE004275) (389 aa) fasta
FT                   scores: E(): 7.2e-26, 33.3% id in 363 aa"
FT                   /db_xref="GOA:A0A0H2W9Q1"
FT                   /db_xref="InterPro:IPR002641"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="InterPro:IPR037483"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2W9Q1"
FT                   /inference="similar to sequence:INSDC:AE004275"
FT                   /protein_id="CAL19114.1"
FT                   /translation="MVGYRIPITLGNIEPLAYKPYQPGKMALVCEGGGQRGIFTAGVLD
FT                   EFHRARFNPFDLMIGTSAGAQNLSAFICGQPGYARRVITRYTTTANFFNPLRFVRGGNL
FT                   IDLDWLVDITSQQYPLAFDHAEQYLHQGREFLMCACRSDDFEPTYISPTRENWLTAIKA
FT                   SSAIPGLYRQGVELDGVSYLDGGISDAIPVEEAYRRGAETIVVIRTVPSQAHYTPQWFK
FT                   RIEQWLSESSLQQLVRIMQQHERSYHRIQQFIEKPPGDVRIFEIFPSKPLASKALGSGA
FT                   VALNRDYHLGRRCGRYFLATIGRWLLPRESLGDSDKTSISLSRHIIQPQNIIQTPNVFQ
FT                   TKNINQLNNTYDYSGSKERFTAVFSTEPSVTLSDLTAPSEVQATAAQINEPLDPTSLTV
FT                   VDTEQAEANSLPVDITLPPNLTKK"
FT   CDS_pept        454105..454893
FT                   /transl_table=11
FT                   /locus_tag="YPO0434"
FT                   /product="putative metalloenzyme"
FT                   /EC_number="3.1.21.-"
FT                   /note="Similar to Escherichia coli putative
FT                   deoxyribonuclease YjjV SW:YJJV_ECOLI (P39408) (259 aa)
FT                   fasta scores: E(): 6.7e-67, 64.314% id in 255 aa, and to
FT                   Pasteurella multocida hypothetical protein PM0942 TR:Q9CM93
FT                   (EMBL:AE006134) (263 aa) fasta scores: E(): 7.7e-42,48.302%
FT                   id in 265 aa"
FT                   /db_xref="GOA:Q0WJM8"
FT                   /db_xref="InterPro:IPR001130"
FT                   /db_xref="InterPro:IPR018228"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:Q0WJM8"
FT                   /inference="similar to sequence:INSDC:AE006134"
FT                   /protein_id="CAL19115.1"
FT                   /translation="MPYFIDTHCHFDFPPFTGDEAASLACAAEANVRQLIVPSVKAAYF
FT                   SRILALADRYPPLFAALGLHPLYIAEHEDADLAALASHLADKPPKLVAIGEIGLDLYMD
FT                   EPQFPHQLVILNMQLELAKQHDLPVILHSRRSHDPLAAALRKAALPRAGVIHGFAGSLA
FT                   QAQAFIRLGYYIGVGGTITYKRAQKTRHVMASLPLSSLLLETDAPDMPLASFQGQANRP
FT                   ERAANVFAALCELRPEPADEIAAELMCNSQRLFSLPPLRP"
FT   misc_feature    454114..454140
FT                   /note="PS01137 Uncharacterized protein family UPF0006
FT                   signature 1."
FT                   /inference="protein motif:ProSite:PS01137"
FT   misc_feature    454129..454872
FT                   /note="Pfam match to entry PF01026 UPF0006, Metalloenzyme
FT                   of unknown function UPF0006, score 295.70, E-value 5.5e-85"
FT                   /inference="protein motif:PF01026"
FT   misc_feature    455422..456690
FT                   /note="Pfam match to entry PF01773 Nucleoside_tra2, Na+
FT                   dependent nucleoside transporter, score 792.80, E-value
FT                   1.3e-234"
FT                   /inference="protein motif:PF01773"
FT   CDS_pept        455428..456699
FT                   /transl_table=11
FT                   /locus_tag="YPO0435"
FT                   /product="putative Na+ dependent nucleoside
FT                   transporter-family protein"
FT                   /note="Similar to Vibrio cholerae NupC family protein
FT                   Vc2352 TR:Q9KPL5 (EMBL:AE004305) (418 aa) fasta scores:
FT                   E(): 2.1e-119, 72.340% id in 423 aa, and to Helicobacter
FT                   pylori J99 putative nucleoside transporter Jhp1106
FT                   TR:Q9ZK36 (EMBL:AE001538) (418 aa) fasta scores: E():
FT                   2.7e-74, 57.346% id in 422 aa"
FT                   /db_xref="GOA:Q0WJM7"
FT                   /db_xref="InterPro:IPR002668"
FT                   /db_xref="InterPro:IPR008276"
FT                   /db_xref="InterPro:IPR011642"
FT                   /db_xref="InterPro:IPR011657"
FT                   /db_xref="InterPro:IPR018270"
FT                   /db_xref="UniProtKB/TrEMBL:Q0WJM7"
FT                   /inference="protein motif:TMHMM:2.0"
FT                   /inference="similar to sequence:INSDC:AE004305"
FT                   /inference="similar to sequence:INSDC:AE001538"
FT                   /protein_id="CAL19116.1"
FT                   /translation="MLMSLVGMAVLILIAVLLSSNARAINLRTVIGAFIIQVVIGALVL
FT                   YVPVGRRILGGMSEGVANVIAYGNEGISFIFGGLVSDKMYEVFGGGGFVFALRVLPVIV
FT                   FFSSLIAVLYYLGVMQIVIKVLGGGLQKLLGTSRTESLSATANIFVGQTEAPLVVRPYI
FT                   ATMTQSELFAVMCGGLASVAGSVLAGYAQMGVPLEYLIAASFMAAPGGLLFAKLMVPET
FT                   EQTHDKVDAIALIAEEDRPANVIDAAASGAASGMQLALNVGAMLLAFIALIALLNGILG
FT                   GIGGWFDYPQLSLELILGWVFSPIAYLIGVPWSEAMVAGSFIGQKIIVNEFVAFMNFGQ
FT                   YLQADELVKAAGLQVLSEHTKAIISFALCGFANLSSVAILLGGLGSMAPNRRHDIARFG
FT                   LKAVAAGTLSNLMSATIAGFFLAL"
FT   misc_feature    455428..455487
FT                   /locus_tag="YPO0435"
FT                   /note="one of 9 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    455500..455568
FT                   /locus_tag="YPO0435"
FT                   /note="one of 9 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    455605..455664
FT                   /locus_tag="YPO0435"
FT                   /note="one of 9 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    455707..455775
FT                   /locus_tag="YPO0435"
FT                   /note="one of 9 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    455938..456006
FT                   /locus_tag="YPO0435"
FT                   /note="one of 9 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    456220..456288
FT                   /locus_tag="YPO0435"
FT                   /note="one of 9 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    456301..456369
FT                   /locus_tag="YPO0435"
FT                   /note="one of 9 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    456514..456582
FT                   /locus_tag="YPO0435"
FT                   /note="one of 9 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    456619..456687
FT                   /locus_tag="YPO0435"
FT                   /note="one of 9 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        457275..458072
FT                   /transl_table=11
FT                   /gene="deoC"
FT                   /gene_synonym="dra"
FT                   /gene_synonym="thyR"
FT                   /locus_tag="YPO0436"
FT                   /product="deoxyribose-phosphate aldolase"
FT                   /EC_number="4.1.2.4"
FT                   /note="Similar to Escherichia coli deoxyribose-phosphate
FT                   aldolase DeoC B4381 SW:DEOC_ECOLI (P00882) (259 aa) fasta
FT                   scores: E(): 6e-84, 78.491% id in 265 aa, and to Vibrio
FT                   cholerae deoxyribose-phosphate aldolase Vc2350 TR:Q9KPL7
FT                   (EMBL:AE004305) (259 aa) fasta scores: E(): 8.3e-76,75.934%
FT                   id in 241 aa"
FT                   /db_xref="GOA:Q8ZIQ4"
FT                   /db_xref="InterPro:IPR002915"
FT                   /db_xref="InterPro:IPR011343"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR023649"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZIQ4"
FT                   /inference="similar to sequence:INSDC:AE004305"
FT                   /protein_id="CAL19117.1"
FT                   /translation="MTDLTACAHLNDYAKRALSLMDLTTLNDDDTDEKVIALCHQAKSP
FT                   AGNTAAICIYPRFIPVARKALREQGTPEIRIATVTNFPHGNDDVAIALAETRAAIAYGA
FT                   DEVDVVFPYRALMAGNDKIGFELVKTCKEACAAANVLLKVIIETGELKQAHLIRQASEI
FT                   AIKAGADFIKTSTGKVPVNATLESADIMIRTIRELGVGETVGFKPAGGVRTAEDAAQFL
FT                   QLADQLMGEGWADARHFRFGASSLLASLLTTLGHQSNANSSGY"
FT   misc_feature    457317..457991
FT                   /note="Pfam match to entry PF01791
FT                   DeoC,Deoxyribose-phosphate aldolase, score 300.70, E-value
FT                   1.7e-86"
FT                   /inference="protein motif:PF01791"
FT   CDS_pept        458193..459511
FT                   /pseudo
FT                   /transl_table=11
FT                   /gene="deoA"
FT                   /gene_synonym="tpp"
FT                   /gene_synonym="ttg"
FT                   /locus_tag="YPO0437"
FT                   /product="thymidine phosphorylase (pseudogene)"
FT                   /EC_number="2.4.2.4"
FT                   /note="Similar to Escherichia coli thymidine phosphorylase
FT                   DeoA SW:TYPH_ECOLI (P07650) (440 aa) fasta scores: E():
FT                   1.3e-147, 82.955% id in 440 aa, and to Bacillus halodurans
FT                   pyrimidine-nucleoside phosphorylase Pdp TR:Q9KCN6
FT                   (EMBL:AP001512) (433 aa) fasta scores: E(): 1.5e-61,41.570%
FT                   id in 433 aa. There is a frameshift around codon 146. The
FT                   sequence has been checked and is believed to be correct"
FT                   /inference="similar to sequence:INSDC:AP001512"
FT   misc_feature    458208..458639
FT                   /note="Pfam match to entry PF00591 Glycos_transf_3,glycosyl
FT                   transferase family, score 185.00, E-value 1.2e-51"
FT                   /inference="protein motif:PF00591"
FT   misc_feature    458529..458576
FT                   /note="PS00647 Thymidine and pyrimidine-nucleoside
FT                   phosphorylases signature."
FT                   /inference="protein motif:ProSite:PS00647"
FT   CDS_pept        459643..460866
FT                   /transl_table=11
FT                   /gene="b4383"
FT                   /gene_synonym="deoB"
FT                   /gene_synonym="drm"
FT                   /gene_synonym="thyR"
FT                   /locus_tag="YPO0439"
FT                   /product="phosphopentomutase"
FT                   /EC_number="5.4.2.7"
FT                   /note="Similar to Escherichia coli phosphopentomutase DeoB
FT                   SW:DEOB_ECOLI (P07651) (407 aa) fasta scores: E(): 0, 86.0%
FT                   id in 407 aa, and to Vibrio cholerae phosphopentomutase
FT                   Vc2348 TR:Q9KPL9 (EMBL:AE004305) (406 aa) fasta scores:
FT                   E(): 0, 77.0% id in 408 aa"
FT                   /db_xref="GOA:Q8ZIQ3"
FT                   /db_xref="InterPro:IPR006124"
FT                   /db_xref="InterPro:IPR010045"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="InterPro:IPR024052"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZIQ3"
FT                   /inference="similar to sequence:INSDC:AE004305"
FT                   /protein_id="CAL19119.1"
FT                   /translation="MKRTFIMVLDSFGIGASADAKKFGDEGADTLGHIAEACARGEANV
FT                   GRSGPLTLPNLSRLGLGKAAEESTGTFPVGLDKNADIIGAYGYASELSSGKDTPSGHWE
FT                   IAGVPVLFDWGYFSDVENSFPQELLDKLVKRANLPGYLGNCHSSGTVILDQLGEEHMKT
FT                   GKPIFYTSADSVFQIACHEETFGLDRLYELCEIAREELTDGGYNIGRVIARPFIGDKPG
FT                   HFQRTGNRHDLAVEPPAPTMLKKLVDEKGGEVVSIGKIADIYAQVGITQKVKATGLDAL
FT                   FDATIEEMKKAGDNTIVFTNFVDFDSSYGHRRDVAGYAAALELFDRRLPELMALIKEDD
FT                   ILILTADHGCDPTWPGTDHTREHIPVLVYGPKVKPGSLGHRETFADIGQTVAAYFGLSP
FT                   MDYGKNML"
FT   misc_feature    460468..460797
FT                   /note="Pfam match to entry PF01676
FT                   Metalloenzyme,Metalloenzyme superfamily, score 163.70,
FT                   E-value 3.1e-45"
FT                   /inference="protein motif:PF01676"
FT   CDS_pept        460991..461710
FT                   /transl_table=11
FT                   /gene="b4384"
FT                   /gene_synonym="deoD"
FT                   /gene_synonym="pup"
FT                   /locus_tag="YPO0440"
FT                   /product="purine nucleoside phosphorylase"
FT                   /EC_number="2.4.2.1"
FT                   /note="Similar to Escherichia coli purine nucleoside
FT                   phosphorylase DeoD SW:DEOD_ECOLI (P09743) (238 aa) fasta
FT                   scores: E(): 0, 91.1% id in 236 aa, and to Klebsiella
FT                   pneumoniae purine nucleoside phosphorylase DeoD
FT                   SW:DEOD_KLEPN (Q59482) (239 aa) fasta scores: E(): 0, 88.7%
FT                   id in 238 aa"
FT                   /db_xref="GOA:Q8ZIQ2"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR004402"
FT                   /db_xref="InterPro:IPR018016"
FT                   /db_xref="InterPro:IPR035994"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZIQ2"
FT                   /protein_id="CAL19120.1"
FT                   /translation="MATPHINAEMGDFADVVLMPGDPLRAKFIAETFLQDVREVNNVRG
FT                   MLGFTGTYKGRKISVMGHGMGIPSCSIYAKELITDFGVKKIIRVGSCGAVRTDVKLRDV
FT                   VIGMGACTDSKVNRMRFKDHDYAAIADFEMTRNAVDAAKAKGVNVRVGNLFSADLFYTP
FT                   DPQMFDVMEKYGILGVEMEAAGICGVAAEFGAKALTICTVSDHIRTGEQTTAAERQTTF
FT                   NDMIEIALESVLLGDNA"
FT   misc_feature    461033..461689
FT                   /note="Pfam match to entry PF01048 PNP_UDP_1, Phosphorylase
FT                   family, score 377.80, E-value 1.1e-109"
FT                   /inference="protein motif:PF01048"
FT   misc_feature    461174..461221
FT                   /note="PS01232 Purine and other phosphorylases family 1
FT                   signature."
FT                   /inference="protein motif:ProSite:PS01232"
FT   CDS_pept        complement(461822..462523)
FT                   /transl_table=11
FT                   /gene="smp"
FT                   /locus_tag="YPO0441"
FT                   /product="putative membrane protein"
FT                   /note="Similar to Escherichia coli hypothetical protein Smp
FT                   SW:SMP_ECOLI (P18838) (214 aa) fasta scores: E(): 0, 65.7%
FT                   id in 213 aa"
FT                   /db_xref="GOA:Q8ZIQ1"
FT                   /db_xref="InterPro:IPR019305"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZIQ1"
FT                   /inference="protein motif:TMHMM:2.0"
FT                   /protein_id="CAL19121.1"
FT                   /translation="MARAKLKFRLHRTAIVLICLALLVLLMQGASYFSLSHQLARSEQV
FT                   EELAQTLAKQVAFSLSPIMDSGDDNIDSQKVDAILQQLTQSSRILDASVYQIDGTLVAS
FT                   AGENVKVRDRLALDGKRPGSYFNHQIVEMIAGNSGPSGFLRMTLDTHVLATESKQVDNT
FT                   TNLLRLMILVALAVGIILARTLLQGRRSRWQQSPYLLTANIPVKEEDESEDDTPEALVG
FT                   QAETDHKPADK"
FT   misc_feature    complement(461966..462031)
FT                   /gene="smp"
FT                   /locus_tag="YPO0441"
FT                   /note="one of 2 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    complement(462419..462484)
FT                   /gene="smp"
FT                   /locus_tag="YPO0441"
FT                   /note="one of 2 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        462755..463735
FT                   /transl_table=11
FT                   /gene="b4388"
FT                   /gene_synonym="serB"
FT                   /locus_tag="YPO0442"
FT                   /product="phosphoserine phosphatase"
FT                   /EC_number="3.1.3.3"
FT                   /note="Similar to Escherichia coli phosphoserine
FT                   phosphatase SerB SW:SERB_ECOLI (P06862) (322 aa) fasta
FT                   scores: E(): 0, 75.0% id in 320 aa, and to Haemophilus
FT                   influenzae phosphoserine phosphatase SerB SW:SERB_HAEIN
FT                   (P44997) (314 aa) fasta scores: E(): 0, 51.0% id in 304 aa"
FT                   /db_xref="GOA:A0A384KFY6"
FT                   /db_xref="InterPro:IPR023190"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041449"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384KFY6"
FT                   /protein_id="CAL19122.1"
FT                   /translation="MSNSLTYCDLPSEIYQWPGLPLSLSGDEVMPLDYRAGHTGWLLYG
FT                   RKLDKQRITDFQRQLGAAMVIVSAWCVEDYQVIRLAGSLTPRIKTLADESGLDVAPLGA
FT                   IPHLRTPGLLVMDMDSTAIQIECIDEIAKLAGVGDEVAAVTERAMQGELDFSASLRQRV
FT                   AALKGADANILKQVRDDLPLMPGLVSLVRKLQALDWHVAIASGGFTYYAEYLRDKLRLV
FT                   HVAANELEIKDGKLTGCVLGPIVDAQYKADTLIKLAEKLNIPLAQTIAIGDGANDLKMM
FT                   QVAGLGLAFHAKPKVYAKAKVAIRHGDLLSVLCILTGSLKHESGK"
FT   CDS_pept        463823..465205
FT                   /transl_table=11
FT                   /gene="b4389"
FT                   /gene_synonym="radA"
FT                   /gene_synonym="sms"
FT                   /locus_tag="YPO0443"
FT                   /product="DNA repair protein RadA"
FT                   /note="Similar to Escherichia coli DNA repair protein RadA
FT                   SW:RADA_ECOLI (P24554) (460 aa) fasta scores: E(): 0, 91.1%
FT                   id in 460 aa, and to Haemophilus influenzae DNA repair
FT                   protein RadA SW:RADA_HAEIN (P45266) (458 aa) fasta scores:
FT                   E(): 0, 79.6% id in 460 aa"
FT                   /db_xref="GOA:A0A384KHZ2"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004504"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020588"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041166"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384KHZ2"
FT                   /protein_id="CAL19123.1"
FT                   /translation="MAKAPKRAFVCNECGADYPRWQGQCSACNAWNTITEVRLAAVASS
FT                   SRNDRFVGYAGDAGVSRVQKLSDISLEELPRFSTGFLEFDRVLGGGVVPGSAILIGGNP
FT                   GAGKSTLLLQTLCKLSENMKTLYVTGEESLQQVAMRAHRLGLPTAGLNMLSETSIEQIC
FT                   LIAEQEQPRLMVIDSIQVMHMADIQSSPGSVAQVRETAAYLTRFAKTRGVAIVMVGHVT
FT                   KDGSLAGPKVLEHCIDCSVMLDGDGDSRFRTLRSHKNRFGAVNELGVFAMTEQGLREVS
FT                   NPSAIFLSRGDEVTAGSSVMVVWEGTRPLLVEIQALVDHSMMSNPRRVAVGLEQNRLAI
FT                   LLAVLHRHGGLQMSDQDVFVNVVGGVKVTETSADLALLMSLVSSLRDRPLPQDLVVFGE
FT                   VGLAGEIRPVPSGQERISEAAKHGFKRAIVPYANMPKKPLPNMQVFGVKKLADALAVLE
FT                   DL"
FT   misc_feature    464126..464149
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:ProSite:PS00017"
FT   CDS_pept        465364..466635
FT                   /transl_table=11
FT                   /gene="b4390"
FT                   /gene_synonym="nadI"
FT                   /gene_synonym="nadR"
FT                   /gene_synonym="pnuA"
FT                   /locus_tag="YPO0444"
FT                   /product="transcriptional regulator NadR"
FT                   /note="Similar to Salmonella typhimurium transcriptional
FT                   regulator NadR SW:NADR_SALTY (P24518) (409 aa) fasta
FT                   scores: E(): 0, 85.0% id in 406 aa, and to Escherichia coli
FT                   transcriptional regulator NadR SW:NADR_ECOLI (P27278) (410
FT                   aa) fasta scores: E(): 0, 83.7% id in 406 aa"
FT                   /db_xref="GOA:A0A384KRK0"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR006417"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR016429"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038727"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384KRK0"
FT                   /protein_id="CAL19124.1"
FT                   /translation="MLQFDYLKTAIKQKGCTLQQVAEASGMTKGYLSQLLNDKIKSPSA
FT                   QKLEALHRFLGLEFPRREKKVGVVFGKFYPLHTGHIYLIQRACSQVDELHVILCHDEPR
FT                   DRELFENSSMSQQPTVSDRLRWLLQTFKYQKNIHIHSFDEHGIEPYPHGWDVWSRGVKA
FT                   FMNEKGIVPSFIYSSESQDAPRYREQLGIETILIDPQRSFMNISGRQIRRDPFRYWDYI
FT                   PTEVKPFFVRTVAILGGESSGKSTLVNKLANIFNTTSAWEYGREYVFSHLGGDEMALQY
FT                   SDYDKIALGQAQYVDFAVKYANKVAFIDTDFVTTQAFCKKYEGREHPFVQALIDEYRFD
FT                   LVILLENNTPWVADGLRSLGSDRDRKSFQNLLEQMLRDNNIEYVHVESADYDARFLRCV
FT                   ELVQQLLAADPQRLARPSVLTDAR"
FT   misc_feature    465382..465549
FT                   /note="Pfam match to entry PF01381 HTH_3,
FT                   Helix-turn-helix,score 41.70, E-value 1.7e-08"
FT                   /inference="protein motif:PF01381"
FT   misc_feature    465409..465474
FT                   /note="Predicted helix-turn-helix motif with score 1872
FT                   (+5.56 SD) at aa 16-37, sequence CTLQQVAEASGMTKGYLSQLLN"
FT   misc_feature    466075..466098
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:ProSite:PS00017"
FT   misc_feature    466078..466101
FT                   /note="PS00687 Aldehyde dehydrogenases glutamic acid active
FT                   site."
FT                   /inference="protein motif:ProSite:PS00687"
FT   CDS_pept        466792..467922
FT                   /transl_table=11
FT                   /locus_tag="YPO0445"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Pseudomonas aeruginosa hypothetical
FT                   protein PA0574 TR:AAG03963 (EMBL:AE004493) (373 aa) fasta
FT                   scores: E(): 0, 57.0% id in 372 aa, and to Sphingomonas
FT                   aromaticivorans hypothetical protein TR:O85863
FT                   (EMBL:AF079317) (379 aa) fasta scores: E(): 0, 37.0% id in
FT                   373 aa"
FT                   /db_xref="InterPro:IPR003812"
FT                   /db_xref="InterPro:IPR025230"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036597"
FT                   /db_xref="InterPro:IPR040198"
FT                   /db_xref="UniProtKB/TrEMBL:Q0WJL9"
FT                   /inference="similar to sequence:INSDC:AE004493"
FT                   /inference="similar to sequence:INSDC:AF079317"
FT                   /protein_id="CAL19125.1"
FT                   /translation="MGENIWVWQQKKWPNFYWDEALIQPQLRHARFKLGQLLGENRTNT
FT                   SAENATKTLDILLANIIASSKIENEPLNIRSVRSSLAKRLGMILEDNYPTSDRTDGLAA
FT                   MMLDAINECKADLTLERLYQWHEWLFPNDLWSLTPMKAGQLRGQEPMQVVSGRIGKETV
FT                   HFEAPPQAILFDEIEQFISWFNLSRSDSFLDPLLRAAIVHFWFVTLHPFEDGNGRITRA
FT                   LTDMALSQADSQSIHLYAMSVAILDNREAYYAILEQGQRGNLDITPWLLWFIATLEQSL
FT                   DQASKGIEHTLAKTSFWLKHNGSGLSAEQVKVLNRLLDGGENGFSAGINASQYQKVAKV
FT                   SKATATRHLADLLARECIEKLPGGGRSTRYQAKYPD"
FT   CDS_pept        complement(468068..469731)
FT                   /pseudo
FT                   /transl_table=11
FT                   /gene="b4391"
FT                   /gene_synonym="yjjK"
FT                   /locus_tag="YPO0446"
FT                   /product="ABC transporter ATP-binding protein (pseudogene)"
FT                   /note="Similar to Escherichia coli ABC transporter
FT                   ATP-binding protein YjjK SW:YJJK_ECOLI (P37797) (554 aa)
FT                   fasta scores: E(): 1.9e-188, 89.892% id in 554 aa, and to
FT                   Haemophilus influenzae ABC transporter ATP-binding protein
FT                   Hi1252 SW:YJJK_HAEIN (P45127) (556 aa) fasta scores: E():
FT                   6e-183, 85.921% id in 554 aa. There is a frameshift around
FT                   codon 190. The sequence has been checked and is believed to
FT                   be correct."
FT   misc_feature    complement(468185..468691)
FT                   /note="Pfam match to entry PF00005 ABC_tran, ABC
FT                   transporter, score 168.60, E-value 1e-46"
FT                   /inference="protein motif:PF00005"
FT   misc_feature    complement(468647..468670)
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:ProSite:PS00017"
FT   misc_feature    complement(469108..469638)
FT                   /note="Pfam match to entry PF00005 ABC_tran, ABC
FT                   transporter, score 58.60, E-value 1.4e-13"
FT                   /inference="protein motif:PF00005"
FT   misc_feature    complement(469201..469245)
FT                   /note="PS00211 ABC transporters family signature."
FT                   /inference="protein motif:ProSite:PS00211"
FT   misc_feature    complement(469594..469617)
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:ProSite:PS00017"
FT   CDS_pept        complement(469914..470420)
FT                   /transl_table=11
FT                   /locus_tag="YPO0448"
FT                   /product="putative lipoprotein"
FT                   /note="Similar to Escherichia coli putative lipoprotein
FT                   YfiB SW:YFIB_ECOLI (P07021) (160 aa) fasta scores: E():
FT                   2.9e-22, 46.1% id in 154 aa, and to Pseudomonas aeruginosa
FT                   probable outer membrane lipoprotein Pa1119 TR:AAG04508
FT                   (EMBL:AE004542) (168 aa) fasta scores: E(): 4.9e-26, 49.4%
FT                   id in 168 aa"
FT                   /db_xref="GOA:A0A384KHY0"
FT                   /db_xref="InterPro:IPR006664"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384KHY0"
FT                   /inference="similar to sequence:INSDC:AE004542"
FT                   /protein_id="CAL19127.1"
FT                   /translation="MQKMQNKRLIQRIWVSFLAMGLMLLVGCQAKPQGLTPDQIAALQE
FT                   QGFKLTDNGWEFGLANKVLFDSDVKKLNSEGMQTVQKIGRILSDVGIKHMRVDGHTDSV
FT                   GKDDYNQQLSYQRALAVADTLATVGIPKSNIDVRGRGKLEPVADNRTSKGRAENRRVAI
FT                   IITAS"
FT   misc_feature    complement(469944..470231)
FT                   /note="Pfam match to entry PF00691 OmpA, OmpA family, score
FT                   102.60, E-value 7.8e-27"
FT                   /inference="protein motif:PF00691"
FT   misc_feature    complement(470337..470369)
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:ProSite:PS00013"
FT   CDS_pept        complement(470426..471703)
FT                   /transl_table=11
FT                   /locus_tag="YPO0449"
FT                   /product="putative exported protein"
FT                   /note="Similar to Escherichia coli hypothetical 46.0 kDa
FT                   protein in aroF-rplS intergenic region YfiN SW:YFIN_ECOLI
FT                   (P46139) (408 aa) fasta scores: E(): 3.1e-52, 36.524% id in
FT                   397 aa, and to Pseudomonas aeruginosa hypothetical protein
FT                   Pa1120 TR:Q9I4L5 (EMBL:AE004542) (435 aa) fasta scores:
FT                   E(): 2.6e-86, 55.639% id in 399 aa"
FT                   /db_xref="GOA:A0A384KP33"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR033417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384KP33"
FT                   /inference="protein motif:TMHMM:2.0"
FT                   /inference="similar to sequence:INSDC:AE004542"
FT                   /protein_id="CAL19128.1"
FT                   /translation="MKPKKNHNSAEKLPTLAGVLRRIHLSVAIVSVVTACIFLTVAALF
FT                   ALRVYVDHNLHLIARAISYTTEAAVVFGDNVEANELLALIASNEEVAEAKIIDKHNRQI
FT                   AYWALPDDGPIHHMEQIVARWILPAPVVLPMFHAGDEIGKIVIVGHGGSLLRFLLQGLA
FT                   GMLACLTVSTLVALFLSRRMLLGIVGSLKRITEVAHNVSRHRSFGQRVPSAKVAELNEL
FT                   SNDFNGLLEELEVWQKHLTQENDSLAYRAAHDSLTGLANRTFFEGRLSRTLNDCQPGEH
FT                   TAVLFLDGDHFKDVNDNYGHAAGDLVLTTIAVRIRALLRETDLVARLGGDEFAVLLTPI
FT                   HNLDDVLTIADHIIDSMALPIILAEGCEITVSLSIGIAVYPDHAQTPEKLLQRADEAMY
FT                   QAKKNFRSGKRIFAYQPNTTNTESLG"
FT   misc_feature    complement(470480..470974)
FT                   /note="Pfam match to entry PF00990 DUF9, Domain of unknown
FT                   function DUF9, score 216.30, E-value 4.5e-61"
FT                   /inference="protein motif:PF00990"
FT   misc_feature    complement(470999..471211)
FT                   /note="Pfam match to entry PF00672 DUF5, HAMP domain, score
FT                   33.00, E-value 7e-06"
FT                   /inference="protein motif:PF00672"
FT   misc_feature    complement(471167..471232)
FT                   /locus_tag="YPO0449"
FT                   /note="one of 2 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    complement(471563..471628)
FT                   /locus_tag="YPO0449"
FT                   /note="one of 2 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    complement(471596..471628)
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:ProSite:PS00013"
FT   CDS_pept        complement(471724..472347)
FT                   /transl_table=11
FT                   /locus_tag="YPO0450"
FT                   /product="putative membrane protein"
FT                   /note="Similar to Pseudomonas aeruginosa hypothetical
FT                   protein Pa1121 TR:AAG04510 (EMBL:AE004542) (190 aa) fasta
FT                   scores: E(): 2e-25, 43.2% id in 148 aa, and to Escherichia
FT                   coli hypothetical 19.0 kDa protein in aroF-rplS intergenic
FT                   region precursor YfiR SW:YFIR_ECOLI (P76597) (172 aa) fasta
FT                   scores: E(): 4.8e-16, 36.0% id in 178 aa"
FT                   /db_xref="InterPro:IPR025293"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384KTC6"
FT                   /inference="similar to sequence:INSDC:AE004542"
FT                   /protein_id="CAL19129.1"
FT                   /translation="MTTATCATNRVSDEHHEPPHRRIVRSRWWGVYLFLLSLLVAVPTP
FT                   LLAASNINADILRERSDAAARMVLGIISYSRWPVAPPVIRLCVISPTDYAEMLFNPALM
FT                   ETTHPVQTQRYSLPNNSLNSKCDVVYLGHIELQQRQQLSIQLNGTPILTISEDYNECTF
FT                   GSVFCLLLNDKQVSFKVNMDALARGGVRIHPSVLQLARKKANAR"
FT   misc_feature    complement(472198..472263)
FT                   /note="1 probable transmembrane helix predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        complement(472722..475448)
FT                   /transl_table=11
FT                   /locus_tag="YPO0451"
FT                   /product="putative cation-transporting P-type ATPase"
FT                   /note="Similar to Pseudomonas aeruginosa probable
FT                   cation-transporting P-type ATPase Pa1429 TR:AAG04818
FT                   (EMBL:AE004572) (902 aa) fasta scores: E(): 0, 44.4% id in
FT                   899 aa, and to Synechocystis sp cation-transporting ATPase
FT                   Pma1 SW:ATA1_SYNY3 (P37367) (905 aa) fasta scores: E():
FT                   0,41.5% id in 867 aa"
FT                   /db_xref="GOA:A0A384KPX3"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR004014"
FT                   /db_xref="InterPro:IPR006068"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384KPX3"
FT                   /inference="protein motif:TMHMM:2.0"
FT                   /inference="similar to sequence:INSDC:AE004572"
FT                   /protein_id="CAL19130.1"
FT                   /translation="MQNSSNPKSASPPPEGKAWYQLTVEESLQHLNSREEGLSQKEAQE
FT                   RLAQYGPNALPARKTKHPLLQFLAHFNDVLIYILLAAALVKGLMGHSVDTIIILCVAVI
FT                   NALIGFIQENKAEKSLKSIQNMLSSKAVVIRDGKAQTIDAQNLVPGDIVTLRPGDKIPT
FT                   DLRLLEAHNLQIEEAILTGESTVVEKQIGVIENESVIGDRKNLLFSGTTISAGTAKGVV
FT                   IASGGDTELGHINQMMATVESTRTPLLQQMDRLGKAIFILILVMMAILFVFAFILRDLP
FT                   VDELLLALISLAVASVPEGLPAIISIILSLGVQAMARNRAIIRKLPTVETLGAMTVVCS
FT                   DKTGTLTMNEMTVKAVILADHCYRVEGESYEPVGNIYPEGREQQAELDTNKALKTFITA
FT                   VNLCNDSQIQQNEQGHWTITGGPTEGALKVLAAKSGIKLDHVTQHGKIPFDSAYKYMAT
FT                   SHQVQSDNSIFLTGAPDVLFTFCQQELTDSGVAPFRRDYWEAEMARYAKQGLRMVAAAF
FT                   RPTDQPVNELDHKDIQQGMVFVGIAGMMDPPRPEAIDAIATCQQAGIRVKMITGDHQET
FT                   AMAIGAMLGIGNGTDSITGSQLEHMDDQQLAEAAVRYDIFARTSPEHKLRLVKALQEKG
FT                   EIVGMTGDGVNDAPALKQADVGIAMGIKGTEVTKEAADMVLSDDNFATIASAVEEGRRV
FT                   YDNLKKTILFVLPTNLAQGLLIIFAILAGAVIPLTPLQILWMNMATSTTLSFGLAFEPA
FT                   EKGIMRRKPRDPSRHVLDGHAIWRIGFVGTLIACSAFALEAYLEPRGYSTEFIRTVLMQ
FT                   TLVTAQWIYMFNCRVMDRFPLNKEVFVNKGLWLVSGVLVLLQLAIIYLPFMNTAFGTAP
FT                   LPAYYWGITLLVAIAIFIIVEIEKWVIGRFKGMNNPV"
FT   misc_feature    complement(472734..473171)
FT                   /note="Pfam match to entry PF00689 Na_K_ATPase_C, Na+/K+
FT                   ATPase C-terminus, score -51.30, E-value 0.00049"
FT                   /inference="protein motif:PF00689"
FT   misc_feature    complement(472770..472826)
FT                   /locus_tag="YPO0451"
FT                   /note="one of 10 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    complement(472872..472937)
FT                   /locus_tag="YPO0451"
FT                   /note="one of 10 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    complement(472977..473033)
FT                   /locus_tag="YPO0451"
FT                   /note="one of 10 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    complement(473064..473129)
FT                   /locus_tag="YPO0451"
FT                   /note="one of 10 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    complement(473199..473264)
FT                   /locus_tag="YPO0451"
FT                   /note="one of 10 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    complement(473277..473342)
FT                   /locus_tag="YPO0451"
FT                   /note="one of 10 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    complement(474408..474428)
FT                   /note="PS00154 E1-E2 ATPases phosphorylation site."
FT                   /inference="protein motif:ProSite:PS00154"
FT   misc_feature    complement(474456..475160)
FT                   /note="Pfam match to entry PF00122 E1-E2_ATPase, E1-E2
FT                   ATPase, score 292.20, E-value 1.4e-87"
FT                   /inference="protein motif:PF00122"
FT   misc_feature    complement(474522..474587)
FT                   /locus_tag="YPO0451"
FT                   /note="one of 10 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    complement(474618..474683)
FT                   /locus_tag="YPO0451"
FT                   /note="one of 10 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    complement(475116..475181)
FT                   /locus_tag="YPO0451"
FT                   /note="one of 10 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    complement(475194..475259)
FT                   /locus_tag="YPO0451"
FT                   /note="one of 10 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    complement(475245..475388)
FT                   /note="Pfam match to entry PF00690 Na_K_ATPase_N, Na+/K+
FT                   ATPase C-terminus, score 24.20, E-value 5.9e-06"
FT                   /inference="protein motif:PF00690"
FT   CDS_pept        476018..477937
FT                   /transl_table=11
FT                   /gene="slt"
FT                   /gene_synonym="sltY"
FT                   /locus_tag="YPO0452"
FT                   /product="putative soluble lytic murein transglycosylase"
FT                   /EC_number="3.2.1.-"
FT                   /note="Similar to Escherichia coli soluble lytic murein
FT                   transglycosylase precursor Slt SW:SLT_ECOLI (P03810) (645
FT                   aa) fasta scores: E(): 0, 63.7% id in 637 aa, and to Vibrio
FT                   cholerae soluble lytic murein transglycosylase VC0700
FT                   TR:Q9KU29 (EMBL:AE004156) (648 aa) fasta scores: E():
FT                   0,35.1% id in 639 aa"
FT                   /db_xref="GOA:A0A384KVX6"
FT                   /db_xref="InterPro:IPR000189"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="InterPro:IPR008939"
FT                   /db_xref="InterPro:IPR012289"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR037061"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384KVX6"
FT                   /inference="similar to sequence:INSDC:AE004156"
FT                   /protein_id="CAL19131.1"
FT                   /translation="MGKWRYLAIGVCLMTTSGVTFADSLDAQRQRYQQVKLAWDSNQMD
FT                   TVAQLMPTLRDYPLYPYLEYRQLTQDLSQVSTAQVKDFLNRHPTLPPAKSLPSRFVNEL
FT                   ARREDWRGLLTFSPTAPKPVAARCNYYYAKWATGEQSVAWEGASEIWLNGQSLPGSCDK
FT                   LFSVWQQAGHQTPLATLARMKLALKEGNASLVSYLLKQLPADYQTMGTALAKLQSDPSS
FT                   VESFARTVGPTDFTRSATTIAFTRLARQDVENARLMIPSLVRLQKMSDSEKLELEEAVA
FT                   WRLMGNDATYEQAKWRDQVALRSHSTSLLERRIRMSLGSGDRQGLATWLARLPAEAQDK
FT                   DEWRYWRASLLLEQGKKAEGEAILRSLTKERGFYPMVAAQKLNIPYPIKVQVAAKPDVS
FT                   LAQRPEIARVRELMYWNMDNQARAEWSYLVASRSKAEQEALARYAFDQKWADLSVQATI
FT                   VAKLWDHLEERFPMAWTKEFRQFTEDKGITPSYAMAIARQESAWNPKAQSPVGATGLMQ
FT                   VMPRTAEHTVKRNNIAGYLNSSQLLDPVTNIEIGTYYLEEVYQQFGRNRILSSAAYNAG
FT                   PSRVNTWLGNSGGQVDAVAFIESIPFSETRGYVKNVLAYDAFYRHFMNRPAKVLSDAEW
FT                   QRRY"
FT   misc_feature    477443..477805
FT                   /note="Pfam match to entry PF01464 SLT, Transglycosylase
FT                   SLT domain, score 140.70, E-value 2.5e-38"
FT                   /inference="protein motif:PF01464"
FT   misc_feature    477500..477586
FT                   /note="PS00922 Prokaryotic transglycosylases signature."
FT                   /inference="protein motif:ProSite:PS00922"
FT   misc_feature    477764..477799
FT                   /note="PS01258 Apoptosis regulator, Bcl-2 family BH2 domain
FT                   signature."
FT                   /inference="protein motif:ProSite:PS01258"
FT   CDS_pept        478188..478565
FT                   /transl_table=11
FT                   /gene="rtrY"
FT                   /gene_synonym="trpR"
FT                   /locus_tag="YPO0453"
FT                   /product="putative Trp operon repressor"
FT                   /note="Similar to Escherichia coli trp operon repressor
FT                   TrpR SW:TRPR_ECOLI (P03032) (107 aa) fasta scores: E():
FT                   3.9e-26, 70.2% id in 104 aa, and to Enterobacter aerogenes
FT                   trp operon repressor TrpR SW:TRPR_ENTAE (P39439) (108 aa)
FT                   fasta scores: E(): 4.9e-28, 70.9% id in 110 aa"
FT                   /db_xref="GOA:P58700"
FT                   /db_xref="InterPro:IPR000831"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013335"
FT                   /db_xref="InterPro:IPR038116"
FT                   /db_xref="UniProtKB/Swiss-Prot:P58700"
FT                   /protein_id="CAL19132.1"
FT                   /translation="MTDEKQVSDSLNRQTAGNPYSAADPALSAEDNQHWLSFVALLQNA
FT                   ITQDLHLPLLQLMLTPDERTALGTRVRIIEELMRGELSQRELKSQLGAGIATITRGSNS
FT                   LKTAPPQLKSWLEAQLLANKR"
FT   misc_feature    478284..478547
FT                   /note="Pfam match to entry PF01371 Trp_repressor, Trp
FT                   repressor protein, score 186.30, E-value 4.8e-52"
FT                   /inference="protein motif:PF01371"
FT   CDS_pept        complement(478562..479104)
FT                   /transl_table=11
FT                   /locus_tag="YPO0454"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Escherichia coli hypothetical protein
FT                   YjjX SW:YJJX_ECOLI (P39411) (173 aa) fasta scores: E():
FT                   0,57.6% id in 170 aa, and to Vibrio cholerae hypothetical
FT                   protein VC0702 TR:Q9KU27 (EMBL:AE004156) (183 aa) fasta
FT                   scores: E(): 0, 53.9% id in 167 aa"
FT                   /db_xref="GOA:Q8ZIP1"
FT                   /db_xref="InterPro:IPR002786"
FT                   /db_xref="InterPro:IPR026533"
FT                   /db_xref="InterPro:IPR029001"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZIP1"
FT                   /inference="similar to sequence:INSDC:AE004156"
FT                   /protein_id="CAL19133.1"
FT                   /translation="MYHVIAATTNPAKINAITLAFDDVYGPGQYRIEGVNVDSGVPLQP
FT                   IGSTETRIGARQRVKNARQVRPEADFWVGIEAGIEDNMTFAWMVVEHLQARGESRSASL
FT                   MLPDIILQGIRQGRELGDEMAVLSGISNVKQQGGAIGIFTQGKLTRTSVYHQALLLALV
FT                   PFHNEIYQRPSPSKPAI"
FT   misc_feature    complement(478595..479089)
FT                   /note="Pfam match to entry PF01931 DUF84, Protein of
FT                   unknown function DUF84, score 219.70, E-value 4.4e-62"
FT                   /inference="protein motif:PF01931"
FT   CDS_pept        479198..479845
FT                   /transl_table=11
FT                   /gene="gpmB"
FT                   /locus_tag="YPO0455"
FT                   /product="putative phosphoglycerate mutase"
FT                   /EC_number="5.4.2.1"
FT                   /note="Similar to Escherichia coli probable
FT                   phosphoglycerate mutase 2 GpmB SW:PMG2_ECOLI (P36942) (215
FT                   aa) fasta scores: E(): 0, 74.9% id in 215 aa, and to
FT                   Deinococcus radiodurans phosphoglycerate putative mutase
FT                   DR1393 TR:Q9RUJ3 (EMBL:AE001985) (237 aa) fasta scores:
FT                   E(): 6e-15, 32.4% id in 207 aa"
FT                   /db_xref="GOA:Q8ZIP0"
FT                   /db_xref="InterPro:IPR001345"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR023086"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZIP0"
FT                   /inference="similar to sequence:INSDC:AE001985"
FT                   /protein_id="CAL19134.1"
FT                   /translation="MLQVYLVRHGETLWNAARRIQGQSDSPLTEIGIRQAHLVAQRVRN
FT                   QGITHIISSDLGRTQQTAKIIADACGLTMVTDPRLRELNMGVLENRPIDSLTPEEEQWR
FT                   KQMVNGTEGARIPEGESMTELGRRMHAALDSCLELPAGSKPLLVSHGMALGCLLSTLLG
FT                   LPAHAERRLRLRNCSLSRVDYQESPWLASGWVIESAGDTAHLDMPALDELQR"
FT   misc_feature    479210..479758
FT                   /note="Pfam match to entry PF00300 PGAM, Phosphoglycerate
FT                   mutase family, score 195.80, E-value 6.9e-55"
FT                   /inference="protein motif:PF00300"
FT   misc_feature    479213..479242
FT                   /note="PS00175 Phosphoglycerate mutase family
FT                   phosphohistidine signature."
FT                   /inference="protein motif:ProSite:PS00175"
FT   CDS_pept        complement(479842..480708)
FT                   /transl_table=11
FT                   /gene="rob"
FT                   /locus_tag="YPO0456"
FT                   /product="putative right origin-binding protein"
FT                   /note="Similar to Escherichia coli right origin-binding
FT                   protein Rob SW:ROB_ECOLI (P27292) (289 aa) fasta scores:
FT                   E(): 0, 68.2% id in 289 aa, and to Bacillus halodurans
FT                   possible transcriptional regulator BH3634 TR:Q9K6U1
FT                   (EMBL:AP001519) (300 aa) fasta scores: E(): 1.7e-19, 30.5%
FT                   id in 311 aa"
FT                   /db_xref="GOA:Q0WJL0"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR010499"
FT                   /db_xref="InterPro:IPR011256"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="InterPro:IPR029442"
FT                   /db_xref="UniProtKB/TrEMBL:Q0WJL0"
FT                   /inference="similar to sequence:INSDC:AP001519"
FT                   /protein_id="CAL19135.1"
FT                   /translation="MDQASIIRDLLSWLESHLDQPLALDNVAAKAGYSKWHLQRMFKDV
FT                   TGNAIGAYIRARRLSKAAVALRLTSRPILDIALQYRFDSQQTFTRAFKKQFAQTPALYR
FT                   RAEDWHSSGICPPIRLGTYTLPQPEFITLPEQHLVGITQSYSCTLEQISTHRAELRLHF
FT                   WQQYLGDADQLPPVLYGLHHSRPNPEKDDEQEIFYTTAIEPQHIPCNVPEGQPVILQGG
FT                   EYVQFSYDGPLDGLQNFILTLYGTILPQLALIRRRGYDIERFYPQGRPKDGPPATLKCD
FT                   YFIPIRR"
FT   misc_feature    complement(480388..480648)
FT                   /note="Pfam match to entry PF00165 HTH_AraC, Bacterial
FT                   regulatory helix-turn-helix proteins, araC family, score
FT                   124.20, E-value 2.4e-33"
FT                   /inference="protein motif:PF00165"
FT   misc_feature    complement(480409..480546)
FT                   /note="PS00041 Bacterial regulatory proteins, araC family
FT                   signature."
FT                   /inference="protein motif:ProSite:PS00041"
FT   CDS_pept        480934..481401
FT                   /transl_table=11
FT                   /gene="creA"
FT                   /locus_tag="YPO0457"
FT                   /product="putative exported protein"
FT                   /note="Similar to Escherichia coli hypothetical protein
FT                   CreA SW:CREA_ECOLI (P08367) (157 aa) fasta scores: E():
FT                   0,78.2% id in 156 aa, and to Pseudomonas aeruginosa
FT                   hypothetical protein Pa4564 TR:AAG07952 (EMBL:AE004870)
FT                   (154 aa) fasta scores: E(): 0, 63.9% id in 155 aa"
FT                   /db_xref="InterPro:IPR010292"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384KW82"
FT                   /inference="similar to sequence:INSDC:AE004870"
FT                   /protein_id="CAL19136.1"
FT                   /translation="MKKSWIFLGCLLSLGAITAQAEEIGSVDTVFKLLGPDHKIVIEAF
FT                   DDPDVKNVTCYISRAKTGGIKGGLGLAEDTADAAISCQQVGPIELSDKIKNKKSEGAVV
FT                   FQKRTSLVFKKLQVVRFYDPKRNSLVYLTYSDRIVDGSPKNAISAVPIMPW"
FT   CDS_pept        complement(481575..482291)
FT                   /transl_table=11
FT                   /gene="arcA"
FT                   /gene_synonym="cpxC"
FT                   /gene_synonym="dye"
FT                   /gene_synonym="fexA"
FT                   /gene_synonym="msp"
FT                   /gene_synonym="seg"
FT                   /gene_synonym="sfrA"
FT                   /locus_tag="YPO0458"
FT                   /product="aerobic respiration control protein"
FT                   /note="Similar to Escherichia coli aerobic respiration
FT                   control protein ArcA SW:ARCA_ECOLI (P03026) (238 aa) fasta
FT                   scores: E(): 0, 92.9% id in 238 aa, and to Vibrio cholerae
FT                   aerobic respiration control protein FexA TR:Q9KPJ9
FT                   (EMBL:AE004307) (238 aa) fasta scores: E(): 0, 85.3% id in
FT                   238 aa"
FT                   /db_xref="GOA:A0A384KMI6"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384KMI6"
FT                   /inference="similar to sequence:INSDC:AE004307"
FT                   /protein_id="CAL19137.1"
FT                   /translation="MQTPHILIVEDEIVTRNTLKSIFEAEGYVVYEANDGAEMHHILSE
FT                   NDINLVIMDINLPGKNGLLLARELREQASVALMFLTGRDNEVDKILGLEIGADDYITKP
FT                   FNPRELTIRARNLLSRTMNLSSVGEERRLVESYKFNGWELDINSRSLVSPTGEHYKLPR
FT                   SEFRAMLHFCENPGKIQSRGELLKKMTGRELKPHDRTVDVTIRRIRKHFESTPDTPEII
FT                   ATIHGEGYRFCGDLEE"
FT   misc_feature    complement(481605..481823)
FT                   /note="Pfam match to entry PF00486
FT                   trans_reg_C,Transcriptional regulatory protein, C terminal,
FT                   score 100.10, E-value 1.2e-28"
FT                   /inference="protein motif:PF00486"
FT   misc_feature    complement(481950..482282)
FT                   /note="Pfam match to entry PF00072 response_reg, Response
FT                   regulator receiver domain, score 114.50, E-value 2.1e-30"
FT                   /inference="protein motif:PF00072"
FT   CDS_pept        483395..485854
FT                   /transl_table=11
FT                   /gene="thrA"
FT                   /gene_synonym="thrA1"
FT                   /gene_synonym="thrA2"
FT                   /locus_tag="YPO0459"
FT                   /product="bifunctional aspartokinase/homoserine
FT                   dehydrogenase I"
FT                   /EC_number="2.7.2.4"
FT                   /note="Similar to Escherichia coli bifunctional
FT                   aspartokinase/homoserine dehydrogenase I ThrA SW:AK1H_ECOLI
FT                   (P00561) (820 aa) fasta scores: E(): 0, 82.0% id in 821
FT                   aa,and to Serratia marcescens bifunctional
FT                   aspartokinase/homoserine dehydrogenase I ThrA SW:AK1H_SERMA
FT                   (P27725) (819 aa) fasta scores: E(): 0, 89.9% id in 819 aa"
FT                   /db_xref="GOA:Q0WJK7"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001341"
FT                   /db_xref="InterPro:IPR001342"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR005106"
FT                   /db_xref="InterPro:IPR011147"
FT                   /db_xref="InterPro:IPR018042"
FT                   /db_xref="InterPro:IPR019811"
FT                   /db_xref="InterPro:IPR027795"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR041743"
FT                   /db_xref="UniProtKB/TrEMBL:Q0WJK7"
FT                   /protein_id="CAL19138.1"
FT                   /translation="MRVLKFGGTSVANAERFMRVADIIESNARQGQVATVLSAPAKITN
FT                   HLVAMIDKMVAGQDISPNISDAERIFAELLRGLADTQPGFDYDRLKALVGHEFAQLKHL
FT                   LHGISLLGQCPDSINASIICRGEKLSIAIMEALFQAKGYHVTVINPVEKLLAQGHYLES
FT                   TVDITESTRRIGASGIPSDHIILMAGFTAGNDKGELVVLGRNGSDYSAAVLAACLRADC
FT                   CEIWTDVDGVYTCDPRTVPDARLLKSMSYQEAMELSYFGAKVLHPRTIAPIARFQIPCL
FT                   IKNTSNPQAPGTLIGGESIDEDSPVKGITNLNNMAMINVSGPGMKGMVGMAARVFAVMS
FT                   RSGISVVLITQSSSEYSISFCVPQGELLRARRALEDEFYLELKDGVLDPLDVMEHLAII
FT                   SVVGDGMRTLRGISARFFSALARANINIIAIAQGSSERSISVVVNNDAVTTGVRVCHQM
FT                   LFNTDQVIEVFVIGVGGVGGALIEQIYRQQPWLKQRHIDLRVCGIANSKAMLTNVHGIA
FT                   LDNWRQELAEVQEPFNLSRLIRLVKEYHLLNPVIVDCTSSQAVADQYADFLTDGFHVVT
FT                   PNKKANTSSMNYYRQMRAAATKSCRKFLYDTNVGAGLPVIENLQNLLNAGDELMRFTGI
FT                   LSGSLSFIFGKLDEGMSLSEATRQAKALGYTEPDPRDDLSGMDVARKLLILAREAGYKL
FT                   ELADIEVESVLPASFDASGDVDTFLARLPSLDAEFTRLVANAAEQGKVLRYVGVIEDGR
FT                   CKVRMEAVDGNDPLYKVKNGENALAFYTRYYQPIPLVLRGYGAGNDVTAAGVFADLLRT
FT                   LSWKLGV"
FT   misc_feature    483395..484159
FT                   /note="Pfam match to entry PF00696 aakinase, Amino acid
FT                   kinase family, score 179.00, E-value 7.8e-50"
FT                   /inference="protein motif:PF00696"
FT   misc_feature    483401..483427
FT                   /note="PS00324 Aspartokinase signature."
FT                   /inference="protein motif:ProSite:PS00324"
FT   misc_feature    484877..485836
FT                   /note="Pfam match to entry PF00742 Homoserine_dh,Homoserine
FT                   dehydrogenase, score 530.00, E-value 1.7e-155"
FT                   /inference="protein motif:PF00742"
FT   misc_feature    485372..485440
FT                   /note="PS01042 Homoserine dehydrogenase signature."
FT                   /inference="protein motif:ProSite:PS01042"
FT   CDS_pept        485857..486786
FT                   /transl_table=11
FT                   /gene="thrB"
FT                   /locus_tag="YPO0460"
FT                   /product="homoserine kinase"
FT                   /EC_number="2.7.1.39"
FT                   /note="Similar to Escherichia coli homoserine kinase ThrB
FT                   SW:KHSE_ECOLI (P00547) (310 aa) fasta scores: E(): 0, 76.6%
FT                   id in 308 aa, and to Serratia marcescens homoserine kinase
FT                   ThrB SW:KHSE_SERMA (P27722) (309 aa) fasta scores: E():
FT                   0,87.4% id in 309 aa"
FT                   /db_xref="GOA:Q8ZIN5"
FT                   /db_xref="InterPro:IPR000870"
FT                   /db_xref="InterPro:IPR006203"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR013750"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036554"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZIN5"
FT                   /protein_id="CAL19139.1"
FT                   /translation="MVKIYAPASIGNVSVGFDVLGAAVSPIDGTLLGDCVSVTAAERFS
FT                   LHNEGRFVSKLPDDPKQNIVYQCWERFCQEMGKEIPVAMVLEKNMPIGSGLGSSACSVV
FT                   AGLMAMNEFCGQPLDKVTLLGMMGELEGRVSGSIHFDNVAPCYLGGMQLILEQEGYISQ
FT                   DVPGFSDWLWVMAYPGIKVSTAEARAILPAQYRRQDCITHGRNLAGFIHACHTQQPDLA
FT                   AKMMKDVIAEPYRTQLLPGFAAARQAAQDIGALACGISGSGPTLFAVCNDQATAQRMAG
FT                   WLQNHYLQNDEGFVHICRLDTAGARLLG"
FT   misc_feature    486061..486252
FT                   /note="Pfam match to entry PF00288 GHMP_kinases, GHMP
FT                   kinases putative ATP-binding proteins, score 65.10, E-value
FT                   5.6e-17"
FT                   /inference="protein motif:PF00288"
FT   misc_feature    486124..486159
FT                   /note="PS00627 GHMP kinases putative ATP-binding domain."
FT                   /inference="protein motif:ProSite:PS00627"
FT   misc_feature    486127..486159
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:ProSite:PS00013"
FT   CDS_pept        486790..488079
FT                   /transl_table=11
FT                   /gene="thrC"
FT                   /locus_tag="YPO0461"
FT                   /product="threonine synthase"
FT                   /EC_number="4.2.3.1"
FT                   /note="Similar to Escherichia coli threonine synthase ThrC
FT                   SW:THRC_ECOLI (P00934) (428 aa) fasta scores: E(): 0, 83.1%
FT                   id in 425 aa, and to Serratia marcescens threonine synthase
FT                   ThrC SW:THRC_SERMA (P27735) (429 aa) fasta scores: E():
FT                   0,89.3% id in 428 aa"
FT                   /db_xref="GOA:A0A384K8U0"
FT                   /db_xref="InterPro:IPR000634"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR004450"
FT                   /db_xref="InterPro:IPR029144"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="InterPro:IPR037158"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384K8U0"
FT                   /protein_id="CAL19140.1"
FT                   /translation="MKLYNLKDHNEQVSFAQAIKQGLGKQQGLFFPLELPEFELTEIDK
FT                   LLDLDFVTRSSRILSAFIGSEIAPDVLTKRVQAAFEFPAPVAQVENDIAVLELFHGPTL
FT                   AFKDFGARFMAQMLAEVAGDQPVTILTATSGDTGAAVAHAFYGLKNVRVVILYPRGKIS
FT                   PLQEKLFCTLGGNIHTVAIDGDFDACQALVKQAFDDEELKTALSLNSANSINISRLLAQ
FT                   ICYYFEAVAQLPQEARNQLVISVPSGNFGDLTAGLLAKSLGLPVKRFIAATNANDTVPR
FT                   FLVNGQWQPKPTVATLSNAMDVSQPNNWPRVEELYRRKIWQLKDLGHGAVSDKTTKDTM
FT                   RELAGLGYISEPHAAIAYRVLRDQLQDGEFGLFIGTAHPAKFKESVEAILGQELPLPKP
FT                   LAVRAQLPLLSHDLPADFAQMRAFLMALPK"
FT   misc_feature    487018..487923
FT                   /note="Pfam match to entry PF00291 PALP,Pyridoxal-phosphate
FT                   dependent enzyme, score 132.10, E-value 1e-35"
FT                   /inference="protein motif:PF00291"
FT   misc_feature    487078..487122
FT                   /note="PS00165 Serine/threonine dehydratases
FT                   pyridoxal-phosphate attachment site."
FT                   /inference="protein motif:ProSite:PS00165"
FT   CDS_pept        complement(488896..489672)
FT                   /transl_table=11
FT                   /locus_tag="YPO0462"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Escherichia coli protein YaaA
FT                   SW:YAAA_ECOLI (P11288) (258 aa) fasta scores: E(): 0, 78.6%
FT                   id in 257 aa, and to Vibrio cholerae hypothetical protein
FT                   VC2355 TR:Q9KPL2 (EMBL:AE004305) (257 aa) fasta scores:
FT                   E(): 0, 65.0% id in 257 aa"
FT                   /db_xref="GOA:Q8ZIN3"
FT                   /db_xref="InterPro:IPR005583"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZIN3"
FT                   /inference="similar to sequence:INSDC:AE004305"
FT                   /protein_id="CAL19141.1"
FT                   /translation="MLIIISPAKTLDYQSPLATTKFSQPEMLDKSQALIEICRELTPAQ
FT                   ISSLMGISDKLAGLNAARFSEWQPDFTPANARQAILAFKGDVYTGMQAESFSEADFDFA
FT                   QQHLRMLSGLYGLLRPLDLMQPYRLEMGTKLANPRGKDLYAFWGDQITEKLNQALELQG
FT                   DNILINLASDEYFKAVKPAKLSGSLIKPVFLDEKNGKYKIISFYAKKARGLMSRFIIQN
FT                   KLTKPEQLVDFNLEGYEFDAGLSAKNELVFKRAEQH"
FT   misc_feature    complement(489388..489435)
FT                   /note="PS00225 Crystallins beta and gamma 'Greek key' motif
FT                   signature."
FT                   /inference="protein motif:ProSite:PS00225"
FT   CDS_pept        490204..491157
FT                   /transl_table=11
FT                   /gene="talB"
FT                   /locus_tag="YPO0463"
FT                   /product="transaldolase B"
FT                   /EC_number="2.2.1.2"
FT                   /note="Similar to Escherichia coli transaldolase B TalB
FT                   SW:TALB_ECOLI (P30148) (316 aa) fasta scores: E(): 0, 88.9%
FT                   id in 316 aa, and to Haemophilus influenzae transaldolase
FT                   Tal SW:TAL_HAEIN (P45055) (316 aa) fasta scores: E():
FT                   0,77.3% id in 313 aa"
FT                   /db_xref="GOA:Q8ZIN2"
FT                   /db_xref="InterPro:IPR001585"
FT                   /db_xref="InterPro:IPR004730"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018225"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZIN2"
FT                   /protein_id="CAL19142.1"
FT                   /translation="MTDKLTSLRQITTVVADTGDIAAMKLYQPQDATTNPSIILNAAQI
FT                   PEYRKLIDEAIAWAREQSSDHAQQIVDATDKLAVNIGLEILKLIPGRISTEVDARLSYD
FT                   TVASVAKAKRLIKLYNEAGISNDRILIKLASTWQGIRAAEQLEKEGINCNLTLLFSFAQ
FT                   ARACAEAGVFLISPFVGRILDWYKANGDQKEFAPSEDPGVVSVTEIYQYYKKHGYKTVV
FT                   MGASFRNLGEIIELAGCDRLTIAPSLLKELAESEGPVERKLAYTGEIQAKPAPLTEAEF
FT                   YWQHNQDPMAVDKLADGIRKFAIDQGKLEKMISDLL"
FT   misc_feature    490228..490944
FT                   /note="Pfam match to entry PF00923
FT                   Transaldolase,Transaldolase, score 454.00, E-value
FT                   1.2e-132"
FT                   /inference="protein motif:PF00923"
FT   misc_feature    490294..490320
FT                   /note="PS01054 Transaldolase signature 1."
FT                   /inference="protein motif:ProSite:PS01054"
FT   misc_feature    490588..490641
FT                   /note="PS00958 Transaldolase active site."
FT                   /inference="protein motif:ProSite:PS00958"
FT   CDS_pept        491445..492032
FT                   /transl_table=11
FT                   /gene="chlG"
FT                   /gene_synonym="mog"
FT                   /gene_synonym="mogA"
FT                   /locus_tag="YPO0464"
FT                   /product="molybdopterin biosynthesis protein"
FT                   /note="Similar to Escherichia coli molybdopterin
FT                   biosynthesis protein Mog SW:MOG_ECOLI (P28694) (195 aa)
FT                   fasta scores: E(): 0, 87.2% id in 195 aa, and to
FT                   Haemophilus influenzae molybdopterin biosynthesis protein
FT                   Mog SW:MOG_HAEIN (P44645) (197 aa) fasta scores: E():
FT                   0,75.4% id in 187 aa"
FT                   /db_xref="GOA:A0A384LCF0"
FT                   /db_xref="InterPro:IPR001453"
FT                   /db_xref="InterPro:IPR008284"
FT                   /db_xref="InterPro:IPR036425"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384LCF0"
FT                   /protein_id="CAL19143.1"
FT                   /translation="MNILRIGLVSVSDRASSGIYQDKGIPALEEWLTSALTTPFEVETR
FT                   LIPDEQSLIEQTLCELVDEMGCHLVLTTGGTGPARRDVTPDATLAIADRQMPGFGEQMR
FT                   QISLHYVPTAILSRQVGVIRKQALIINLPGQPKSIKETLEGVKDAQSNVVVAGIFASVP
FT                   YCIQLLDGPYIETNTDVVVAFRPKSAIIDIKD"
FT   misc_feature    491649..491690
FT                   /note="PS01078 Molybdenum cofactor biosynthesis proteins
FT                   signature 1."
FT                   /inference="protein motif:ProSite:PS01078"
FT   CDS_pept        492160..493548
FT                   /transl_table=11
FT                   /locus_tag="YPO0465"
FT                   /product="putative transport protein"
FT                   /note="Similar to Pseudomonas aeruginosa probable MFS
FT                   transporter Pa5370 TR:AAG08755 (EMBL:AE004949) (438 aa)
FT                   fasta scores: E(): 0, 69.2% id in 412 aa, and to
FT                   Campylobacter jejuni putative transmembrane transport
FT                   protein Cj0250C TR:Q9PIP5 (EMBL:AL139074) (436 aa) fasta
FT                   scores: E(): 0, 45.1% id in 419 aa"
FT                   /db_xref="GOA:A0A384KMC4"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384KMC4"
FT                   /inference="protein motif:TMHMM:2.0"
FT                   /inference="similar to sequence:INSDC:AE004949"
FT                   /inference="similar to sequence:INSDC:AL139074"
FT                   /protein_id="CAL19144.1"
FT                   /translation="MSQDHNSSQVGSSQIDSSQHHVDQQHNHNRRLNKQDYKTLTLAAL
FT                   GGALEFYDFIIFVFFAAVIGDLFFPADMPEWLRQVQTFGIFAAGYLARPLGGIIMAHFG
FT                   DLVGRKKMFTLSILLMALPTLAIGMLPTYATIGITAPLLLLLMRVLQGAAIGGEVPGAW
FT                   VFVAEHVPRKRIGIACGTLTAGLTAGILLGSLVATVMNTTLGHQAILEGGWRIPFFLGG
FT                   IFGLFAMYLRRWLQETPIFKEMQARKTLAEELPLKSVVVNHKKEVVVSMLLTWLLSAGI
FT                   VVVILMTPTYLQKQFNVPPELALQANSLAIIALVIGCVVAGLAIDRFGASKTFIVGSLM
FT                   LAMSTWSFYHTNLTNPSQLFPHYMLAGFCVGIVGAVPYVMVRAFPAEVRFTGISFSYNV
FT                   AYAIFGGLTPILVTLWMKSSAMAPAYYMLVLSLVGLLLGIYLRNDINSEVKVQMPKRVM
FT                   NGVN"
FT   misc_feature    492274..493506
FT                   /note="Pfam match to entry PF00083 sugar_tr, Sugar (and
FT                   other) transporter, score 75.80, E-value 8.8e-19"
FT                   /inference="protein motif:PF00083"
FT   misc_feature    492277..492345
FT                   /locus_tag="YPO0465"
FT                   /note="one of 12 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    492403..492471
FT                   /locus_tag="YPO0465"
FT                   /note="one of 12 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    492508..492576
FT                   /locus_tag="YPO0465"
FT                   /note="one of 12 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    492589..492657
FT                   /locus_tag="YPO0465"
FT                   /note="one of 12 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    492682..492750
FT                   /locus_tag="YPO0465"
FT                   /note="one of 12 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    492793..492852
FT                   /locus_tag="YPO0465"
FT                   /note="one of 12 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    492955..493023
FT                   /locus_tag="YPO0465"
FT                   /note="one of 12 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    493066..493134
FT                   /locus_tag="YPO0465"
FT                   /note="one of 12 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    493153..493206
FT                   /locus_tag="YPO0465"
FT                   /note="one of 12 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    493234..493302
FT                   /locus_tag="YPO0465"
FT                   /note="one of 12 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    493339..493407
FT                   /locus_tag="YPO0465"
FT                   /note="one of 12 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    493420..493488
FT                   /locus_tag="YPO0465"
FT                   /note="one of 12 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        complement(493618..496065)
FT                   /transl_table=11
FT                   /locus_tag="YPO0466"
FT                   /product="hypothetical protein"
FT                   /note="No significant database matches. CDS DNA contains
FT                   low GC content, 35.33%"
FT                   /db_xref="GOA:A0A384KBF3"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR001064"
FT                   /db_xref="InterPro:IPR011024"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384KBF3"
FT                   /protein_id="CAL19145.1"
FT                   /translation="MKKTNKLLISIVSAISFSAYSNDINDAKVCFYELENFSGESFCAY
FT                   EGESQSTINNDFDKKIKSISIPPGMVITLYDGIDFTGKKKKLKNDVNLDGMKSFGLYNK
FT                   ISSYHIDPAVCFYTEDNFQGDSTCLAASQHIDLYSDAEGFANSNRTVLPIHNDSIQSIK
FT                   VPLGMMTTIYKNDQFNAPFFELTENINLETLKTLAMDNQLTSLKASEKKGLYCDQKCII
FT                   LEKHEINLPEVFGEYWHDSRLVNKQVILSFNSQENGINDDYKINLTNGPSVRILKNEII
FT                   FSDYNMITKFSFDRIDKFDKLSFILQIEKDIVQVQYIQTLDDQLIDLSPIISFKWTHMI
FT                   DDTPTLTIKNKNTDKPLILNKSIITADTGDQNWEKRDIENTSQIICAFTPFLNLYNYIV
FT                   QGTCRQLDGIIFKADQYFNSNTKGKTLHIAGKSFPLKPDLLTELNNDGLHENKMLLTYI
FT                   DNVNNNQSLSLPAVAKTCMVSIHSILSTRQTRQIRPACIDWTLEIMTDFTLLFGSSLRT
FT                   WNTEYFGRIIQSIITTGNTGVAVENTEIEKRLSHAVKKAIMSQSIDSTLDHIKTAFDYA
FT                   QLNYFDYSLFYVSEDTPSQVEQLPLGIYELLLPSFIYRPIPPIIIENSERVEQHELAFE
FT                   IEILPSLFPEDARPSDTEIEHARELRQKISETIAQWGQQYQGAHAIDDVDQEVNADENA
FT                   ALSQLLHAGHIVTGIIHRRLILNRPGEIYVVVKLRGEIIAIVLADRFNNRDEVELVASA
FT                   TLPDYVLSPDSEGTVRGAGTAAVYELARYLQQQGAKTLFSETISQPSARVKQKVGFTFK
FT                   SEF"
FT   CDS_pept        complement(496354..496965)
FT                   /transl_table=11
FT                   /gene="yaaH"
FT                   /locus_tag="YPO0467"
FT                   /product="putative membrane protein"
FT                   /note="Similar to Escherichia coli hypothetical 20.1 kDa
FT                   protein in mog-htgA intergenic region YaaH or B0010
FT                   SW:YAAH_ECOLI (P28695) (188 aa) fasta scores: E(): 0, 73.7%
FT                   id in 186 aa, and to Vibrio cholerae hypothetical protein
FT                   Vc0770 TR:Q9KTW0 (EMBL:AE004162) (197 aa) fasta scores:
FT                   E(): 0, 66.8% id in 184 aa"
FT                   /db_xref="GOA:A0A384KFU2"
FT                   /db_xref="InterPro:IPR000791"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384KFU2"
FT                   /inference="protein motif:TMHMM:2.0"
FT                   /inference="similar to sequence:INSDC:AE004162"
FT                   /protein_id="CAL19146.1"
FT                   /translation="MNTIKLANPGPLGLMGFGMTTVLLNLHNAGFFPLSSVILSMGIFY
FT                   GGLAQILAGLLEYKKGNTFAATAFTSYGAFWLSLVGLLMLPKMGLADATDAQFLGVYLG
FT                   LWGIFTLFMFIGTLPANRALQFVFGSLTILFALLAVGNFTDNHTLLMFAGFEGIICGAS
FT                   AIYLAMAEVLNEQYGRTILPIGEPLPIGEPSQTLETQAVM"
FT   misc_feature    complement(496402..496962)
FT                   /note="Pfam match to entry PF01184
FT                   Grp1_Fun34_YaaH,GPR1/FUN34/yaaH family, score 314.60,
FT                   E-value 1.2e-90"
FT                   /inference="protein motif:PF01184"
FT   misc_feature    complement(496456..496521)
FT                   /gene="yaaH"
FT                   /locus_tag="YPO0467"
FT                   /note="one of 6 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    complement(496543..496593)
FT                   /gene="yaaH"
FT                   /locus_tag="YPO0467"
FT                   /note="one of 6 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    complement(496606..496671)
FT                   /gene="yaaH"
FT                   /locus_tag="YPO0467"
FT                   /note="one of 6 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    complement(496711..496776)
FT                   /gene="yaaH"
FT                   /locus_tag="YPO0467"
FT                   /note="one of 6 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    complement(496807..496872)
FT                   /gene="yaaH"
FT                   /locus_tag="YPO0467"
FT                   /note="one of 6 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    complement(496888..496953)
FT                   /gene="yaaH"
FT                   /locus_tag="YPO0467"
FT                   /note="one of 6 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        497339..499249
FT                   /transl_table=11
FT                   /gene="dnaK"
FT                   /gene_synonym="groP"
FT                   /gene_synonym="grpF"
FT                   /gene_synonym="seg"
FT                   /locus_tag="YPO0468"
FT                   /product="chaperone protein DnaK"
FT                   /note="Similar to Escherichia coli chaperone protein DnaK
FT                   SW:DNAK_ECOLI (P04475) (637 aa) fasta scores: E(): 0, 91.4%
FT                   id in 638 aa, and to Salmonella typhimurium chaperone
FT                   protein DnaK SW:DNAK_SALTY (Q56073) (637 aa) fasta scores:
FT                   E(): 0, 91.7% id in 637 aa"
FT                   /db_xref="GOA:Q8ZIM7"
FT                   /db_xref="InterPro:IPR012725"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="InterPro:IPR018181"
FT                   /db_xref="InterPro:IPR029047"
FT                   /db_xref="InterPro:IPR029048"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZIM7"
FT                   /protein_id="CAL19147.1"
FT                   /translation="MGKIIGIDLGTTNSCVAIMDGTKARVLENSEGDRTTPSIIAYTQD
FT                   GETLVGQPAKRQAVTNPQNTLFAIKRLIGRRFQDEEAQRDKDIMPYKIIAADNGDAWLE
FT                   VKGQKMAPPQISAEVLKKMKKTAEDYLGEPVTEAVITVPAYFNDAQRQATKDAGRIAGL
FT                   EVKRIINEPTAAALAYGLDKEVGNRTIAVYDLGGGTFDISIIEIDEVDGEKTFEVLATN
FT                   GDTHLGGEDFDSRLINYLVEEFKKDQGMDLRTDPLAMQRLKEAAEKAKIELSSAQQTDV
FT                   NLPYITADGSGPKHMNIKVTRAKLESLVEDLVNRSIEPLKVALQDAGLSVSDIQDVILV
FT                   GGQTRMPMVQKKVADFFGKEPRKDVNPDEAVAIGAAVQGGVLSGEVKDVLLLDVTPLSL
FT                   GIETMGGVMTPLITKNTTIPTKHSQVFSTAEDNQSAVTIHVLQGERKRAQDNKSLGQFN
FT                   LDGIQPAPRGMAQIEVTFDIDADGILHVSAKDKNTGREQKITIKASSGLNEEEIQKMVR
FT                   DAEANAEADRKFEELVQTRNQADHLIHGTRKQLEEAGDKLPAEDKTAIEEAMKGLEAAL
FT                   KGEDKAEIEAKTQALVQVSGKLLEMAQQQQAAAGGDAGDTSAKKEDDVVDAEFEEVKDK
FT                   K"
FT   misc_feature    497348..499150
FT                   /note="Pfam match to entry PF00012 HSP70, Hsp70
FT                   protein,score 1355.50, E-value 0"
FT                   /inference="protein motif:PF00012"
FT   misc_feature    497357..497380
FT                   /note="PS00297 Heat shock hsp70 proteins family signature
FT                   1."
FT                   /inference="protein motif:ProSite:PS00297"
FT   misc_feature    497912..497953
FT                   /note="PS00329 Heat shock hsp70 proteins family signature
FT                   2."
FT                   /inference="protein motif:ProSite:PS00329"
FT   misc_feature    498347..498391
FT                   /note="PS01036 Heat shock hsp70 proteins family signature
FT                   3."
FT                   /inference="protein motif:ProSite:PS01036"
FT   CDS_pept        499361..500500
FT                   /transl_table=11
FT                   /gene="dnaJ"
FT                   /gene_synonym="groP"
FT                   /locus_tag="YPO0469"
FT                   /product="chaperone protein DnaJ"
FT                   /note="Similar to Escherichia coli chaperone protein DnaJ
FT                   SW:DNAJ_ECOLI (P08622) (375 aa) fasta scores: E(): 0, 86.5%
FT                   id in 378 aa, and to Salmonella typhimurium chaperone
FT                   protein DnaJ SW:DNAJ_SALTY (Q60004) (378 aa) fasta scores:
FT                   E(): 0, 87.6% id in 379 aa"
FT                   /db_xref="GOA:Q8ZIM6"
FT                   /db_xref="InterPro:IPR001305"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR002939"
FT                   /db_xref="InterPro:IPR008971"
FT                   /db_xref="InterPro:IPR012724"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="InterPro:IPR036410"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZIM6"
FT                   /protein_id="CAL19148.1"
FT                   /translation="MAKRDYYEVLGVSRDAEEREIKKAYKRLAMKFHPDRQSEDKNAEE
FT                   KFKEAKEAYEILTDAQKRAAYDQYGHAAFEQGGMGGGGFGGGGGGADFSDIFGDVFGDI
FT                   FGGGRRQQRASRGSDLRYNMDLTLEEAVRGVTKEIRIPTLDECDVCHGSGAKPGSSPVT
FT                   CPTCHGAGQVQMRQGFFTVQQACPHCHGRGQIIKDPCNKCHGHGRVEKSKTLSVKIPAG
FT                   VDTGDRIRLSGEGEAGEHGAPSGDLYVQVQVKAHPIFEREGNNLYCEVPINFAMAALGG
FT                   EIEVPTLDGRVKLKIPAETQTGKMFRMRGKGVKSVRGGSQGDLLCRVVVETPVSLSEKQ
FT                   KQLLRELEESFVGAAGEKNSPRAKSFLDGVKKFFDDLTR"
FT   misc_feature    499373..499570
FT                   /note="Pfam match to entry PF00226 DnaJ, DnaJ domain, score
FT                   127.90, E-value 1.9e-34"
FT                   /inference="protein motif:PF00226"
FT   misc_feature    499499..499558
FT                   /note="PS00636 Nt-dnaJ domain signature."
FT                   /inference="protein motif:ProSite:PS00636"
FT   misc_feature    499760..500002
FT                   /note="Pfam match to entry PF00684 DnaJ_CXXCXGXG, DnaJ
FT                   central domain (4 repeats), score 172.80, E-value 5.5e-48"
FT                   /inference="protein motif:PF00684"
FT   misc_feature    499799..499873
FT                   /note="PS00637 CXXCXGXG dnaJ domain signature."
FT                   /inference="protein motif:ProSite:PS00637"
FT   misc_feature    499799..499816
FT                   /note="PS00190 Cytochrome c family heme-binding site
FT                   signature."
FT                   /inference="protein motif:ProSite:PS00190"
FT   misc_feature    499958..499975
FT                   /note="PS00190 Cytochrome c family heme-binding site
FT                   signature."
FT                   /inference="protein motif:ProSite:PS00190"
FT   misc_feature    500039..500404
FT                   /note="Pfam match to entry PF01556 DnaJ_C, DnaJ C terminal
FT                   region, score 278.50, E-value 8.9e-80"
FT                   /inference="protein motif:PF01556"
FT   CDS_pept        500743..501927
FT                   /transl_table=11
FT                   /gene="ant"
FT                   /gene_synonym="b0019"
FT                   /gene_synonym="nhaA"
FT                   /locus_tag="YPO0470"
FT                   /product="sodium-proton antiporter"
FT                   /note="Similar to Escherichia coli sodium-proton antiporter
FT                   1 NhaA SW:NHAA_ECOLI (P13738) (388 aa) fasta scores: E():
FT                   0, 65.9% id in 381 aa, and to Vibrio cholerae sodium-proton
FT                   antiporter affecting protein NhaA TR:O85187 (EMBL:AF051158)
FT                   (382 aa) fasta scores: E(): 0, 64.3% id in 389 aa"
FT                   /db_xref="GOA:Q7CG77"
FT                   /db_xref="InterPro:IPR004670"
FT                   /db_xref="InterPro:IPR023171"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7CG77"
FT                   /inference="protein motif:TMHMM:2.0"
FT                   /inference="similar to sequence:INSDC:AF051158"
FT                   /protein_id="CAL19149.1"
FT                   /translation="MTNIIRQFLRQEAAGGLILIIAAAIALLMANSALQGVYQSFLDIP
FT                   VSIKIASLDISKPLLLWINDGLMAVFFLMIGLEVKRELMEGSLAGRDKAVFPAIAALGG
FT                   MLAPALIYLLFNGADEVTRQGWAIPAATDIAFALGVMALLGNRVPTGLKVFLLALAIID
FT                   DLGVIIIIALFYTQQVSLQSLGIAAAAIALLAYMNWRGVGKTSAYLLVGLVLWVCILKS
FT                   GVHATLAGVIVGFMIPLHTQDQRSPSESLEHGLHPWVAYLILPLFAFANAGVSLQGVSL
FT                   SGLTSLLPMGIATGLFIGKPLGIFTFSWLAVKLGIAKLPDAINFKQIFAVSVLCGIGFT
FT                   MSIFIASLAFEGTDIALTTYSKLGILLGSTTAAVVGYSLLRLVLPARRKAVNVR"
FT   misc_feature    501022..501090
FT                   /gene="ant"
FT                   /gene_synonym="b0019"
FT                   /gene_synonym="nhaA"
FT                   /locus_tag="YPO0470"
FT                   /note="one of 10 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    501115..501174
FT                   /gene="ant"
FT                   /gene_synonym="b0019"
FT                   /gene_synonym="nhaA"
FT                   /locus_tag="YPO0470"
FT                   /note="one of 10 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    501202..501270
FT                   /gene="ant"
FT                   /gene_synonym="b0019"
FT                   /gene_synonym="nhaA"
FT                   /locus_tag="YPO0470"
FT                   /note="one of 10 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    501283..501351
FT                   /gene="ant"
FT                   /gene_synonym="b0019"
FT                   /gene_synonym="nhaA"
FT                   /locus_tag="YPO0470"
FT                   /note="one of 10 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    501379..501447
FT                   /gene="ant"
FT                   /gene_synonym="b0019"
FT                   /gene_synonym="nhaA"
FT                   /locus_tag="YPO0470"
FT                   /note="one of 10 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    501514..501582
FT                   /gene="ant"
FT                   /gene_synonym="b0019"
FT                   /gene_synonym="nhaA"
FT                   /locus_tag="YPO0470"
FT                   /note="one of 10 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    501610..501678
FT                   /gene="ant"
FT                   /gene_synonym="b0019"
FT                   /gene_synonym="nhaA"
FT                   /locus_tag="YPO0470"
FT                   /note="one of 10 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    501724..501792
FT                   /gene="ant"
FT                   /gene_synonym="b0019"
FT                   /gene_synonym="nhaA"
FT                   /locus_tag="YPO0470"
FT                   /note="one of 10 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    501835..501894
FT                   /gene="ant"
FT                   /gene_synonym="b0019"
FT                   /gene_synonym="nhaA"
FT                   /locus_tag="YPO0470"
FT                   /note="one of 10 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        502057..502956
FT                   /transl_table=11
FT                   /gene="antO"
FT                   /gene_synonym="b0020"
FT                   /gene_synonym="nhaR"
FT                   /locus_tag="YPO0471"
FT                   /product="transcriptional activator protein NhaR"
FT                   /note="Similar to Escherichia coli transcriptional
FT                   activator protein NhaR SW:NHAR_ECOLI (P10087) (301 aa)
FT                   fasta scores: E(): 0, 78.5% id in 298 aa, and to Vibrio
FT                   cholerae transcriptional activator protein NhaR
FT                   SW:NHAR_VIBCH (P52692) (296 aa) fasta scores: E(): 0, 67.2%
FT                   id in 296 aa"
FT                   /db_xref="GOA:A0A384KF89"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384KF89"
FT                   /protein_id="CAL19150.1"
FT                   /translation="MRMSHINFNHLYYFWQVCKEGSVVGAAEALFLTPQTITGQIKALE
FT                   GRLGGKLFKRRGRGLVPSELGQLVFRYADKMFMLSQEMLDIVNYRKESHLLFDVGVADA
FT                   LSKRLVSQVLETAVVEHEKIHLRCFESTHEMLLEQLSQHKLDMILSDCPVDSSQQEGLF
FT                   SVKLGECSVSFYCRQPVPDLPFPASLQQKRLLIPGRRSMLGRKLLNWINSKGLKVEVLG
FT                   EFDDAALMNAFAVYHDAIFVAPTIYAADTYANDSEIIEIGRLDNVQEEYYVIFAERMIQ
FT                   HPAVQRVCNKDFSALFNC"
FT   misc_feature    502078..502503
FT                   /note="Pfam match to entry PF00126 HTH_1, Bacterial
FT                   regulatory helix-turn-helix protein, lysR family, score
FT                   133.00, E-value 5.5e-36"
FT                   /inference="protein motif:PF00126"
FT   misc_feature    502120..502212
FT                   /note="PS00044 Bacterial regulatory proteins, lysR family
FT                   signature."
FT                   /inference="protein motif:ProSite:PS00044"
FT   CDS_pept        complement(503087..503350)
FT                   /transl_table=11
FT                   /gene="b0023"
FT                   /gene_synonym="rpsT"
FT                   /locus_tag="YPO0472"
FT                   /product="30S ribosomal protein S20"
FT                   /note="Similar to Escherichia coli 30S ribosomal protein
FT                   S20 RpsT SW:RS20_ECOLI (P02378) (86 aa) fasta scores: E():
FT                   1.1e-26, 87.1% id in 85 aa, and to Proteus mirabilis 30S
FT                   ribosomal protein S20 RpsT SW:RS20_PROMI (P42275) (72 aa)
FT                   fasta scores: E(): 2.2e-22, 85.9% id in 71 aa"
FT                   /db_xref="GOA:Q8ZIM3"
FT                   /db_xref="InterPro:IPR002583"
FT                   /db_xref="InterPro:IPR036510"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZIM3"
FT                   /protein_id="CAL19151.1"
FT                   /translation="MANIKSAKKRAVQSEKRRKHNASRRSMVRTFIKKVYAAIAAGDKD
FT                   AAQKAFNEMQPIVDRQSCKGLIHKNKAARHKSNLVAQINAMQ"
FT   misc_feature    complement(503096..503347)
FT                   /note="Pfam match to entry PF01649 Ribosomal_S20p,Ribosomal
FT                   protein S20, score 159.30, E-value 6.4e-44"
FT                   /inference="protein motif:PF01649"
FT   CDS_pept        complement(503372..503548)
FT                   /transl_table=11
FT                   /locus_tag="YPO0473"
FT                   /product="hypothetical protein"
FT                   /note="Doubtful CDS. No significant database hits"
FT                   /db_xref="UniProtKB/TrEMBL:Q74Q15"
FT                   /protein_id="CAL19152.1"
FT                   /translation="MKLWNFLSKDCIPQREAGKIPLHHNVASAARTNGAYLHKSIDKRR
FT                   LKGHIPRPLNCPQ"
FT   CDS_pept        503765..504703
FT                   /transl_table=11
FT                   /gene="b0025"
FT                   /gene_synonym="ribF"
FT                   /locus_tag="YPO0474"
FT                   /product="riboflavin biosynthesis protein (includes:
FT                   riboflavin kinase and FMN adenyltransferase)"
FT                   /EC_number="2.7.1.26"
FT                   /EC_number="2.7.7.2"
FT                   /note="Similar to Escherichia coli riboflavin biosynthesis
FT                   protein RibF SW:RIBF_ECOLI (P08391) (313 aa) fasta scores:
FT                   E(): 0, 75.3% id in 312 aa, and to Vibrio cholerae
FT                   riboflavin kinase/FMN adenylyltransferase VC0681 TR:Q9KU48
FT                   (EMBL:AE004154) (322 aa) fasta scores: E(): 0, 64.7% id in
FT                   306 aa"
FT                   /db_xref="GOA:A0A384LE02"
FT                   /db_xref="InterPro:IPR002606"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015864"
FT                   /db_xref="InterPro:IPR015865"
FT                   /db_xref="InterPro:IPR023465"
FT                   /db_xref="InterPro:IPR023468"
FT                   /db_xref="UniProtKB/TrEMBL:A0A384LE02"
FT                   /inference="similar to sequence:INSDC:AE004154"
FT                   /protein_id="CAL19153.1"
FT                   /translation="MELIRGIHNIRARHHGCVLTIGNFDGVHRGHQALLEQLKREGQRL
FT                   GLPVMVMIFEPQPLELFAADKAPARLTRLRDKAKYLAQAGVDYLLCVKFDPRFAANTAQ
FT                   AFVAQLLVEKLGVKFLTVGDDFRFGAGRQGDFQLLQQAGAEFGFDVISTDSFCDGGLRI
FT                   SSTAIRQALHDDDLVLAETLLGHPYSISGRVVHGDELGRTIGFPTANLPLKRLVAPVKG
FT                   VYAVDVYGLGSTPLYGVANIGTRPTVAGVRQQLEVHLLDVTMDLYGCHIDVVLRAKLRN
FT                   EQRFASLEALKQQIANDVVTARTFFGLKTPV"
FT   misc_feature    504311..504685
FT                   /note="Pfam match to entry PF01687 FAD_Synth, Riboflavin
FT                   kinase / FAD synthetase, score 205.90, E-value 6.3e-58"
FT                   /inference="protein motif:PF01687"
FT   CDS_pept        504735..507551
FT                   /transl_table=11
FT                   /gene="b0026"
FT                   /gene_synonym="ileS"
FT                   /gene_synonym="ilvS"
FT                   /locus_tag="YPO0475"
FT                   /product="isoleucyl-tRNA synthetase"
FT                   /EC_number="6.1.1.5"
FT                   /note="Similar to Escherichia coli isoleucyl-tRNA
FT                   synthetase IleS SW:SYI_ECOLI (P00956) (937 aa) fasta
FT                   scores: E(): 0, 83.7% id in 937 aa, and to Vibrio cholerae
FT                   isoleucyl-tRNA synthetase Vc0682 TR:Q9KU47 (EMBL:AE004154)
FT                   (949 aa) fasta scores: E(): 0, 69.8% id in 951 aa"
FT                   /db_xref="GOA:Q8ZIM0"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002301"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR010663"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR023585"
FT                   /db_xref="InterPro:IPR033708"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZIM0"
FT                   /inference="similar to sequence:INSDC:AE004154"
FT                   /protein_id="CAL19154.1"
FT                   /translation="MSDYKNTLNLPETGFPMRGDLAKREPDMLKRWYEQDLYGIIRAAK
FT                   KGKKTFILHDGPPYANGNIHIGHSVNKILKDIIVKSKGMAGYDSPYIPGWDCHGLPIEL
FT                   KVEQLIGKPGEKVSAAEFRTACRKYAAEQVEGQKKDFIRLGVLGDWDHPYLTMDFKTEA
FT                   NIIRALSKIIDNGHLHKGAKPVHWCTDCGSSLAEAEVEYYDKTSQSIDVRFNAVDTATV
FT                   AAKFGVSAVNGPISLVIWTTTPWTLPANRAISLNAEYLYQLVQVEGECLILAADLVESV
FT                   MKRAGITQWAVLGSCTGSDLELLRFTHPFMGFDVPAILGDHVTLDAGTGAVHTAPGHGP
FT                   DDFVIGQKYGLEVANPVGPNGCYLAGTYPTLDGLFVFKANDVVVELLREKGALLHVEKL
FT                   LHSYPCCWRHKTPIIFRATPQWFISMDQKGLRKQSLQEIKGVQWIPDWGQARIETMVAN
FT                   RPDWCISRQRTWGVPMSLFVHKETEQLHPRSIELMEEVAKRVEQDGIQAWWDLDPAEIL
FT                   GADAADYVKVPDTLDVWFDSGSTHSSVVDVRPEFGGHSPDMYLEGSDQHRGWFMSSLMI
FT                   ATAMKGKAPYRQVLTHGFTVDGQGRKMSKSIGNTISPQDVMNKLGGDILRLWVASTDYT
FT                   GEIAVSDEILKRSADSYRRIRNTARFLLANLNGFDPAQHQVKPEEMVVVDRWAVGRAQA
FT                   AQAEIMEAYENYDFHLVVQRLMQFCSVEMGSFYLDIIKDRQYTAKGDGIARRSCQTALF
FT                   HIAEALVRWMAPIMSFTADEIWNHLPGERQQYVFTEEWYDGLFGLAGNESMNDTFWAEL
FT                   LKVRGEVNKVLEQARSDKRIGGSLEAAVTLYAEPELAARLNSLQDELRFVLLTSAAKVA
FT                   AYADAGNDAQQSELIAGLKITFNKADGEKCPRCWHYTQDVGLVAEHAELCGRCVTNVAG
FT                   DGEERKFA"
FT   misc_feature    504813..506834
FT                   /note="Pfam match to entry PF00133 tRNA-synt_1, tRNA
FT                   synthetases class I (I, L, M and V), score 1166.70, E-value
FT                   0"
FT                   /inference="protein motif:PF00133"
FT   misc_feature    504906..504941
FT                   /note="PS00178 Aminoacyl-transfer RNA synthetases class-I
FT                   signature."
FT                   /inference="protein motif:ProSite:PS00178"
FT   misc_feature    505590..505622
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:ProSite:PS00013"
FT   CDS_pept        507551..508060
FT                   /transl_table=11
FT                   /gene="b0027"
FT                   /gene_synonym="lspA"
FT                   /locus_tag="YPO0476"
FT                   /product="lipoprotein signal peptidase"
FT                   /EC_number="3.4.23.36"
FT                   /note="Similar to Escherichia coli lipoprotein signal
FT                   peptidase LspA SW:LSPA_ECOLI (P00804) (164 aa) fasta
FT                   scores: E(): 0, 70.1% id in 157 aa, and to Enterobacter
FT                   aerogenes lipoprotein signal peptidase LspA SW:LSPA_ENTAE
FT                   (P13514) (165 aa) fasta scores: E(): 0, 67.3% id in 162 aa"
FT                   /db_xref="GOA:Q8ZIL9"
FT                   /db_xref="InterPro:IPR001872"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZIL9"
FT                   /inference="protein motif:TMHMM:2.0"
FT                   /protein_id="CAL19155.1"
FT                   /translation="MNKPICSTGLRWLWLAVVVVILDISSKQWVMAHFALYESVPLIPF
FT                   FNLTYAQNFGAAFSFLADKSGWQRWFFAGIAIGISVVLMVMMYRSTAKQRLINCAYALI
FT                   IGGALGNLYDRLVHGAVNDFLDFYINNWHFPTFNLADVAICIGAALVIFEGFLSPVEKN
FT                   AVNNDE"
FT   misc_feature    507578..508042
FT                   /note="Pfam match to entry PF01252 Peptidase_A8, Signal
FT                   peptidase (SPase) II, score 256.60, E-value 3.4e-73"
FT                   /inference="protein motif:PF01252"
FT   misc_feature    507587..507655
FT                   /gene="b0027"
FT                   /gene_synonym="lspA"
FT                   /locus_tag="YPO0476"
FT                   /note="one of 4 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    507746..507814
FT                   /gene="b0027"
FT                   /gene_synonym="lspA"
FT                   /locus_tag="YPO0476"
FT                   /note="one of 4 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    507833..507901
FT                   /gene="b0027"
FT                   /gene_synonym="lspA"
FT                   /locus_tag="YPO0476"
FT                   /note="one of 4 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    507866..507898
FT                   /note="PS00855 Signal peptidases II signature."
FT                   /inference="protein motif:ProSite:PS00855"
FT   misc_feature    507959..508027
FT                   /gene="b0027"
FT                   /gene_synonym="lspA"
FT                   /locus_tag="YPO0476"
FT                   /note="one of 4 probable transmembrane helices predicted"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS_pept        508128..508586
FT                   /transl_table=11
FT                   /gene="b0028"
FT                   /gene_synonym="fkpB"
FT                   /gene_synonym="slpA"
FT                   /locus_tag="YPO0476a"
FT                   /product="FKBP-type peptidyl-prolyl cis-trans isomerase"
FT                   /EC_number="5.2.1.8"
FT                   /note="Similar to Escherichia coli FKBP-type 16 kDa
FT                   peptidyl-prolyl cis-trans isomerase FkpB SW:FKBX_ECOLI
FT                   (P22563) (148 aa) fasta scores: E(): 0, 68.8% id in 144
FT                   aa,and to Klebsiella pneumoniae FKBP-type peptidyl-propyl
FT                   cis-trans isomerase SlpA TR:Q9RF46 (EMBL:AF201388) (149 aa)
FT                   fasta scores: E(): 0, 70.1% id in 144 aa"
FT                   /db_xref="GOA:Q0WJI9"
FT                   /db_xref="InterPro:IPR001179"
FT                   /db_xref="UniProtKB/TrEMBL:Q0WJI9"
FT                   /inference="similar to sequence:INSDC:AF201388"
FT                   /protein_id="CAL19156.1"
FT                   /translation="MQNNGAVLVHFTLKLEDGSTAESTRTHGKPALFRLGDNSLSDALE
FT                   QQLLGLTVGDKHAFTLRPEDAFGVENPDLIQYFTPRDFAETGVPDAGTIMLFSSRDGSE
FT                   MPGVVREVAEESITVDFNHPLAGHSVSFELEILEIDPQQEVVYADIAG"
FT   misc_feature    508152..508199
FT                   /note="PS00453 FKBP-type peptidyl-prolyl cis-trans
FT                   isomerase signature 1."
FT                   /inference="protein motif:ProSite:PS00453"
FT   misc_feature    508245..508331
FT                   /note="PS00454 FKBP-type peptidyl-prolyl cis-trans
FT                   isomerase signature 2."
FT                   /inference="protein motif:ProSite:PS00454"
FT   CDS_pept        508567..509520
FT                   /transl_table=11
FT                   /gene="b0029"
FT                   /gene_synonym="lytB"
FT                   /locus_tag="YPO0477"
FT                   /product="LytB protein"
FT                   /note="Similar to Escherichia coli protein involved in
FT                   penicillin tolerance and control of the stringent
FT                   response,LytB SW:LYTB_ECOLI (P22565) (316 aa) fasta scores:
FT                   E(): 0,82.6% id in 317 aa, and to Vibrio cholerae LytB
FT                   protein Vc0685 TR:Q9KU44 (EMBL:AE004154) (320 aa) fasta
FT                   scores: E(): 0, 68.7% id in 319 aa. Note the large overlap
FT                   with the upsteam CDS."
FT                   /db_xref="GOA:P58680"
FT                   /db_xref="InterPro:IPR003451"
FT                   /db_xref="UniProtKB/Swiss-Prot:P58680"
FT                   /inference="similar to sequence:INSDC:AE004154"
FT                   /protein_id="CAL19157.1"
FT                   /translation="MQILLANPRGFCAGVDRAISIVERAIEMYGAPIYVRHEVVHNRYV
FT                   VESLCERGAIFIEEISEVPDGSILIFSAHGVSQAVRAEARSRNLTMLFDATCPLVTKVH
FT                   MEVARASRKGKEAILIGHAGHPEVEGTMGQYSNPNGGMYLVESPDDVWQLNVKDENNLC
FT                   FMTQTTLSVDDTSAVIDALNTRFPKIVGPRKDDICYATTNRQEAVRNLANDADIVLVVG
FT                   SKNSSNSNRLAELVQRMGKPAYLIDSAADIQEFWLQGAKCIGVTAGASAPDILVQQVIA
FT                   RLKDLGAGESIELSGREENIVFEVPKELRVEVKQID"
FT   misc_feature    508573..509424
FT                   /note="Pfam match to entry PF02401 LYTB, , score
FT                   593.50,E-value 1.3e-174"
FT                   /inference="protein motif:PF02401"
FT   CDS_pept        509549..509713
FT                   /transl_table=11
FT                   /locus_tag="YPO0478"
FT                   /product="hypothetical protein"
FT                   /note="No significant database hits"
FT                   /db_xref="UniProtKB/TrEMBL:Q74Q19"
FT                   /protein_id="CAL19158.1"
FT                   /translation="MFTQYVFTDESSPLRLLEVIDNAIFSLVNEGLTAPRGTSVAYATT
FT                   TPTARFPFN"
FT   repeat_region   509757..510468
FT                   /note="Contains a 'G' at nucleotide position 315"
FT                   /note="IS200-like insertion sequence:IS1541"
FT   CDS_pept        509902..510360
FT                   /transl_table=11
FT                   /gene="tnp"
FT                   /locus_tag="YPO0479"
FT                   /product="transposase for the IS1541 insertion element"
FT                   /note="Similar to Salmonella typhimurium, and Salmonella
FT                   typhi transposase for insertion sequence IS200 TnpA
FT                   SW:T200_SALTY (Q57334) (152 aa) fasta scores: E(): 0, 94.