(data stored in ACNUC7421 zone)

EMBL: AL591973

ID   AL591973; SV 1; linear; genomic DNA; STD; PRO; 200050 BP.
XX
AC   AL591973;
XX
DT   21-OCT-2001 (Rel. 69, Created)
DT   27-FEB-2015 (Rel. 123, Last updated, Version 7)
XX
DE   Listeria monocytogenes EGD-e, complete genome, segment 1/12
XX
KW   .
XX
OS   Listeria monocytogenes EGD-e
OC   Bacteria; Firmicutes; Bacilli; Bacillales; Listeriaceae; Listeria.
XX
RN   [2]
RP   1-200050
RA   Glaser P., Frangeul L., Rusniok C.;
RT   ;
RL   Submitted (06-JUN-2001) to the INSDC.
RL   Glaser P., Institut Pasteur, Genomique des Microorganismes Pathogenes, 25
RL   rue du Docteur Roux, 75724 Paris Cedex 15, FRANCE.
XX
RN   [3]
RX   DOI; 10.1126/science.1063447.
RX   PUBMED; 11679669.
RA   Glaser P., Frangeul L., Buchrieser C., Rusniok C., Amend A., Baquero F.,
RA   Berche P., Bloecker H., Brandt P., Chakraborty T., Charbit A.,
RA   Chetouani F., Couve E., de Daruvar A., Dehoux P., Domann E.,
RA   Dominguez-Bernal G., Duchaud E., Durant L., Dussurget O., Entian K.D.,
RA   Fsihi H., Portillo F.G., Garrido P., Gautier L., Goebel W., Gomez-Lopez N.,
RA   Hain T., Hauf J., Jackson D., Jones L.M., Kaerst U., Kreft J., Kuhn M.,
RA   Kunst F., Kurapkat G., Madueno E., Maitournam A., Vicente J.M., Ng E.,
RA   Nedjari H., Nordsiek G., Novella S., de Pablos B., Perez-Diaz J.C.,
RA   Purcell R., Remmel B., Rose M., Schlueter T., Simoes N., Tierrez A.,
RA   Vazquez-Boland J.A., Voss H., Wehland J., Cossart P.;
RT   "Comparative genomics of Listeria species";
RL   Science, e1252229 294(5543):849-852(2001).
XX
DR   MD5; 4690e5e38a0b442dc6b8450e565c61ac.
DR   ENA-CON; AL591824.
DR   BioSample; SAMEA3138329.
DR   EuropePMC; PMC1231089; 16113338.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00162; SAM.
DR   RFAM; RF01457; rli22.
DR   RFAM; RF01458; rli23.
XX
CC   E-mail: pglaser@pasteur.fr
CC   Phone: +33 1 45 68 89 96, Fax: +33 (0)1 45 68 87 86
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..200050
FT                   /organism="Listeria monocytogenes EGD-e"
FT                   /strain="EGD-e"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:169963"
FT   regulatory      305..310
FT                   /gene="dnaA"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        318..1673
FT                   /transl_table=11
FT                   /gene="dnaA"
FT                   /product="Chromosomal replication initiation protein DnaA"
FT                   /db_xref="GOA:Q8YAW2"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8YAW2"
FT                   /protein_id="CAC98216.1"
FT                   /translation="MQSIEDIWQETLQIVKKNMSKPSYDTWMKSTTAHSLEGNTFIISA
FT                   PNNFVRDWLEKSYTQFIANILQEITGRLFDVRFIDGEQEENFEYTVIKPNPALDEDGIE
FT                   IGKHMLNPRYVFDTFVIGSGNRFAHAASLAVAEAPAKAYNPLFIYGGVGLGKTHLMHAV
FT                   GHYVQQHKDNAKVMYLSSEKFTNEFISSIRDNKTEEFRTKYRNVDVLLIDDIQFLAGKE
FT                   GTQEEFFHTFNTLYDEQKQIIISSDRPPKEIPTLEDRLRSRFEWGLITDITPPDLETRI
FT                   AILRKKAKADGLDIPNEVMLYIANQIDSNIRELEGALIRVVAYSSLVNKDITAGLAAEA
FT                   LKDIIPSSKSQVITISGIQEAVGEYFHVRLEDFKAKKRTKSIAFPRQIAMYLSRELTDA
FT                   SLPKIGDEFGGRDHTTVIHAHEKISQLLKTDQVLKNDLAEIEKNLRKAQNMF"
FT   regulatory      1856..1860
FT                   /gene="dnaN"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        1867..3012
FT                   /transl_table=11
FT                   /gene="dnaN"
FT                   /product="DNA polymerase III, beta chain"
FT                   /db_xref="GOA:Q8YAW1"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:Q8YAW1"
FT                   /protein_id="CAC98217.1"
FT                   /translation="MKFVIERDRLVQAVNEVTRAISARTTIPILTGIKIVVNDEGVTLT
FT                   GSDSDISIEAFIPLIENDEVIVEVESFGGIVLQSKYFGDIVRRLPEENVEIEVTSNYQT
FT                   NISSGQASFTLNGLDPMEYPKLPEVTDGKTIKIPINVLKNIVRQTVFAVSAIEVRPVLT
FT                   GVNWIIKENKLSAVATDSHRLALREIPLETDIDEEYNIVIPGKSLSELNKLLDDASESI
FT                   EMTLANNQILFKLKDLLFYSRLLEGSYPDTSRLIPTDTKSELVINSKAFLQAIDRASLL
FT                   ARENRNNVIKLMTLENGQVEVSSNSPEVGNVSENVFSQSFTGEEIKISFNGKYMMDALR
FT                   AFEGDDIQISFSGTMRPFVLRPKDAANPNEILQLITPVRTY"
FT   regulatory      3030..3062
FT                   /gene="dnaN"
FT                   /regulatory_class="terminator"
FT   regulatory      3104..3109
FT                   /gene="lmo0003"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        3121..4464
FT                   /transl_table=11
FT                   /gene="lmo0003"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="GOA:Q8YAW0"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/TrEMBL:Q8YAW0"
FT                   /protein_id="CAC98218.1"
FT                   /translation="MMKDMTTGNPTKLIFLFAMPMLIGNLFQQFYTMIDAVIVGKFVSV
FT                   DALAAVGATNSVNFFMISLIIGLMSGISVVVAQYFGFKDYDRLKDVIATATYAVVFSAI
FT                   ILTVAGVLLAKPLLILLRTPANILDDSTIFLTTLFIGILPMSLYNGMAAILRALGNSIT
FT                   PLIFLILSSLMNIALDFLFVVYMDMGVRGAAIATVLSQTAAAIAVIYYAYRHVPFMRIE
FT                   RAKFKLSTPLLKEMVRIGLPSGLQGSFISIGNMALQSLINGFGSSVVAAYTAASRIDSL
FT                   TYQPGIAFGAASSMFAGQNIGAGKIDRVREGFWSGIKVVTAISIGITILVQLFARQFLL
FT                   LFVDSSETEVINIGVSYLLIVSLFYVVVGILFVVRETLRGTGDAMVPLAMGIFELVSRL
FT                   VIGFVLSLYIGYVGLWWATPVAWITATILGVWRYKSGAWQKKAVIRRK"
FT   regulatory      4631..4637
FT                   /gene="lmo0004"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        4644..4865
FT                   /transl_table=11
FT                   /gene="lmo0004"
FT                   /note="similar to B. subtilis YaaA protein"
FT                   /db_xref="GOA:Q8YAV9"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR014330"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:Q8YAV9"
FT                   /protein_id="CAC98219.1"
FT                   /translation="MAETVKINSEFVTLGQLLQMIDVVSTGGMAKAYLSENTIYINGEQ
FT                   DNRRGKKLRNGDVILVPGVGKVKIEQGK"
FT   regulatory      4856..4861
FT                   /gene="RecF"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        4869..5981
FT                   /transl_table=11
FT                   /gene="RecF"
FT                   /product="RecF protein"
FT                   /db_xref="GOA:Q8YAV8"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR018078"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042174"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8YAV8"
FT                   /protein_id="CAC98220.1"
FT                   /translation="MHLESIVLRNFRNYENLELEFSPSVNVFLGENAQGKTNLLEAVLM
FT                   LALAKSHRTTNDKDFIMWEKEEAKMEGRIAKHGQSVPLELAITQKGKRAKVNHLEQKKL
FT                   SQYVGNLNVVIFAPEDLSLVKGAPGIRRRFLNMEIGQMQPIYLHNLSEYQRILQQRNQY
FT                   LKMLQMKRKVDPILLDILTEQFADVAINLTKRRADFIQKLEAYAAPIHHQISRGLETLK
FT                   IEYKASITLNGDDPEVWKADLLQKMESIKQREIDRGVTLIGPHRDDSLFYINGQNVQDF
FT                   GSQGQQRTTALSIKLAEIDLIHEETGEYPVLLLDDVLSELDDYRQSHLLGAIEGKVQTF
FT                   VTTTSTSGIDHETLKQATTFYVEKGTVKKS"
FT   regulatory      6017..6021
FT                   /gene="gyrB"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        6030..7970
FT                   /transl_table=11
FT                   /gene="gyrB"
FT                   /product="DNA gyrase subunit B"
FT                   /db_xref="GOA:Q8YAV7"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR034160"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q8YAV7"
FT                   /protein_id="CAC98221.1"
FT                   /translation="MSEENITNVQENASDYNEDQIQVLEGLEAVRKRPGMYIGSTSQRG
FT                   LHHLVWEIVDNAIDEALAGFCTEIEITIEADNSITVRDNGRGIPTGINEKIGRPTVEVI
FT                   FTVLHAGGKFGGGGYKVSGGLHGVGASVVNALSTSLEVYVHREGQKYYQRFERGDVVMD
FT                   MEEQGETDYRGTIVHFTPDPQIFTETTEFDFDTLRTRTRELAFLNRGLTISIEDKREEH
FT                   KVRKDFHYEGGIRSYVEHLNKAKDVIHEPPIYLEGERDDIMVEISMQYNTGFSSNIISF
FT                   ANNIHTYEGGTHESGFKTALTRVINDYARRNKLFKDSDDNLSGEDVREGLTAIISIKHP
FT                   DPQFEGQTKTKLGNSEARSITDKLFSEALNKFMMENPDVAKKIVEKGVVASRARLAAKR
FT                   AREVARKSSGLEISSLPGKLADCSSRNPEISELYIVEGDSAGGSAKQGRDRLFQAILPI
FT                   RGKILNVEKARLDRILANEEIRTIFTAMGTGFGGDFDVSKSRYHKLIIMTDADVDGAHI
FT                   RTLLLTLFYRYMRPLLDAGYIYIAQPPLYQIKHGKQIEYVYSDGQLEDYLASLDGDTKY
FT                   SIQRYKGLGEMNPEQLWDTTMNPEHRTLLQVNIKDAIDADETFEMLMGDRVEPRRKFIE
FT                   DNAQYVKNLDV"
FT   regulatory      8048..8053
FT                   /gene="gyrA"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        8065..10593
FT                   /transl_table=11
FT                   /gene="gyrA"
FT                   /product="DNA gyrase subunit A"
FT                   /db_xref="GOA:Q8YAV6"
FT                   /db_xref="InterPro:IPR002205"
FT                   /db_xref="InterPro:IPR005743"
FT                   /db_xref="InterPro:IPR006691"
FT                   /db_xref="InterPro:IPR013757"
FT                   /db_xref="InterPro:IPR013758"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR035516"
FT                   /db_xref="UniProtKB/TrEMBL:Q8YAV6"
FT                   /protein_id="CAC98222.1"
FT                   /translation="MAETPNQRITEINLNKEMRTSFLDYAMSVIVARALPDVRDGLKPV
FT                   HRRILYAMNDLGMTSDKAYKKSARIVGEVIGKYHPHGDTAVYFTMVRMAQDFSYRNMLV
FT                   DGHGNFGSVDGDMAAAMRYTEARMSKISMELLRDINKDTIDYADNYDGSEREPVILPAR
FT                   FPNLLVNGSSGIAVGMATNIPTHHLGEVIDGVLALSHDPEITIRDLMEYIPGPDFPTAG
FT                   MIMGRSGIRRAYESGRGSITVRGRVDIEEKKNGKETIVITEIPYQVNKARLVERIAELA
FT                   REKKIDGITSLNDESDRSGMRIVIEVRRDISASVIVNNLFKMTALQTTFGINMLALVDN
FT                   HPKVLNLKEILYYYLEHQKVVIRRRTEFELRKAEARAHILEGLRIALDNIDAIIKLIRG
FT                   SKTSDVAKEGLMTQFNLSDKQAQAILDMRLQRLTGLEREKIEEEYQNLVALINDLKAIL
FT                   ADDERILEIIREELEEIKVKYADKRRTEILAGDLVSLEDEDLIPEEEVAITLTKRGYIK
FT                   RLPLSTYRSQRRGGRGIQGMSTHEDDFVEHLVATSTHDTLLFFTNTGKVYRSKGYEVPE
FT                   YGRTAKGIPIINLLGIESQEQVNAVINLSEFTDDSYLFFTTKHGVVKRTTLSQFAKIRQ
FT                   SGLRAVELRENDELISVQMTDGSKNMIIATKHGQSIYFPEENIRVMGRTAAGVRGIRLR
FT                   EDDEVIGMEVLEDDEKVLVVTEKGYGKQTPASQYPLRNRGGMGVKTVTITEKNGNLVAM
FT                   KTVTGEEDLMLMTVSGVLIRFEIDTVSQTGRSAMGVKLIRLDEDEKVATVAKVPKEEDE
FT                   VELEEEIDETLITQVPDESFEDAPGSDIEE"
FT   regulatory      10600..10653
FT                   /gene="gyrA"
FT                   /regulatory_class="terminator"
FT   regulatory      10712..10717
FT                   /gene="lmo0008"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        10728..12242
FT                   /transl_table=11
FT                   /gene="lmo0008"
FT                   /note="similar to cardiolipin synthase"
FT                   /db_xref="GOA:Q8YAV5"
FT                   /db_xref="InterPro:IPR001736"
FT                   /db_xref="InterPro:IPR022924"
FT                   /db_xref="InterPro:IPR025202"
FT                   /db_xref="InterPro:IPR027379"
FT                   /db_xref="InterPro:IPR030874"
FT                   /db_xref="UniProtKB/TrEMBL:Q8YAV5"
FT                   /protein_id="CAC98223.1"
FT                   /translation="MRKLIQFLFIAVVLFLVEYVLINQAAILFLVTSGIIQLCGVIIAI
FT                   RLLLFDQRNTSSKVAWVAVIFILPVLGTISYLVFGRNPATRKFSTAQVKEKTKLINAIH
FT                   AIPNNTNEKLPRLSKRIAHLTSIEPIKGNKIEILTNGEETFPVLLDALRKAENHIHIQY
FT                   YIFKTDAISTEIRDILVEKAKSGVEVRFMFDGLGSSKLGKAFLAPLKEAGVSIHAFDPI
FT                   ASPWIVRTANLRNHRKIVVIDGQIGFTGGLNIGEEYRSNTPDFRVWRDTHIKITGQAVI
FT                   ELQESFLNDWVYMENQAGAADGFISESGSKQYFSPVDMGDEWAQVIYGGPYDKEKWVRD
FT                   SMLDLIDSAKESVWIVSPYFVPDEESLAVIRRVAMSGVDVRVIIPGKGDRGISFHGSNA
FT                   YVKTMIEAGAKMYAYADDSFVHAKAMLVDGTRAAIGTANFDVRSFRLNHELMVFLYDES
FT                   EAMHHLKRDFKKDFEDSRLFTMKDMENKPLLTRIKEVLSSLLSPIL"
FT   regulatory      12246..12251
FT                   /gene="lmo0009"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        12258..12776
FT                   /transl_table=11
FT                   /gene="lmo0009"
FT                   /note="similar to spermidine N1-acetyltransferase"
FT                   /db_xref="GOA:Q8YAV4"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q8YAV4"
FT                   /protein_id="CAC98224.1"
FT                   /translation="MSGDLKLRPLEREDLKFVHRLNNDAKIMSYWFEEPYEAFVELQEL
FT                   YDKHIHDQSERRFILELDGQMVGLVELMEIDYIHRRAEFQIIIDPKFQGHGYAVSATKL
FT                   AMKYAFHVLNMHKLYLVVDKVNEKAIHVYEKVGFIREGELIDEFFVDGTYHDAIRMCIF
FT                   QHQYREMDI"
FT   regulatory      12904..12909
FT                   /gene="lmo0010"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        12918..13886
FT                   /transl_table=11
FT                   /gene="lmo0010"
FT                   /note="similar to mevalonate kinase"
FT                   /db_xref="GOA:Q8YAV3"
FT                   /db_xref="InterPro:IPR006203"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR006205"
FT                   /db_xref="InterPro:IPR013750"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036554"
FT                   /db_xref="UniProtKB/TrEMBL:Q8YAV3"
FT                   /protein_id="CAC98225.1"
FT                   /translation="MATGIGTAKMILCGEHAVVYGEPAISVPFTQAVVTTNVETSIKTK
FT                   FSSAFFSGDLDDMPDFLAGIKALVVDVLNEIGNGECVSIHVVSGVPIGRGLGSSAAVAT
FT                   SIARGLYKYFNQELDSKKLLAIVNAAEKIAHGNASGVDAITVVSEKPVWYERDRKLEIM
FT                   HFPKKITFVVADTGVPSETRDAVKDVQVLYKENQVEIGKIIHQLGDISREIKTHLEGDA
FT                   DTVKIGAAMNKAQSYLETLTVSDSSLEKLIKVARSNGADGAKLTGGGRGGCIIAVAKNQ
FT                   EIAEQITKALHNAGAAQEWIFTIGEGSYESDSHRTHECGAN"
FT   regulatory      13832..13837
FT                   /gene="lmo0011"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        13843..14814
FT                   /transl_table=11
FT                   /gene="lmo0011"
FT                   /note="similar to mevalonate diphosphate decarboxylase"
FT                   /db_xref="GOA:Q8YAV2"
FT                   /db_xref="InterPro:IPR005935"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR029765"
FT                   /db_xref="InterPro:IPR036554"
FT                   /db_xref="InterPro:IPR041431"
FT                   /db_xref="UniProtKB/TrEMBL:Q8YAV2"
FT                   /protein_id="CAC98226.1"
FT                   /translation="MKATAIAHTNVALIKYWGKRDEHLILPANSSLSFTVDKFYTKTTV
FT                   EWDEKLTQDTFILNNEQKTDAKVARFIDKMREEFGISAKAKITSENHVPTAAGLASSAS
FT                   AFAALALAGSNAAGRKDTKEYISRLARFGSGSASRSVFGDFVIWEKGELADGSDSFAVP
FT                   FTNKLCDKMSLVVAVVSDKEKKVSSRDGMRLTVETSPFFENWVSAAEIDLEEMKQAILD
FT                   EDFIKVGEITERNGMKMHATTLGAEPPFTYFQPQSLEIMDAVRELRENGIPAYFTMDAG
FT                   PNVKVICERANENIVAEKLSGLAKNVLICHAGKEASVVSDEK"
FT   regulatory      14783..14788
FT                   /gene="lmo0012"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        14795..15874
FT                   /transl_table=11
FT                   /gene="lmo0012"
FT                   /note="similar to mevalonate kinases"
FT                   /db_xref="GOA:Q8YAV1"
FT                   /db_xref="InterPro:IPR005917"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR013750"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR035102"
FT                   /db_xref="InterPro:IPR036554"
FT                   /db_xref="UniProtKB/TrEMBL:Q8YAV1"
FT                   /protein_id="CAC98227.1"
FT                   /translation="MYQMKNKLQVKIPGKLYVAGEYAVVESGHTAILTAVNRYITLTLE
FT                   DSERNELWIPHYENPVSWPVGGELKPDGEHWTFTAEAINIATTFLKSEGIELTPVKMII
FT                   ETELIDQSGAKYGLGSSAAATVAVINALMTKFYPEISMLKKFKLAALSHLVVQGNGSCG
FT                   DIASCMYGGWIAYTTFDQEWVKHRLAYKSLEWFMKEPWPMLQIETLEEPVPTFSVGWTG
FT                   TPVSTGKLVSQIHAFKQEDSKNYQHFLTRNNEIMKQIIQAFHTKDEELLYSAIKENRRI
FT                   LQELGTKAGVNIETSLLKELADSAENMGGAGKSSGSGGGDCGIAFSKTKELAEKLVNEW
FT                   EKLGIKHLPFHTGRVQITE"
FT   regulatory      15882..15921
FT                   /gene="lmo0012"
FT                   /regulatory_class="terminator"
FT   regulatory      16205..16210
FT                   /gene="qoxA"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        16219..17325
FT                   /transl_table=11
FT                   /gene="qoxA"
FT                   /product="AA3-600 quinol oxidase subunit II"
FT                   /db_xref="GOA:Q8YAV0"
FT                   /db_xref="InterPro:IPR002429"
FT                   /db_xref="InterPro:IPR006332"
FT                   /db_xref="InterPro:IPR006333"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR011759"
FT                   /db_xref="InterPro:IPR034227"
FT                   /db_xref="InterPro:IPR036257"
FT                   /db_xref="UniProtKB/TrEMBL:Q8YAV0"
FT                   /protein_id="CAC98228.1"
FT                   /translation="MSKVLKSLLLTALLGVTGLISGCGDLTVLNPKGPVAKGQSDLIIY
FT                   SIIFMLVIVLTIFVLFTIMLVKYRERKDISNYEPDMHGSKKLEIFWTLIPVAIVIALAI
FT                   PTVKTIYAGEEAPKVTSHKDPIIIYATSADWKWIFSYPDESIETVNYVNIPTDRPVLFK
FT                   LTSADTMTSFWVPQLGGQKYAMSGMTMNLYLQADEVGTYKGRNANFNGEGFADQRFDVV
FT                   AQSEKDFKKWAKETKASSPVITQDIYDRLLIPGSSKKKTYSGTHLAFVDVAADPEYVFY
FT                   AYKRFGYEMTNPHNPNTKSTISDEPMLPVRPVTVTNPQFERHDMKPQIIKNGEGYHEDK
FT                   HREDEMKKMEEDIQTNEFNKKESDDAGK"
FT   regulatory      17328..17333
FT                   /gene="qoxB"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        17344..19323
FT                   /transl_table=11
FT                   /gene="qoxB"
FT                   /product="AA3-600 quinol oxidase subunit I"
FT                   /db_xref="GOA:Q8YAU9"
FT                   /db_xref="InterPro:IPR000883"
FT                   /db_xref="InterPro:IPR014233"
FT                   /db_xref="InterPro:IPR023615"
FT                   /db_xref="InterPro:IPR023616"
FT                   /db_xref="InterPro:IPR036927"
FT                   /db_xref="UniProtKB/TrEMBL:Q8YAU9"
FT                   /protein_id="CAC98229.1"
FT                   /translation="MKWNEFIVTGDPMILGAQISIVLVSIGVVALLTYTKKWKWLMKEW
FT                   ISSVDHKKIGIMYLLAAVLMFFRGGVDALMMRTQLALPDMKFLDAQHYNEVFSTHGTIM
FT                   ILFMAMPFIIGLMNIAVPLQIGARDVAFPFLNNLSFWTFFMGAMLFNLSFVIGGSPDAG
FT                   WTNYAPLATDFSAGYGINFYLLGVQIAGIGTLMTGINFFVTILRMRTKGMTLMKMPMFT
FT                   WSSLITSLIIIFAFPVLTVALALMSFDRLFGTAFFTLTNGGLPMMWANLFWVWGHPEVY
FT                   IVILPAFGIFSEIISTFSRKKLFGYPAMVAAMAVISLLSFLVWVHHFFTMGSGALVNSF
FT                   FSITTMMIAIPTGIKIFNWLFTMYKGRITFTTPMLWSLAFIPNFVVGGVTGVMLAMAAA
FT                   DYQYHNTYFLVSHFHYVLIAGTVFSCFAGLTYWYPKMVGYRLNEKIGKWFFWIFVVGFN
FT                   VCFFPQYFLGLDGMPRRIYTYVQGDGWTTLNFISTVGGFLMGVAFLVLCYNIYYSYKNS
FT                   KREVTGDPWDARTLEWATSSAVPPKYNFAVLPEWNDLDDFWNRKQKGDPYVNDKNYKPI
FT                   HMPSNTMVGFVMSVFFFIAGFGLVFYWYWMGIIGLVGILGCMIYRSFQNNDGYHVEVEE
FT                   IKATEEHNARELATGVKEGNPWNL"
FT   regulatory      19298..19303
FT                   /gene="qoxC"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        19311..19922
FT                   /transl_table=11
FT                   /gene="qoxC"
FT                   /product="AA3-600 quinol oxidase subunit III"
FT                   /db_xref="GOA:Q8YAU8"
FT                   /db_xref="InterPro:IPR000298"
FT                   /db_xref="InterPro:IPR013833"
FT                   /db_xref="InterPro:IPR014246"
FT                   /db_xref="InterPro:IPR024791"
FT                   /db_xref="InterPro:IPR033946"
FT                   /db_xref="InterPro:IPR035973"
FT                   /db_xref="UniProtKB/TrEMBL:Q8YAU8"
FT                   /protein_id="CAC98230.1"
FT                   /translation="MESVETNKNLPIEYRSEQGRLNILGFWIFLGAEIALFATLFATYF
FT                   VMRKAGSNAGHPPAEMFELWLVLIMTFLLLTSSFTCGLAIGEMRKGNVKMLTIYSIITL
FT                   ILGAGFVGFELYEFAHYVTEGVTMQVGSYWSAFFVLLGTHGLHVTVGIFWISFILIQIK
FT                   MHGLTPKTASKVFISSLYWHFLDVVWIFIFTGVYLLGMVN"
FT   regulatory      19908..19913
FT                   /gene="qoxD"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        19924..20256
FT                   /transl_table=11
FT                   /gene="qoxD"
FT                   /note="highly similar to quinol oxidase aa3-600 chain IV"
FT                   /db_xref="GOA:Q8YAU7"
FT                   /db_xref="InterPro:IPR005171"
FT                   /db_xref="InterPro:IPR014250"
FT                   /db_xref="UniProtKB/TrEMBL:Q8YAU7"
FT                   /protein_id="CAC98231.1"
FT                   /translation="MTQNNKSNAAHAEGGIPWKHIVGFALSVVLTLLAVWVALYSTLTT
FT                   NVKVVIIFIFAFIQAALQLLMFMHMTEGRDGKIQIGNILFAAFIAIVVVIGSYWVMEIG
FT                   HMNHLL"
FT   regulatory      20264..20313
FT                   /gene="qoxD"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(20308..21426)
FT                   /transl_table=11
FT                   /gene="lmo0017"
FT                   /note="similar to Bacillus anthracis CapA protein
FT                   (polyglutamate capsule biosynthesis)"
FT                   /db_xref="GOA:Q8YAU6"
FT                   /db_xref="InterPro:IPR019079"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:Q8YAU6"
FT                   /protein_id="CAC98232.1"
FT                   /translation="MKSRKKGIILVLSVILIFSIGLLVNNLMTNNKDTAKPKKKTVAAV
FT                   KKKKETPPKPKEPFNIDFTGDIMFDWDLRPVLAEKGMDYPFNNVREELKSSDYTFVDLE
FT                   TAITTRTKKVPYQEFWIKSDPSSLTALKNAGVDMVNISNNHILDYYEDGLLDTTAALRA
FT                   NNLAYVGAGKNEDEAYQLKVADIKGNKVGFMSFCHFFPNTGWIADEDTPGVTNGYDLNL
FT                   VEEKIKEERAKNKDIDYMVVYFHWGVEKTNTPVDYQTQYVKKLVDDNLVDAIVASHPHW
FT                   LQGFEVYKDVPIAYSLGNFLFPDYVSGHSAETGIYKLNFDQGKVTAHFDPGIISGNQIN
FT                   MLEGSSKTAQLNYLQSISPNATINSNGDISAK"
FT   regulatory      complement(21434..21439)
FT                   /gene="lmo0017"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      21637..21642
FT                   /gene="lmo0018"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        21652..23085
FT                   /transl_table=11
FT                   /gene="lmo0018"
FT                   /product="beta-glucosidase"
FT                   /db_xref="GOA:Q8YAU5"
FT                   /db_xref="InterPro:IPR001360"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR018120"
FT                   /db_xref="InterPro:IPR033132"
FT                   /db_xref="UniProtKB/TrEMBL:Q8YAU5"
FT                   /protein_id="CAC98233.1"
FT                   /translation="MTESKFPKDFLWGGAVAANQCEGAYLEDGKGLSLVDILPTVEDGR
FT                   WEALFNPSKALATDYGFYPSHESIDFYHRYKEDIKLMAEMGFKCFRMSISWPRIFPNGD
FT                   ETTPNEKGLAFYDAVFDECHKYGIEPVVTINHFDTPLEVFKKYGGWKNRKCIDFYLNFC
FT                   EAIFTRYKDKVKYWMTFNEINMILHLPYIGGGLDVTKEDNPEEVKYQAAHHQLVASALA
FT                   TKLGHEINPENQIGCMLAAGNTYPMTCNPKDVWKSIEADREGYFFIDVQARGYYPSYTK
FT                   RFFKEHNINIKMEDGDLDALRDHTVDYVAFSYYSSRLTSADPEKNKETEGNVFATLKNP
FT                   YLKASEWGWQIDPLGLRITMNTIYDRYQKPLFIVENGLGAVDTVEEDGSITDDYRIDYM
FT                   REHVREMGEAIEDGVELLGYTPWGCIDLVSAGSGEMKKRYGFIYVDRDNKGNGTLNRSK
FT                   KKSFDWYKKVIETNGKDID"
FT   regulatory      complement(23086..23124)
FT                   /gene="lmo0019"
FT                   /regulatory_class="terminator"
FT   regulatory      23097..23135
FT                   /gene="lmo0018"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(23132..23953)
FT                   /transl_table=11
FT                   /gene="lmo0019"
FT                   /db_xref="InterPro:IPR003646"
FT                   /db_xref="InterPro:IPR016997"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="InterPro:IPR039563"
FT                   /db_xref="InterPro:IPR039564"
FT                   /db_xref="UniProtKB/TrEMBL:Q8YAU4"
FT                   /protein_id="CAC98234.1"
FT                   /translation="MGTFFSKWGKWILVLGLVFSVFSVSTAGQAAAKETVINKQMVTTA
FT                   SLNVRSTNSTSGKVIGWLKNNTKFKAIAKTSNNWYRFSFKGKNGYVSGKYVKAATATPT
FT                   PKPPTPKIVQMNVPLIVQRPQLPTGCEITNIAMMLRYAGKNVDKVKLAKEMKRHKSNPN
FT                   YGFVGNPFSKSGWTIYPPALVNQVKKYTGSAKNMTGTNLAGIKNQLNKKRPVVAWVSKF
FT                   HGFSVHAITITGYDKNNFYYNDSWSGQKNARISQSYFNTCWSKQAKRAISY"
FT   regulatory      complement(23959..23964)
FT                   /gene="lmo0019"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      24180..24185
FT                   /gene="lmo0020"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        24194..24934
FT                   /transl_table=11
FT                   /gene="lmo0020"
FT                   /note="similar to transcriptional regulator (GntR family)"
FT                   /db_xref="GOA:Q8YAU3"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR011663"
FT                   /db_xref="InterPro:IPR028978"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q8YAU3"
FT                   /protein_id="CAC98235.1"
FT                   /translation="MAEPKYAIIINDIKRLISDGTFKPGEKIYSEDELKKKYNVSNTTV
FT                   VRALHELVRAGILARYQGKGTYVSKSIINEEVIFNEYTTVPNGRFNRKTKITNEHTKVV
FT                   AINEIQDARIAKKLQIPPENMIVHFQRIRLIDDLPWTVQNNYMAKSNLINVDLTNFEKF
FT                   NSLSEVIKELYGINILHEAMKERIEVEFPVKDKNNFKLLEIDTELPLYHIERITYVPEG
FT                   QPYEYIESYLRHNFYSIEIEKKKQ"
FT   regulatory      24936..24941
FT                   /gene="lmo0021"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        24950..25351
FT                   /transl_table=11
FT                   /gene="lmo0021"
FT                   /note="similar to PTS system, fructose-specific IIA
FT                   component"
FT                   /db_xref="GOA:Q8YAU2"
FT                   /db_xref="InterPro:IPR004701"
FT                   /db_xref="InterPro:IPR033887"
FT                   /db_xref="InterPro:IPR036662"
FT                   /db_xref="UniProtKB/TrEMBL:Q8YAU2"
FT                   /protein_id="CAC98236.1"
FT                   /translation="MDYIIAAHGRYAQEVKDSCQMITGQTTNISAITFTEEMGVTDVLD
FT                   AYMAVYSPVNETAIIVDIVGGTPCNAAQMFSTKHPEVKVVSGLSLGLIIPLSLGESLEE
FT                   AMLGAKDNIQFVEQKASHTIVSDDGEEED"
FT   regulatory      25338..25343
FT                   /gene="lmo0022"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        25351..25839
FT                   /transl_table=11
FT                   /gene="lmo0022"
FT                   /note="similar to PTS system, fructose-specific IIB
FT                   component"
FT                   /db_xref="GOA:Q8YAU1"
FT                   /db_xref="InterPro:IPR004720"
FT                   /db_xref="InterPro:IPR036667"
FT                   /db_xref="UniProtKB/TrEMBL:Q8YAU1"
FT                   /protein_id="CAC98237.1"
FT                   /translation="MGSNGIKHVRVDERLIHGQVATMWTNTIKATRIMIVDDAVVKNEM
FT                   EKVALKTAVPAGVKLSILTVKGAANNINNDKYAGQQVFLIVKSPHALRGLVDAGVELPQ
FT                   INVGNMSTKAGSRQIKKSVSVTDENLEDFDYLAQKGIKITAQMVPSEDAVEFANLLKK"
FT   regulatory      25849..25854
FT                   /gene="lmo0023"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        25862..26665
FT                   /transl_table=11
FT                   /gene="lmo0023"
FT                   /note="similar to PTS system, fructose-specific IIC
FT                   component"
FT                   /db_xref="GOA:Q8YAU0"
FT                   /db_xref="InterPro:IPR004700"
FT                   /db_xref="UniProtKB/TrEMBL:Q8YAU0"
FT                   /protein_id="CAC98238.1"
FT                   /translation="MDLAIWQIILLVILAACTILDALTLVIGLNFPVITGTLAGIIMGD
FT                   MVLGLAIGATLQLMVLGVGTYGGASIPDFTTGAIVGTVFAVLSGQDAEFAIGLAIPVGL
FT                   LMVQLDILARFTNTFFLHRIDSNIASGNISAVKRNIWYGALPWALSRAVPVFIMLTFGQ
FT                   SVVDFILNEIPEWLMGGLRVAGGILPVVGIAILLRYLPTNKFVAYLIIGFVAAAYLKVP
FT                   MLGVALIGVALAIIYFKQNFKNPVAAGANGAALVGEENEDGEYED"
FT   regulatory      26631..26636
FT                   /gene="lmo0024"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        26640..27467
FT                   /transl_table=11
FT                   /gene="lmo0024"
FT                   /note="similar to PTS system, mannose-specific IID
FT                   component"
FT                   /db_xref="GOA:Q8YAT9"
FT                   /db_xref="InterPro:IPR004704"
FT                   /db_xref="UniProtKB/TrEMBL:Q8YAT9"
FT                   /protein_id="CAC98239.1"
FT                   /translation="MKMANTKTEQDFEKVLKRRDLIAANFRWLFASQICWNYERMMSTG
FT                   YLYSILPTLRKLYKTDDDLKDMMNMHNQFFNTNPMVGGLILGMDMAIEEREKKASKEVV
FT                   TGLKTGLMGPFAGVGDTIFGVILPTIFGSIAAYMGLQGNVTGVVIWVLVNILVVGARFT
FT                   LLPLGYKQGAKLVTEFADRLNALTDAAILLGVTVVGALIPTVIKATVPFVYKSGKVELK
FT                   MQDMLDQIMPSLVPVLLVALIYALLGHKKMTSTKAILLVMVIAIILFNLKILG"
FT   regulatory      27479..27484
FT                   /gene="lmo0025"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        27495..28199
FT                   /transl_table=11
FT                   /gene="lmo0025"
FT                   /note="similar to phosphoheptose isomerase"
FT                   /db_xref="GOA:Q8YAT8"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR022951"
FT                   /db_xref="InterPro:IPR035472"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8YAT8"
FT                   /protein_id="CAC98240.1"
FT                   /translation="MGLTFFDKARELTEELEKTQAESIHQAAKLVADSIMNDGIIQAFG
FT                   SGHSYAAAIEVCGRAGGLIPSKVIMDPAGGYYESIEGVGSLLTHRLQAKPNDIFFLISN
FT                   SGRNPMGIELAEWIKSQGCKLIVVTALDASQTAASRHSSGKLLYEFADVILDNRSVQGD
FT                   AALELEGLEGKVCGTSSFSAVLLLQQTIYEAVELMLEKGYTPPVYRSANIDGGYEYNFA
FT                   IEDKFADRIFHL"
FT   regulatory      28209..28246
FT                   /gene="lmo0025"
FT                   /regulatory_class="terminator"
FT   regulatory      28241..28246
FT                   /gene="lmo0026"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        28254..28895
FT                   /transl_table=11
FT                   /gene="lmo0026"
FT                   /note="similar to E. coli copper homeostasis protein CutC"
FT                   /db_xref="GOA:Q8YAT7"
FT                   /db_xref="InterPro:IPR005627"
FT                   /db_xref="InterPro:IPR023648"
FT                   /db_xref="InterPro:IPR036822"
FT                   /db_xref="UniProtKB/TrEMBL:Q8YAT7"
FT                   /protein_id="CAC98241.1"
FT                   /translation="MILKEVCIENTTNLVNVIEAGANRVELCDNLAEGGTSVSYGVAKH
FT                   VVKICHEQNVSVMAMVRPRKGNFVYTKEEISVMIDDILMYKKIAVDGVVFGCITDSGLL
FT                   DKPAINELLKAAAGLEVTFHMAFDELVETEKLSAIDWLVEQGVTRILTHGGDGAKLPEE
FT                   TFVQWRKYIDYAAGRIIILPGGGIKSHNLEWIIKETGAAEIHGTDLFGER"
FT   regulatory      29086..29091
FT                   /gene="lmo0027"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        29100..31004
FT                   /transl_table=11
FT                   /gene="lmo0027"
FT                   /note="similar to PTS system, beta-glucosides specific
FT                   enzyme IIABC"
FT                   /db_xref="GOA:Q8YAT6"
FT                   /db_xref="InterPro:IPR001127"
FT                   /db_xref="InterPro:IPR001996"
FT                   /db_xref="InterPro:IPR003352"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR011297"
FT                   /db_xref="InterPro:IPR013013"
FT                   /db_xref="InterPro:IPR018113"
FT                   /db_xref="InterPro:IPR036878"
FT                   /db_xref="UniProtKB/TrEMBL:Q8YAT6"
FT                   /protein_id="CAC98242.1"
FT                   /translation="MKYEQLAKDILKNVGGKENINSVFHCITRLRFKLKDENIANTKEI
FT                   EKLDGVISVIKSGGQYQVVIGNHVPDVFKAVLEVGGISAEGDEGSSAPATGNIFNRFID
FT                   MISGVFTPVLGVLAATGMIKGFTAMFVAFGWITVTSGTYQLLYAIGDCLFYFFPIFLGY
FT                   TAMKKFGGNIFIGMAIGGALVYPTLAGITAGDPLYTLFAGTIFESPIHVTFLGIPVILM
FT                   SYASSVIPIIVATYFGSKVEKGFKKIIPDVIKTFVVPFCTLLIVVPITFIVIGPIATWA
FT                   GQLLGAGTIWVYNLSPIIAGLILGGFWQVFVIFGLHWGLVPVAINNLTVLGHDPILAMT
FT                   FGASFAQIGAVLAVFFKSRNKKIKSLSIPAFISGIFGVTEPAIYGVTLPLKKPFIMSCI
FT                   AGGIGGGIIGFAGSQTYIMGGLGIFGLPNFFKPGSGISGEFWWVVIAIVISFILGFILT
FT                   YVVGFKDPADVVVEQSNTVEGETLIERETIPAPVVGEIVTLADVKDEAFSSGALGKGVA
FT                   IIPTVGRVVAPAAGTVTTIFPTGHAIGITTKDGAEVLIHIGMDTVQLEGKFFTAHVKQG
FT                   DVIEKGQLLTEFDIEGIKAAGYDVTTPVVVTNSNQYLDVMITDAKEAKLEERLITLVI"
FT   regulatory      31019..31057
FT                   /gene="lmo0027"
FT                   /regulatory_class="terminator"
FT   regulatory      31076..31082
FT                   /gene="lmo0028"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        31088..31963
FT                   /transl_table=11
FT                   /gene="lmo0028"
FT                   /note="similar to E. coli microcin C7 self-immunity protein
FT                   (MccF)"
FT                   /db_xref="InterPro:IPR003507"
FT                   /db_xref="InterPro:IPR027461"
FT                   /db_xref="InterPro:IPR027478"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR040449"
FT                   /db_xref="InterPro:IPR040921"
FT                   /db_xref="UniProtKB/TrEMBL:Q8YAT5"
FT                   /protein_id="CAC98243.1"
FT                   /translation="MLVKGDTVGIICCSDGRKKEDENRIALLEQVLKTEFSLQVVFAET
FT                   IFQKAESPFSGTPQARAIELMKLYQRSDVQMIFDISGGDAANQVLPYLDFDIIRNAQKP
FT                   FVGYSDLTVILNAIYTKTEQMGYNYQLLHLVGKDSELQQSHFRKTFFENRVLISGEQLN
FT                   EFVWRGGEVIGGNIRCFLKLAGTNFMPDFTNKIILLESLGGKEAKLASYVAQLEQLGAF
FT                   SKCLGVIVGQHSEAEENGEYERIGRLYQQIGRKYKLPIFRTSEIGHSVDAKPCLIGAKV
FT                   NVSRETLTNF"
FT   regulatory      31988..32018
FT                   /gene="lmo0028"
FT                   /regulatory_class="terminator"
FT   regulatory      32184..32189
FT                   /gene="lmo0029"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        32197..32535
FT                   /transl_table=11
FT                   /gene="lmo0029"
FT                   /db_xref="GOA:Q8YAT4"
FT                   /db_xref="InterPro:IPR025273"
FT                   /db_xref="UniProtKB/TrEMBL:Q8YAT4"
FT                   /protein_id="CAC98244.1"
FT                   /translation="MKVEGLLGFLGAALGIGFSLMVLVIPDISQALEEESFFFYMLTIG
FT                   SLVLSGVGLAGSFIVSHKPRLGGAMMVAAAIGCTMSISIMFLLPIVLLAVGGLIALINY
FT                   EEAASVEE"
FT   regulatory      complement(32535..32563)
FT                   /gene="lmo0030"
FT                   /regulatory_class="terminator"
FT   regulatory      32546..32574
FT                   /gene="lmo0029"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(32571..33380)
FT                   /transl_table=11
FT                   /gene="lmo0030"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="GOA:Q8YAT3"
FT                   /db_xref="InterPro:IPR000150"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:Q8YAT3"
FT                   /protein_id="CAC98245.1"
FT                   /translation="MEKYLICSDLDGTLLLKNQTISPKTLNLLQQLIEEGHHFAVSTGR
FT                   MYNSATDFAKLVHPKADVIASNGGVVAVSGEIIQQEKMKQSALLETFLLCQNHDLPVFF
FT                   FSTDTVFYTKNPPYYFTDEEDKGRVNATKLVAIKSREIFLEHADQFINGIVIEEEDFDK
FT                   LAVLRSDLEKLSDVSILSSHANNIEILPKDMDKKYAVKNLAAHLNIKPENVITFGDGEN
FT                   DIGMLEVAGAGVAMENASELVKKSADFVTTANDADGIYYFLKKHLNR"
FT   regulatory      complement(33387..33392)
FT                   /gene="lmo0030"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(33397..34452)
FT                   /transl_table=11
FT                   /gene="lmo0031"
FT                   /product="transcriptional regulator LacI family"
FT                   /db_xref="GOA:Q8YAT2"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:Q8YAT2"
FT                   /protein_id="CAC98246.1"
FT                   /translation="MKKITIQEIAKLSGVSVSTVSRVLNNSPSVSAAKRKKIQAIIDEH
FT                   NYTPSVFARGMVNKQTKNIGVILPDISNPYFISLITQIQKFALDYMFSTILFNTMLAEP
FT                   DNKNNQHPLTEEDYLKIILEKQVDGLLILGGEIDKEIVPKEYITALNQLNNAIPVVVIG
FT                   SKIPELNCLFIERNLKKGVTTLVSHLTALGHKNIGFIGGEAGVKITTYRLESFKEAMTS
FT                   YQHPVNDDWVVLSDYYTADGYAAMTHLLENSTTLPTALVAINDNVAIGAIRAINDAKLS
FT                   CPEDIAIVSCDQFMNGDYQTPRLTSMDQHNEYLGKMAILQLISAINGQVEPMIINHNPE
FT                   LIIRESCGSKL"
FT   regulatory      complement(34465..34470)
FT                   /gene="lmo0031"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      34640..34645
FT                   /gene="lmo0032"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        34654..35619
FT                   /transl_table=11
FT                   /gene="lmo0032"
FT                   /note="similar to xylose repressor"
FT                   /db_xref="InterPro:IPR000600"
FT                   /db_xref="UniProtKB/TrEMBL:Q8YAT1"
FT                   /protein_id="CAC98247.1"
FT                   /translation="MDIQESVIGIDLGGTKILIGEVTKDGEVLNSKSYPSNTENQTKAT
FT                   ETLLKVLADYTQNIGFIAPKQTGIGVGLVGRVDHKSGVWLEIEPGKSNPTPLAGILEAK
FT                   TGLPVSLGNDVVCATMAEKQFGWGRETNDFIYLNVGTGLAAGFVVDGRITQGGHFNAGE
FT                   VGHAVVDIHSDVLCGCGRRGCVERLASGLGIKEEALRHLNSYPTSILAETQTELTGKMV
FT                   LHAAEQKDELAEKIIDNATFQLANLIMNLVRTTDPECVILGGGVTRNEHFFQKIQDNLQ
FT                   SNTIRFVTKGVVRSKLEKDKVGLIGAAVIGMRLGNEGGKE"
FT   regulatory      35604..35609
FT                   /gene="lmo0033"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        35616..38018
FT                   /transl_table=11
FT                   /gene="lmo0033"
FT                   /note="similar to endoglucanase"
FT                   /db_xref="GOA:Q8YAT0"
FT                   /db_xref="InterPro:IPR001701"
FT                   /db_xref="InterPro:IPR004197"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="UniProtKB/TrEMBL:Q8YAT0"
FT                   /protein_id="CAC98248.1"
FT                   /translation="MKPSMKRQIAQTGIIHRPLPIETEHALETLAKKKQVLSSRTLFSS
FT                   KQHVSLEFTHQGAGDFTISGQDEIKLSSPVVMPHWPAGAPDDGDYTNFGNVTISASIGN
FT                   EDWSGFNRVRIQVFPDFPGVTNPYLMISFKNDGTVKVPDIYGREGVHGVNLINHEWNDV
FT                   IFEIEGLPRDRMTEMSFSYYLNGPERLTAGTMELFINEIKLEQISEPEISKGWLPQNNT
FT                   LIYSHNGYSKDMPKVAFCANKHAATTFTIHDKETDKVVFTGKSYQNATETGNFVILDFS
FT                   DLQTVGEYYLKFADMQTEIFQIGTSEVIWESSIWKSLNFIFCERCGCPVFGKHTTCHAD
FT                   IIAEHDGKQLSFNGGWHDAGDVSQQLIQTAEVTMALYEMAASLPEKEETLRMRLLEEGE
FT                   WGLDFILKTRFGDGFRATSAGMTRWTDGLVGGMDDAIARVHNQAYENFYCAGIEAYIGS
FT                   QIADNATMQNHLLRIAEEDLLFAIKELEKHGTSQKPIFWEHTYQTSESLYYATASWAAS
FT                   MVYQLTNKEIYAEKAAEWLDLMLEAQEKAGIRDSETSELYKGFFYRDKSHKVIQHFNHQ
FT                   AREHLYLLALEAALETQPSHAEKQTWLQAVEMYGDYLKKVTRFTKPYPLIPAGLYKKDE
FT                   YLDEASFHLQHLLIDERAIEEYQLQFEQGIKINDEVALRKFPIWFSFRGNNAILLSAGK
FT                   AASIAGKILKDKALLDIAEGQLQWVIGMNPFGQSMMHGEGYRYAQQYSVLNGEITGEIP
FT                   VGMETFRNEDEPYWPEFNNATYKEVWVGNAGKWMSIVADLNKITGKS"
FT   regulatory      38017..38022
FT                   /gene="lmo0034"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        38031..39383
FT                   /transl_table=11
FT                   /gene="lmo0034"
FT                   /note="similar to PTS system, cellobiose-specific IIC
FT                   component"
FT                   /db_xref="GOA:Q8YAS9"
FT                   /db_xref="InterPro:IPR003352"
FT                   /db_xref="InterPro:IPR004501"
FT                   /db_xref="InterPro:IPR004796"
FT                   /db_xref="UniProtKB/TrEMBL:Q8YAS9"
FT                   /protein_id="CAC98249.1"
FT                   /translation="MSSERSLSSRFIEGLSIFAQKISSQKHIMAIRDGFAAMIPITIIA
FT                   AFFLLVNNVLLQPENGLLKFIPNVENYLGVGIQVYNATLGIMAILAAFLIGNFLAKSYG
FT                   MEGRTEGVIAVAAYVVLIPASSHLMSVDGKAFEAGGVLTQEMTSSTGMFLAIIAALVSI
FT                   TMLAKFSKSKKLKISMPESVPPAIAKSFNILIPSFLVLSILAIIEVLVVSFVSMSIPEI
FT                   IVKVLQIPLVGGFQTLPGILLYVFLAGFLWVFGIHGAFVLGAISGPVLLTSLQQNIDAV
FT                   NAGTALPNIVTQPFLDAFVYMGGGGTIICLVIAIFIASKRPDHRMVTKFGLIPSIFNVS
FT                   EPLMFGLPVVFNPIYGIPLVIAPLASTAMAYFATSWGWISQTYILIPWVTPPVLSGYLA
FT                   TGGDIRASILQIAIIIVGTLIYLPFVLVANRAYVLEQKAAGKVEAVTNGEV"
FT   regulatory      39371..39376
FT                   /gene="lmo0035"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        39385..40470
FT                   /transl_table=11
FT                   /gene="lmo0035"
FT                   /note="similar to Glucosamine--fructose-6-phosphate
FT                   aminotransferase (C-terminal domain)"
FT                   /db_xref="GOA:Q8YAS8"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR035466"
FT                   /db_xref="InterPro:IPR035490"
FT                   /db_xref="UniProtKB/TrEMBL:Q8YAS8"
FT                   /protein_id="CAC98250.1"
FT                   /translation="MKPTMMTYINEEEEMCRAILANFQTNAEKLESLVKNGAKEWLILA
FT                   TGSSLNAAQSAKYYIENIADVRITVEEPFNHLYYEKLSNHLDLVIGISQSGQSTSTISA
FT                   LERVKKEASVPVVALTSDVTSEIAEFADITLDIGSGKERVGYVTKGFTATVLTLMLTGL
FT                   HFAYKTAQIDETKFNNEINAFSRATNAIPATIAETEAFYERWQEEFATAPKFTAIGYGP
FT                   TVGTCKEFETKFSETVRVPSQGLDLEAFMHGPYLEVNPQHRIFFLETESAVTERLVALR
FT                   NYESKYTPFTYTVKFGTAGNDRTLLIPADLDEYQAPFLMILPFQILAHHIAELKGNKLT
FT                   ERIYTDFGVAMKSKTKPGDYA"
FT   regulatory      40483..40530
FT                   /gene="lmo0035"
FT                   /regulatory_class="terminator"
FT   regulatory      40691..40696
FT                   /gene="lmo0036"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        40705..41730
FT                   /transl_table=11
FT                   /gene="lmo0036"
FT                   /note="similar to ornithine carbamoyltransferase"
FT                   /db_xref="GOA:Q8YAS7"
FT                   /db_xref="InterPro:IPR002292"
FT                   /db_xref="InterPro:IPR006130"
FT                   /db_xref="InterPro:IPR006131"
FT                   /db_xref="InterPro:IPR006132"
FT                   /db_xref="InterPro:IPR024903"
FT                   /db_xref="InterPro:IPR036901"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8YAS7"
FT                   /protein_id="CAC98251.1"
FT                   /translation="MNKKRDFIDTKDFSKEEILFMIEIGRKMKESIKNGHYPQLLKHKT
FT                   LGMIFEQSSTRTRVSFETAMTQLGGHAQYLAPGQIQLGGHESVGDTAKVLSRLVDILMA
FT                   RVERHQTVVELANTAAIPVINGMSDYNHPTQELGDAITMFEHLPKGKKIEDCKIVFVGD
FT                   ATQVCASTMFMATKLGMDFVQFGPKGFQLREEHLKVAEENCEVSGGSYLITEDVDIALK
FT                   DADFIYTDVWYGLYEAELSEEERMKTFYPKYQVNKELISKAAPHVKFMHCLPATRGEEV
FT                   TDEVLDAPYSVVIDEAENRLTAMRALLVYFMNPYVKEAGFAVAEKYDAELELLLRNGAG
FT                   L"
FT   regulatory      41787..41792
FT                   /gene="lmo0037"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        41803..43188
FT                   /transl_table=11
FT                   /gene="lmo0037"
FT                   /note="similar to amino acid transporter"
FT                   /db_xref="GOA:Q8YAS6"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:Q8YAS6"
FT                   /protein_id="CAC98252.1"
FT                   /translation="MEKKKKFRLFDAVLMAVCVVLVVESAAPAAAIGSSQFFWWIALLI
FT                   LFFLPYGLVSAELGTTYDDEGGIYDWVKRAFGRKWGARVAWLYWINYPIWMASLAVLFV
FT                   EVITQIFPVSFGTPVSILIQLIFVWIVVIVSCYPVSDSKWILNIAAFCKVAIMLCLGVL
FT                   GIYFAITKGLANDFSGKALLPTFDLESLSFISVILFNFLGFEVVTTLASDMENPKKQIP
FT                   QAIIYGGILIAFFYLLAAFGMGAAIPTSELSTSGGLIDSFIMLIGGVNPFVIIIGIMFM
FT                   YTLVANLVSWALGVNYVAMYAAKNKDLPAVFGKTNPKNDMPTGTSILNGIVASVLIVAA
FT                   PLIPNENIFWAFFALNVVALLGSYILMFPAFLKLRKLDPDRERPFKVPGGKILLYLMTF
FT                   VPMILLIITLIFSAVPLNGSSAELNEKIPILIGTIVAVIVGEICIWLAGKRKDKGEIKN
FT                   END"
FT   regulatory      43161..43166
FT                   /gene="lmo0038"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        43175..44266
FT                   /transl_table=11
FT                   /gene="lmo0038"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="GOA:Q8YAS5"
FT                   /db_xref="InterPro:IPR007466"
FT                   /db_xref="InterPro:IPR017754"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8YAS5"
FT                   /protein_id="CAC98253.1"
FT                   /translation="MRTIDSSSKKDGFRMPGEFEKHAGCYIIWPERPDNWRLGAKPAQK
FT                   AFVDVATAISHFEPVTVVASSSQYVNARYMLSDEIRVVEMDNDDAWVRDSGPTFVVNDS
FT                   GDVRGVDWSFNSWGGLVDGLYFPWDKDDQVAQKICELERKDRYRLADFVLEGGSIHVDG
FT                   EGTLVTTEECLLSEGRNPQLSKQQIEMVLKEYLNLEKIIWLKRGIYLDETNGHVDNIFN
FT                   YVRPGVVALAWTDDETDPQYEISKECFDILSNETDAKGRKLEVHKINVPKPILITDEES
FT                   KGVDAVEGTLPREEGDRLAASYINYYTANGGVIFPLFGDPNDELAREKLQQLYPNCEVV
FT                   GVKAREILLGGGNIHCITQQVPR"
FT   regulatory      44269..44274
FT                   /gene="lmo0039"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        44282..45223
FT                   /transl_table=11
FT                   /gene="lmo0039"
FT                   /note="similar to carbamate kinase"
FT                   /db_xref="GOA:Q8YAS4"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR003964"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="UniProtKB/TrEMBL:Q8YAS4"
FT                   /protein_id="CAC98254.1"
FT                   /translation="MNQKIVVALGGNAILSSDASAEAQRSALEETAEYLVQFIENGDDL
FT                   IISHGNGPQVGNLMLQQHAGASEKNPAMPLDTCVAMTQGSIGYWMQNALDKAFLKHGLD
FT                   KVAVSLITQVVVDKDDPAFEKPTKPIGPFLNKEEAEKEMAETGAIFLEDAGRGYRKVVP
FT                   SPRPLSIKEHQIIKQLVDSGVVTISAGGGGVSVVENGLDLSGVETVIDKDFASEKLAEL
FT                   IDADLLVILTGVENVYINYNQPNQKKLEQVTVSELEKYIDEKQFAAGSMLPKIEAATAF
FT                   VKERPHAKAIITSLENIGAMLERGAGTVIVAG"
FT   regulatory      45241..45270
FT                   /gene="lmo0039"
FT                   /regulatory_class="terminator"
FT   regulatory      45310..45315
FT                   /gene="lmo0040"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        45325..46434
FT                   /transl_table=11
FT                   /gene="lmo0040"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="GOA:Q8YAS3"
FT                   /db_xref="InterPro:IPR007466"
FT                   /db_xref="InterPro:IPR017754"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8YAS3"
FT                   /protein_id="CAC98255.1"
FT                   /translation="MGQLKGLPVEDGFRMPGEYEPHIGCFMIWPERPDNWRLGGKPAQQ
FT                   NYKEVAVAISNFEPVTMFVSPNQYKNARKELPDTIRVIEMSNDDAWIRDYGPSFLVDDK
FT                   GDMRGVDWGFNAWGGLLDGLYFPWDKDNQIAKKVCELERIDYYSQKDFILEGCSIHVDG
FT                   EGTLVTTEECLLSEGRNPNLTKIEIEQTLKKYFHAQKVIWLKHGFYLDETNGHVDNIFN
FT                   FVAPGEVVLSWTDNKSDPQYEISRECYDILANKTDAKGRTFIIHKLHCPDPVLITQTES
FT                   EGVEAINGTFPRQAGDRLAASYVNYYTANGAIIFPLFDDPKDKDAQELLEKLYPDRKIV
FT                   GIKAREILLGGGNIHCITQHLPDKSTIRE"
FT   regulatory      46437..46442
FT                   /gene="lmo0041"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        46451..47230
FT                   /transl_table=11
FT                   /gene="lmo0041"
FT                   /note="conserved hypothetical protein, hypothetical
FT                   regulator"
FT                   /db_xref="GOA:Q8YAS2"
FT                   /db_xref="InterPro:IPR000281"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR035472"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q8YAS2"
FT                   /protein_id="CAC98256.1"
FT                   /translation="MDFYEISSKTVASLTRNERILFDYVVKNMNLIKNQSIREVSAECF
FT                   VSTTTFLRFVRKLGFTGYSEFTTVLKFTLLGHTELKPSPFVVEQSDYREEYLKNIIESV
FT                   RVLEPSKIKKITKKLVNKPRIYFFAKGLSKHAAKYIKYLYTMSGFLVEFPEDYQYRQAV
FT                   LPHIGKDDLVFILTYGGHDIELIQTAQKLKSRNETPMLISITGADNNIIQNMSDINLYI
FT                   FTDEIEMNNLDITSRISTIAIMELILYQFMEDETSSF"
FT   regulatory      47319..47324
FT                   /gene="lmo0042"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        47335..47994
FT                   /transl_table=11
FT                   /gene="lmo0042"
FT                   /note="similar to E. coli DedA protein"
FT                   /db_xref="GOA:Q8YAS1"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="InterPro:IPR032818"
FT                   /db_xref="UniProtKB/TrEMBL:Q8YAS1"
FT                   /protein_id="CAC98257.1"
FT                   /translation="MDFITYIIDFILHIDQHLVEIINNFGIWTYIILFLIVFIETGLVV
FT                   FPFLPGDSLLFAAGALSVLDGSILHIVPLIITLWLAAVLGDTVNYHIGKKIGTSIPEDS
FT                   WFGKLINKEKMEKAEAFFNKHGGKTIFIARFMPFIRTFAPFVAGASRMNYRYFLNYNIL
FT                   GATVWVLLCTLAGYFFGNFPIVKDNFSLVVIGIIVVSVIPMVVSFIKSKMDKKSAE"
FT   regulatory      47979..48009
FT                   /gene="lmo0042"
FT                   /regulatory_class="terminator"
FT   regulatory      48063..48068
FT                   /gene="lmo0043"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        48074..49306
FT                   /transl_table=11
FT                   /gene="lmo0043"
FT                   /note="similar to arginine deiminase"
FT                   /db_xref="GOA:Q8YAS0"
FT                   /db_xref="InterPro:IPR003876"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8YAS0"
FT                   /protein_id="CAC98258.1"
FT                   /translation="MKMEQALNITSEIGKLQTVLVKRPGSELENITPEYLESLLFDDIP
FT                   YLKMMQKEHDFFAKTMRDSNIEVLYLEKLAAEALREANNKESFLTKMIKESNQMDESAL
FT                   YVRDYLMSFDEEEMIRKLMSGLKKSEIPERKKKHLNEMMDEQYPFFLDPLPNLYFTRDP
FT                   AAVIGNGVTINRMFQPARRRESIFIELILKHHPRFSNQDIPVWSGRGEPFSLEGGDELV
FT                   LNEETVLVGVSERTDARAVERLAESLFNRSPKIKRVLAVEIPETRSFMHLDTVFTMVNF
FT                   AQFTIHPAIQNQQGELNIYILEKSENGLEITPRRDFQRVIAEVLDEPEIDFIPCGGEDV
FT                   IVSAREQWNDGANTLAIAPGEVITYDRNQVSNDLLRSAGIKVHEVISSELSRGRGGPRC
FT                   MTMPLVRENLK"
FT   regulatory      49569..49574
FT                   /gene="rpsF"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        49585..49878
FT                   /transl_table=11
FT                   /gene="rpsF"
FT                   /product="ribosomal protein S6"
FT                   /db_xref="GOA:Q8YAR9"
FT                   /db_xref="InterPro:IPR000529"
FT                   /db_xref="InterPro:IPR014717"
FT                   /db_xref="InterPro:IPR020814"
FT                   /db_xref="InterPro:IPR020815"
FT                   /db_xref="InterPro:IPR035980"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8YAR9"
FT                   /protein_id="CAC98259.1"
FT                   /translation="MARKYEIMYIIRPNIEEDEKKAVVERFDGILTENGAEIIESKEWG
FT                   KRRLAYEINDYRDGFYHIVKLNADKADSINEFDRLAKISDDIIRHMVIKEEA"
FT   regulatory      49918..49923
FT                   /gene="ssb"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        49934..50470
FT                   /transl_table=11
FT                   /gene="ssb"
FT                   /note="highly similar to single-strand binding protein
FT                   (SSB)"
FT                   /db_xref="GOA:Q8YAR8"
FT                   /db_xref="InterPro:IPR000424"
FT                   /db_xref="InterPro:IPR011344"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8YAR8"
FT                   /protein_id="CAC98260.1"
FT                   /translation="MMNRVVLVGRLTKDPELRYTPAGVAVATFTLAVNRTFTNQQGERE
FT                   ADFINCVVWRKPAENVANFLKKGSMAGVDGRVQTRNYEGNDGKRVYVTEIVAESVQFLE
FT                   PRNSNGGGGNNYQSGNNNNNYNSGGNNFGQAPTNNGGFGQDQQQSQNQNYQSTNNDPFA
FT                   SDGKPIDISDDDLPF"
FT   regulatory      50500..50505
FT                   /gene="rpsR"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        50514..50753
FT                   /transl_table=11
FT                   /gene="rpsR"
FT                   /product="ribosomal protein S18"
FT                   /db_xref="GOA:P66461"
FT                   /db_xref="InterPro:IPR001648"
FT                   /db_xref="InterPro:IPR018275"
FT                   /db_xref="InterPro:IPR036870"
FT                   /db_xref="UniProtKB/Swiss-Prot:P66461"
FT                   /protein_id="CAC98261.1"
FT                   /translation="MAGGRRGGRRRKKVCYFTSNGITHIDYKDVELLKKFVSERGKILP
FT                   RRVTGTSAKYQRKLTVAIKRSRQMALLPFVAEEK"
FT   regulatory      50765..50800
FT                   /gene="rpsR"
FT                   /regulatory_class="terminator"
FT   regulatory      50893..50898
FT                   /gene="lmo0047"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        50907..51518
FT                   /transl_table=11
FT                   /gene="lmo0047"
FT                   /db_xref="InterPro:IPR025711"
FT                   /db_xref="UniProtKB/TrEMBL:Q8YAR7"
FT                   /protein_id="CAC98262.1"
FT                   /translation="MYKKLATVGMTVLLVGALSACSFNDDKDTSSNNSNNETTSSKSSN
FT                   NESSSDSLQNKSLDMSYEDAINAFKDKHSDAEISSVELEKSLGKYVYKVDGISNDNEYE
FT                   MKFNAETKEQLSDETDRLDREDAGGVEKENEKLSLDGIKSPKEAMDKAVSEQAGDVTSW
FT                   KIERELDTTYYEVTVKQDNNKYEIKLNAKTLEILQTEQDD"
FT   regulatory      51532..51570
FT                   /gene="lmo0047"
FT                   /regulatory_class="terminator"
FT   regulatory      51761..51766
FT                   /gene="lmo0048"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        51775..52389
FT                   /transl_table=11
FT                   /gene="lmo0048"
FT                   /note="similar to Staphylococcus two-component sensor
FT                   histidine kinase AgrB"
FT                   /db_xref="GOA:Q8YAR6"
FT                   /db_xref="InterPro:IPR006741"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8YAR6"
FT                   /protein_id="CAC98263.1"
FT                   /translation="MSNFTAKVPLSERMADVLISKDRWKDDEEGYLKVKYGLEIILINV
FT                   MKFALVYGIALVTGLLLQTVTVHLSYLWLRRYSFGLHATKTLNCTLISLLMFVLAPFVF
FT                   QNIPSNNWIVLGTFGFILLNMFLFAPADTESLPLIGEEHRKTLKRKAMIGTLILTGIAL
FT                   LIPFAEMKTLIMVGSLFQVISINPLTYKLLKRRYRNYEKYE"
FT   regulatory      52357..52362
FT                   /gene="lmo0049"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        52373..52534
FT                   /transl_table=11
FT                   /gene="lmo0049"
FT                   /db_xref="InterPro:IPR009229"
FT                   /db_xref="UniProtKB/TrEMBL:Q92FR1"
FT                   /protein_id="CAC98264.1"
FT                   /translation="MKNMNKSVGKFLSRKLEEQSMKVADSSMSKACFMFVYEPKSPFVK
FT                   MQEKNENK"
FT   regulatory      52618..52623
FT                   /gene="lmo0050"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        52630..53925
FT                   /transl_table=11
FT                   /gene="lmo0050"
FT                   /note="similar to sensor histidine kinase (AgrC from
FT                   Staphylococcus)"
FT                   /db_xref="GOA:Q8YAR5"
FT                   /db_xref="InterPro:IPR032834"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q8YAR5"
FT                   /protein_id="CAC98265.1"
FT                   /translation="MFSILMAIIQITGIFIAIQILTNKVFSIKEGLVTIAIAMLAFPLF
FT                   TLVQYWSMIFVLIVFVSALYWKNKNVVVSASITLVVIILLTISDSIVGFILVPGLNFKY
FT                   DEIFNELLPTLIYCAGMLANLLVFSFLLRKLIEKVNISRFVEHRKYAYIIFSIVALTVL
FT                   AFYMNIYAGSIAGFDGSVLKINTLIFTGYTILLIVIVTVVINTATNELKVQNQKEQLEQ
FT                   LQDYVTTLESLHREMRVFRHDYVNILSTLVGYIDNNDMPGLKYYFENNIVPINKTIESN
FT                   NYKISLLQNIHVIELKGLLAVKLIRAQELKIDAILEVVEPIDKISMDSIDLCKVVGILL
FT                   DNAVEAALTCENPVIRIAFVKKGDSIIIVFANSLPVNMPPIYKIFEEGFSTKGEGRGLG
FT                   LASLREIMKKYSHVALDTKVTDREVIQELEIM"
FT   regulatory      53933..53938
FT                   /gene="lmo0051"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        53944..54672
FT                   /transl_table=11
FT                   /gene="lmo0051"
FT                   /note="similar to 2-components response regulator protein
FT                   (AgrA from Staphylococcus)"
FT                   /db_xref="GOA:Q8YAR4"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR007492"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:Q8YAR4"
FT                   /protein_id="CAC98266.1"
FT                   /translation="MLPVFICEDNRMQRERLTKYIEDYIMVEHFDMKLELSTGDPFELV
FT                   SRMPTHQGMGLYFLDIDLGQPDMNGFELAQEIRKFDPRGFIIFITTHAELSYMTFTYKV
FT                   EALDYIIKDDIDLLHDRVLACMKQAEERISNDQDMQKYFTFKVSDKKIIHELLDDILFF
FT                   ETAPTIHKVILHGKNRQVEFYGKLKNIEKMLDESFYRCHRSYIVNKKNIHELDTTKGVV
FT                   KMSNGENCYASSKLIKSLSL"
FT   regulatory      54675..54702
FT                   /gene="lmo0051"
FT                   /regulatory_class="terminator"
FT   regulatory      54825..54830
FT                   /gene="lmo0052"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        54839..56812
FT                   /transl_table=11
FT                   /gene="lmo0052"
FT                   /note="highly similar to B. subtilis YybT protein"
FT                   /db_xref="GOA:Q8YAR3"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001667"
FT                   /db_xref="InterPro:IPR003156"
FT                   /db_xref="InterPro:IPR014528"
FT                   /db_xref="InterPro:IPR038763"
FT                   /db_xref="UniProtKB/TrEMBL:Q8YAR3"
FT                   /protein_id="CAC98267.1"
FT                   /translation="MSGYFQKRMLKYPLYGLIAATIILSVITFFFSWWLSALVVVGGII
FT                   LTVAMFYFEYRLNEDVQLYVSNLTYRIKRSEEEALVEMPMGILLYDEHYKIEWVNPFMS
FT                   KYFDKAELIGESLEEVGPEFLDVITGNDEKGIMSIAWRDHRFDTIVKRKERILYLYDRT
FT                   EYYDLNKKFQANKSVFAVIFLDNYDEWAQGMDDRRRSALNNLVTSMLTNWAREHRIYLK
FT                   RISTDRFMAFLTEEMLKRLEEEKFQILDRIRERTSKQNIPLTLSIGIGYKEDDLIQLAD
FT                   LAQSSLDLALGRGGDQVVIKQPEGKVRFYGGKTNPMEKRTRVRARVISQALQELITQSD
FT                   QVFVMGHRYPDMDVIGSSLGVMRIAEMNDRNAYVVVEPGKMSPDVKRLMNEIEEYPNVI
FT                   KNIVTPQVALENITEKSLLVVVDTHKPSMVINKELLDSATNVVVVDHHRRSEEFVGSPV
FT                   LVYIEPYASSTAELITELFEYQPDLEQVGKIEATALLSGIVVDTKNFTLRTGSRTFDAA
FT                   SYLRSLGADTILVQQFLKEDITTFTQRSRLVESLEIYHDGMAIATGHEDEEFGTVIAAQ
FT                   AADTMLSMEGVQASFVITLRPDKLIGISARSLGQINVQVIMEKLGGGGHLSNAATQLKD
FT                   VTIAEAEKQLISAIDAYWKGET"
FT   regulatory      56800..56805
FT                   /gene="rplI"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        56815..57261
FT                   /transl_table=11
FT                   /gene="rplI"
FT                   /product="50S ribosomal protein L9"
FT                   /db_xref="GOA:Q8YAR2"
FT                   /db_xref="InterPro:IPR000244"
FT                   /db_xref="InterPro:IPR009027"
FT                   /db_xref="InterPro:IPR020069"
FT                   /db_xref="InterPro:IPR020070"
FT                   /db_xref="InterPro:IPR020594"
FT                   /db_xref="InterPro:IPR036791"
FT                   /db_xref="InterPro:IPR036935"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8YAR2"
FT                   /protein_id="CAC98268.1"
FT                   /translation="MKVIFLKDVKGKGKKGETKNVADGYANNFLIKNGYAVEANNAALS
FT                   TLSAQKKKEDKLAAEELAEAKALKEKMENLTVELKAKSGEGGRLFGSITSKQIAQTLEK
FT                   THGIKIDKRKMDLPEAIRALGHTKVPVKLHHEVTATLDVHVSEE"
FT   regulatory      57272..57277
FT                   /gene="dnaC"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        57286..58638
FT                   /transl_table=11
FT                   /gene="dnaC"
FT                   /note="highly similar to replicative DNA helicases"
FT                   /db_xref="GOA:Q92FQ6"
FT                   /db_xref="InterPro:IPR007692"
FT                   /db_xref="InterPro:IPR007693"
FT                   /db_xref="InterPro:IPR007694"
FT                   /db_xref="InterPro:IPR016136"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036185"
FT                   /db_xref="UniProtKB/TrEMBL:Q92FQ6"
FT                   /protein_id="CAC98269.1"
FT                   /translation="MDNNFQDRTPPQNIEAEQAVLGAIFLEPNALITASEILMPDDFYR
FT                   TGHQIIFETMLDLNDHGKAVDVLTVYEALAAKGNLEDAGGLPYLTELSGAVPTAANLEY
FT                   YAHIIEDKALLRRLIRTATQIATDGYSREDELDMLMDEAEKSILEVSQRKNVGAFKNIK
FT                   DVLVKTYDDIEILHNRKGDITGIPTGFNELDKMTAGFQRNDLIIVAARPSVGKTAFALN
FT                   IAQNVATKTDENVAIFSLEMGAEQLVMRMLCAEGNINAQNLRTGALTSDDWQKLTIAMG
FT                   TLSNSGIYIDDTPGVRVNEIRSKCRRLKQETGLGMIVIDYLQLIAGSGRGGENRQQEVS
FT                   EISRSLKALARELEVPVIALSQLSRSVEQRQDKRPMMSDIRESGSIEQDADIVAFLYRE
FT                   DYYDREGENDGTIEIIIAKQRNGPVGDVKLAFVKEYNKFVNLEVRYDDAMA"
FT   regulatory      58647..58694
FT                   /gene="dnaC"
FT                   /regulatory_class="terminator"
FT   regulatory      58884..58889
FT                   /gene="purA"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        58897..60189
FT                   /transl_table=11
FT                   /gene="purA"
FT                   /note="highly similar to adenylosuccinate synthetase"
FT                   /db_xref="GOA:Q8YAR1"
FT                   /db_xref="InterPro:IPR001114"
FT                   /db_xref="InterPro:IPR018220"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033128"
FT                   /db_xref="InterPro:IPR042109"
FT                   /db_xref="InterPro:IPR042110"
FT                   /db_xref="InterPro:IPR042111"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8YAR1"
FT                   /protein_id="CAC98270.1"
FT                   /translation="MSSVVVVGTQWGDEGKGKITDFLSENAEAIARYQGGNNAGHTIKF
FT                   DGVTYKLHLIPSGIFYKEKISVIGNGMVVDPKALVEELKYLHDKGVDTSNLRISNRAHI
FT                   ILPYHIRIDEADEERKGANKIGTTKKGIGPAYMDKAARVGIRIIDLLDKETFKEKLEHN
FT                   LGEKNRLLERFYELEGFKLEDILDEYYEYGQQFKEYVCDTSVVLNDALDDGKRVLFEGA
FT                   QGVMLDIDQGTYPFVTSSNPIAGGVTIGSGVGPSKINHVVGVAKAYTTRVGDGPFPTEL
FT                   FDSIGDTIREVGHEYGTTTGRPRRVGWFDSVVVRHARRVSGLTDLSLTLLDVLTGIETL
FT                   KICVAYKLDGKTITEFPASLKDLARCEPVYEELPGWTEDITGVTSLDDLPVNCRHYMER
FT                   IAQLTGVQVSMFSVGPDRAQTHVIKSVWRLA"
FT   regulatory      60205..60244
FT                   /gene="purA"
FT                   /regulatory_class="terminator"
FT   regulatory      60492..60497
FT                   /gene="lmo0056"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        60506..60799
FT                   /transl_table=11
FT                   /gene="lmo0056"
FT                   /note="similar to a small heat shock protein of Clostridium
FT                   acetobutylicum"
FT                   /db_xref="InterPro:IPR010310"
FT                   /db_xref="InterPro:IPR036689"
FT                   /db_xref="UniProtKB/TrEMBL:Q8YAR0"
FT                   /protein_id="CAC98271.1"
FT                   /translation="MSGQIRMSPSELRDRAKTYGQSGRDIEDILSRLSQLQEQLRSEWE
FT                   GQAFMRFDDQFEQLKPKVTEFANLMDQINDQLEKTANAVEEHDQQLSQNFGF"
FT   regulatory      60853..60885
FT                   /gene="lmo0056"
FT                   /regulatory_class="terminator"
FT   regulatory      60933..60938
FT                   /gene="lmo0057"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        60948..64154
FT                   /transl_table=11
FT                   /gene="lmo0057"
FT                   /note="similar to B. subtilis YueB protein"
FT                   /db_xref="GOA:Q8YAQ9"
FT                   /db_xref="InterPro:IPR023838"
FT                   /db_xref="UniProtKB/TrEMBL:Q8YAQ9"
FT                   /protein_id="CAC98272.1"
FT                   /translation="MKKVKWSILLFLVLAIFLSAGITYLALNQSSNKESKNNSEKTHKM
FT                   TIALVNEDQGDNFQGKQVEFGNQFVKSIEKDDTHEWYVVSRGVAESGLKRDVYNMMIVI
FT                   PSDFSEKAMSMTSSAPEKVTISYKVNDVGNSDLKAEAEKTAASVLEDFNSRIIDVYFAS
FT                   ILTTLQEAQDNIGTLVKEEKKYDAIYNKDVNNPLSSYTKQFKTVQDYTGTSKESFQGFQ
FT                   DIMKEFEESLNLSQKENEEHMKNMDAYTKTQEENAPFGAEFTENLSKFDGTLSAEDIRM
FT                   QTAALEQVNAKMTSEFQILENSNSLLSQTQALQSYIAETNARIDAVDAEIMGTLENDFR
FT                   TAVYNDLLRILQENEYSDKLNEIGLKDLTGEDINAGFNKMIVKEIQSLPTYNADQLASI
FT                   GLDEEMYKNVVTLSKEYYSNHRGAFSEGFSFTTDPKTLPTDTLKSDTINRLKSEGVALE
FT                   SSSYTVEGSDYPTEIILTLDENFTFSDVDCLVNGSSNPELVQQNAYGENGIKLSIQALG
FT                   STPAEIKITGKAKLREGVNVPLIGAVNWNATLQQYEKKEYSEMPTIPSELDPTTPDTSL
FT                   IVRKEPVPIKVTAPTYLNETKSSVKAITNTVKDYYKLQALFDLYYGIDASDSGQIPDFS
FT                   NYQVTLENSAKASSYYYIFNKEDVIGSFVNLTTDRFVADYTKKIKAFEKRIDDYKNTMA
FT                   EANSRSEDVTNRLNETTQEAINLNTNLALTLQNLESWREESKGLIEENGVVLEKSGEEA
FT                   TMALQLSSEFAGLLAESESLAGTSEGNLKSAEVVYKTFDAIDKEAKNIQQSGETLVKEA
FT                   STLSDDLSEKLEDDETFQKNFAKVMENSRVGDRQNENLYSFLSSPVDKMNAGTIVAGDK
FT                   SMPYFMILICTILAIFTSYVISHQEKKREQLNEFEKEMSLVFKNIPITFLAICVGIIEG
FT                   LIIGAISGFIFEVGEIGMFLWIGVCVLIMMTLVTAFSYLLRQFNMIGMSIILLVLSLYL
FT                   FLTDAVGLNIDNESIFATFRTFSPLQYMEYLLNGILSAQKDYIIVVYSLIGATVVFTGL
FT                   NLFVWHRSKEKVEEDDSDEI"
FT   regulatory      64129..64134
FT                   /gene="lmo0058"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        64144..64659
FT                   /transl_table=11
FT                   /gene="lmo0058"
FT                   /db_xref="InterPro:IPR018920"
FT                   /db_xref="InterPro:IPR034026"
FT                   /db_xref="UniProtKB/TrEMBL:Q8YAQ8"
FT                   /protein_id="CAC98273.1"
FT                   /translation="MKYKIVALLMLLCFAFAPGVLAADSDSYLENNGKMDIKTDRLQKT
FT                   EEEKTKELEQMEETELDKNGIPLFTDEMDEKIAKEKAAEKAEYDRIKDSLFEEESTSGE
FT                   TVKKTKEKLFTGEYETTAVNTETPTTTETTVEDETKKTKQKTVGGAIAGTLVALAGGIY
FT                   VAARNVFE"
FT   regulatory      64666..64671
FT                   /gene="lmo0059"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        64677..64928
FT                   /transl_table=11
FT                   /gene="lmo0059"
FT                   /note="similar to B. subtilis YukD protein"
FT                   /db_xref="InterPro:IPR014921"
FT                   /db_xref="InterPro:IPR024962"
FT                   /db_xref="UniProtKB/TrEMBL:Q8YAQ7"
FT                   /protein_id="CAC98274.1"
FT                   /translation="MAKNTHMNVTVDFTNWGASKYDLRIPVHQPIKALIINLAETLKID
FT                   YKDLSKCTIKTTNKAILLSDDDKLTNFQIADGDILEIL"
FT   regulatory      64935..64940
FT                   /gene="lmo0060"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        64950..66146
FT                   /transl_table=11
FT                   /gene="lmo0060"
FT                   /note="similar to B. subtilis YukC protein"
FT                   /db_xref="GOA:Q8YAQ6"
FT                   /db_xref="InterPro:IPR018778"
FT                   /db_xref="InterPro:IPR042565"
FT                   /db_xref="UniProtKB/TrEMBL:Q8YAQ6"
FT                   /protein_id="CAC98275.1"
FT                   /translation="MNKTIEMDGTTYDFTYEDLVWSITFPKSKTRAKELAQLELLEKPA
FT                   THFTPAKISSDSDSYTISYEIAPRTYGFEQVRKMGREDKLRALRNIADLGELLNTRYTF
FT                   FLHPDNLIFDINLVPSIVHRGIKNILPPYELTEETFFKQYQCFVIAMFSKKFSFENLYN
FT                   GSLSGARGTQFEKSILDAKTVQDIATILEEAYMKEHAAVQKNMASVPKKKYSTFRGLAV
FT                   GFIIVAILLAIPVSYFAFVKVPLQNDLLTANENFLKTDYDKVITGLENVDPEKMPQSVQ
FT                   YELAYSYVKGEKMSDKKKENIMNTISLKSDAKNLLYWIYNGRGEFSKSLDIAKLLDDPT
FT                   LAMYSLTKQIEQVQSDTTLSGDEKVEKLKTLEESLKEYDEKVNESTTTEDETTNTEAK"
FT   regulatory      66146..66151
FT                   /gene="lmo0061"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        66160..70656
FT                   /transl_table=11
FT                   /gene="lmo0061"
FT                   /note="highly similar to B. subtilis YukA protein"
FT                   /db_xref="GOA:Q8YAQ5"
FT                   /db_xref="InterPro:IPR002543"
FT                   /db_xref="InterPro:IPR022206"
FT                   /db_xref="InterPro:IPR023839"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q8YAQ5"
FT                   /protein_id="CAC98276.1"
FT                   /translation="MNREALLIVSNGQQCHKNHLSPEKVVTIGNTIEHEITYPELAESI
FT                   EVKYDEGSWNAGTTALQANQAVNVENLAFYLCQDLHTQVYDVVTNISVTFGVGIENDVT
FT                   LDDTKSDFILLRDAKEKLFKLQVLNGEVYHNFSLVTEDCVLEPGDQLYTDGVTITIGKE
FT                   DISVLAVKNRVTSKLAPLFAADNSFGEDYPDYHRSPRIIYRAPEEKISMAKPSSKPSKP
FT                   TDGLIKIILPPLIMVAITVMISIFQPRGLYIIMTIAMSAVTITMAILNYIKSRKKYKID
FT                   SKQRVESYDLYLKRKTKELHETSEKQRHALTYHYPDVTELEKMALRVDSRIYEKTMFHH
FT                   DFLTFRVGRGDETSSFSVEFQQEEFSQEKDELVEEAVKIKGQYLSINEVPVATDLMHGP
FT                   VGYIGPRRLVLEQLQMLVMQTSLFHSYYDLQFITIFPEEEKADWDWMRWLPHANMRDVN
FT                   VRGFVYHERSRDQVLNSLYQILKERKQALTEQASKQEKLYFTPHYVVLITDEKLVLDHT
FT                   VMEFFNEDPSELGVSLVFVQDVMESLPEHVKTVVDIRDAKSGNIILEQGDLVNRAFVPD
FT                   HLPADFDKEVISRALAPLNHLQNLKNSIPESVTFLEMYGVERVEELNIAGRWAKNETYK
FT                   SLAVPLGLRGKDDIVQLNLHEKAHGPHGLVAGTTGSGKSEIIQSYIISLGVNFHPYEVA
FT                   FLLIDYKGGGMANLFKNMPHLLGTITNLDGAQSMRALASIKAELQKRQRLFGEHDVNHI
FT                   NQYQKLYKQGKATEPMPHLFLISDEFAELKSEQPEFMKELVSTARIGRSLGIHLILATQ
FT                   KPSGVVDDQIWSNSKFKLALKVQNASDSNEILKTPDAAEITLPGRSYLQVGNNEIYELF
FT                   QSAWSGADYVPDKESTDYIDTTIYAINDLGQYDILTEDLSGLDKKDDLTKLPSELDAVI
FT                   DHIHEYTEASGIEALPRPWLPPLEEQIFLPELHQVITDELWSGEKQPLQATIGFLDIPQ
FT                   MQAQEPLTIDLAKDGHLAVFSSPGYGKSTFLQTITMDLARQHNPERLHIYLLDLGTNGL
FT                   LPLKKLPHVADTIMVDEEIKIGKLIRRLTLELKERKQKLSKYGVASISMYEKASKEEVP
FT                   AILLVIDAFDSVGEAPYKDVFEKLIAQIAREGASVGIHLVMSAVRQNAIRVQMLASIKH
FT                   QIPLFMIEPGESRSIVGKTDLTIEELPGRGLVKLEEPTVFQTALPVCADGTLEIIEKIQ
FT                   AESEAMSSEWNGSRPAPIPMVPEVINMLEYLENKQVQKSLSEGKTPIAVDFEDVLPVNL
FT                   DVQTDGNTLVLTDNADVLERTMVSLTELIGQNMEVDIALYDNSSNRFQQYRNNVNIYAG
FT                   EETAMNSTSEQIVSVLEAREDGWKEIQRASNGEITLKMYVEELRPMYVLLTDSIYAAEQ
FT                   MSLEARKNMVRLIENGPKLGIYFVTGSQTGILYRARDEISGELRKQKTGILLGRISDQN
FT                   ILSLINNIYKEALLAPYEAYYIKQGQYEKIKLIAPNQ"
FT   regulatory      70662..70667
FT                   /gene="lmo0062"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        70676..71071
FT                   /transl_table=11
FT                   /gene="lmo0062"
FT                   /db_xref="UniProtKB/TrEMBL:Q92FP8"
FT                   /protein_id="CAC98277.1"
FT                   /translation="MGLTDFWKTPTEKKRDEYDKLHDYLKDALKKHDEKMAEVKSDLSA
FT                   YKKGMPDMPSKGIPANPFVEKNEKVLEQLEKYIDKEKDKRASLKSAIDTAYRKYLEYKA
FT                   LAIKEEKAEQAKKEKEKKEREERLKNG"
FT   regulatory      71049..71054
FT                   /gene="lmo0063"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        71064..71363
FT                   /transl_table=11
FT                   /gene="lmo0063"
FT                   /db_xref="InterPro:IPR010310"
FT                   /db_xref="UniProtKB/TrEMBL:Q8YAQ4"
FT                   /protein_id="CAC98278.1"
FT                   /translation="MGNVKIDAAKVAEAKKSAAIVEKSLESTHKKCKSVISYVEGASWS
FT                   GKSRDAFLTFMELIEKYHADVKKNYKKQKKALTALEDYVEDFENTSYSKDVKRL"
FT   regulatory      71344..71349
FT                   /gene="lmo0064"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        71360..72061
FT                   /transl_table=11
FT                   /gene="lmo0064"
FT                   /db_xref="InterPro:IPR031682"
FT                   /db_xref="UniProtKB/TrEMBL:Q8YAQ3"
FT                   /protein_id="CAC98279.1"
FT                   /translation="MTVETIDVFSPVELYLLLSPIEAQHLFGVPDKLTFLLKGEDVFAE
FT                   GFDRLKSKGILNEAGELTDGGGFLIDSLIEYYQSKKYVRMNQLMFAFLEKTPNELLVMI
FT                   EITPQKEYRFERMNKIYALEMIKDFFPLIRREPGERETEFLKEELTNEERKRATAFDPE
FT                   KNFISMEFFHVDEEPKEKNNAKYYKQYLAFEMEDKLMMVDVVNDTYYRGSQYALLKLLF
FT                   DELEFPYEEAK"
FT   regulatory      72048..72053
FT                   /gene="lmo0065"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        72062..72394
FT                   /transl_table=11
FT                   /gene="lmo0065"
FT                   /db_xref="UniProtKB/TrEMBL:Q8YAQ2"
FT                   /protein_id="CAC98280.1"
FT                   /translation="MAQQTMGGAGAASTIDINPDEMTHIAKELLAIANEFEGVIKPAVN
FT                   QLKANKYLTKGKAKKAMDKVPKANERVMELQDQYNMASSVVFDILQTMVDADRDIAEKI
FT                   IAALEV"
FT   regulatory      72394..72399
FT                   /gene="lmo0066"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        72408..74222
FT                   /transl_table=11
FT                   /gene="lmo0066"
FT                   /note="similar to toxin components"
FT                   /db_xref="GOA:Q8YAQ1"
FT                   /db_xref="InterPro:IPR003540"
FT                   /db_xref="UniProtKB/TrEMBL:Q8YAQ1"
FT                   /protein_id="CAC98281.1"
FT                   /translation="MKEVNYREDDWREAKSALAPFAAANWVGGLFNNLEKVSKNMEEAE
FT                   EDVQELDSDHAISFQHTNYRGKYSAIEDDLMVLYKFSCHAGEKMETLVDQPFYEKLDAF
FT                   VDGMQDLSISTYSTTNRIGAKSKQTYTTTSGGSQVIESIKEGATIEDLMNGDNFYANQM
FT                   QLQYRDWQRANPDQDVSKKDFQMGMLHSRAFEYKSIKDEQQEKEFWVNIVATVVIVGVS
FT                   IFCPPAGLALAVGYGSLEAGSAISGKDWVSGRELSTEERALRGGLALLDIVPGVKALST
FT                   GAKAASAGSKLVRVGDNVLAGSKNVGKGTIDNGIQAGKQAMDLRLANAKKVSEAVQKKL
FT                   TKDLDDIGTMAKTIQNKTKETFTLPPREQLAFARGGSIPEQSATGAAAIAAKKKLKDIM
FT                   QNMDNLNVKGGGKDDIIEQNKSLKFTSLEESEKWGIDGFSVWRNSLSSREIQAIRDYTD
FT                   IWHYGNMNGYLRGSVEKLAPDNAERIKNLSSALEKAELPDNIILYRGTSSEILDNFLDL
FT                   KNLNYQNLVGKTIEEKGFMSTTTISNQTFSGNVTMKINAPKGSKGAYLAHFSETPEEAE
FT                   VLFNIGQKMLIKEVTELNGKIEIIVDLL"
FT   regulatory      74226..74231
FT                   /gene="lmo0067"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        74239..75228
FT                   /transl_table=11
FT                   /gene="lmo0067"
FT                   /note="similar to dinitrogenase reductase ADP-ribosylation
FT                   system"
FT                   /db_xref="InterPro:IPR005502"
FT                   /db_xref="InterPro:IPR036705"
FT                   /db_xref="UniProtKB/TrEMBL:Q8YAQ0"
FT                   /protein_id="CAC98282.1"
FT                   /translation="MRGQEEIDKEQYQVLFIKERLIPCVLGAVIGDCLGVPVEFKDREY
FT                   LKQNPIVEMIGYGTYNQPKGTWSDDSSLTFALMESLISGYDINRIVNNMVSFMDDGFWT
FT                   PYGEVFDIGSVTRESLNRYKNGVSVFECGGKDNFDNGNGAIMRIMPLVFYLGKDFSFGK
FT                   KNKITEEVTRITHAHPRSILGSYVYIELLQNLFANMDKKLAYEEMQNYIRKNYSDYPFK
FT                   DELQYYNNILEGNLYELKESNIKSSGYVVDTLEASIWAFLTTNSYKEAVLKAVNLGGDT
FT                   DTIAFITGSLAGIYYKMEQIPVNWIDQIAKKEDILNLCNRFIESLIKQ"
FT   regulatory      75328..75333
FT                   /gene="lmo0068"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        75342..75665
FT                   /transl_table=11
FT                   /gene="lmo0068"
FT                   /db_xref="InterPro:IPR028954"
FT                   /db_xref="UniProtKB/TrEMBL:Q8YAP9"
FT                   /protein_id="CAC98283.1"
FT                   /translation="MIDELKKYKKIIEDAVDLLGYTPLRYAIFEGEKNNRIEYQVRIEY
FT                   IENHYEVYTTGERASISGKKQFENFFEAYHNFLFKLQLSILQNRRRVRDGEPPEYFCAL
FT                   WEK"
FT   CDS_pept        75832..76125
FT                   /transl_table=11
FT                   /gene="lmo0069"
FT                   /db_xref="UniProtKB/TrEMBL:Q8YAP8"
FT                   /protein_id="CAC98284.1"
FT                   /translation="MTVTSNINSELADGFQGYTDVRKITVNSTVDVGVSGSLTAVLGQV
FT                   GSSFGLPGAIGGLGVGLVLDTILSLNGTKDTWKNSINEKMQDLEDWFRVEAK"
FT   regulatory      76249..76254
FT                   /gene="lmo0070"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        76262..76984
FT                   /transl_table=11
FT                   /gene="lmo0070"
FT                   /db_xref="GOA:Q8YAP7"
FT                   /db_xref="UniProtKB/TrEMBL:Q8YAP7"
FT                   /protein_id="CAC98285.1"
FT                   /translation="MKKNLEQIYAIEFTMGLRYRPMQIRHNIKLIFLLLLFVTWLQGDF
FT                   MNRLPGNLDITKVDMPLVLLALLCYIILYPQKMTIRFQNLQYLLYICCFQFLVFMVIRY
FT                   FYSNLIYGIQNMVSLTAQTLVASYVFLLVLWILALIFFYFHFRKKLRNGDYRKDSELQK
FT                   KRSNLGLKLSKGSYILIGAFFVFILSSQIVGGIMVDIMIISIEIVGIALCSMGIVIFPE
FT                   QLFTAYCKFKFKEFHIEE"
FT   CDS_pept        77149..77406
FT                   /transl_table=11
FT                   /gene="lmo0071"
FT                   /db_xref="InterPro:IPR031664"
FT                   /db_xref="UniProtKB/TrEMBL:Q8YAP6"
FT                   /protein_id="CAC98286.1"
FT                   /translation="MAEVDKSTIGEVEGVTFQSYFLIKNMLHTRVVGDLEKRLPVTLEK
FT                   MVEYVESNRKEIITPIFIVLNYVGNVPYVDVYVGIDPYDE"
FT   CDS_pept        77863..78066
FT                   /transl_table=11
FT                   /gene="lmo0072"
FT                   /note="Hypothetical"
FT                   /db_xref="UniProtKB/TrEMBL:Q8YAP5"
FT                   /protein_id="CAC98287.1"
FT                   /translation="MKLPPEADYLNDETLEVYENDKKKYDQTNQLITNNSVTILLGDFC
FT                   YYESAWSSRWRDNRFWIGSKVS"
FT   regulatory      78077..78082
FT                   /gene="lmo0073"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        78090..78374
FT                   /transl_table=11
FT                   /gene="lmo0073"
FT                   /db_xref="GOA:Q8YAP4"
FT                   /db_xref="UniProtKB/TrEMBL:Q8YAP4"
FT                   /protein_id="CAC98288.1"
FT                   /translation="MKIDLEQIYILDFTMGLRFHPLIIRKNLPLLYVAFIFLIWIQGVV
FT                   MAGLPGDFDTTELDVLLAAIPALPLLILYPKKMAMKFQNVQYLLYVCFN"
FT   CDS_pept        78362..78811
FT                   /transl_table=11
FT                   /gene="lmo0074"
FT                   /db_xref="GOA:Q8YAP3"
FT                   /db_xref="UniProtKB/TrEMBL:Q8YAP3"
FT                   /protein_id="CAC98289.1"
FT                   /translation="MFQLMIFMIIRVFYFAIFYLLENEILVTAQFITNAYITLCIIWVI
FT                   SFAIFSFRFKKKLDKGGYRKDSKLQQKRSNLGLNLSKGTYFLILGSFGLFILIRMLIGG
FT                   ELEEIIISLFLIVCILIGIAGVSLFPEHLFTAYCKFNFKEFHIEE"
FT   regulatory      79033..79038
FT                   /gene="lmo0075"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        79047..79820
FT                   /transl_table=11
FT                   /gene="lmo0075"
FT                   /note="similar to carboxyphosphonoenolpyruvate
FT                   phosphonomutase"
FT                   /db_xref="GOA:Q8YAP2"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR039556"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:Q8YAP2"
FT                   /protein_id="CAC98290.1"
FT                   /translation="MTKNFKKLKSLHELPTPLILYNCWDVASARAIQQGGAPVIATSSY
FT                   AIAESLGAVDGEHLTFDEMFSVISRIAENVSLPLTVDIETGYARNLEELAQNVERLLAI
FT                   GVCGVNLEDQLIGVTNPGLCSTEEQCDKIKTIKETAAKMSTEIFINARTDVFFQGRDEA
FT                   VDLVEEAISRANAYKEAGADAIFIPGLLSPNLIRAFVEKSPLPVNVMRMDGMLSNEDLQ
FT                   KIGVKRISYGPFSFFQANLAIQQEVERIFEGGKAL"
FT   regulatory      79802..79807
FT                   /gene="lmo0076"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        79817..80869
FT                   /transl_table=11
FT                   /gene="lmo0076"
FT                   /note="similar to E. coli Ada protein (O6-methylguanine-DNA
FT                   methyltransferase)"
FT                   /db_xref="GOA:Q8YAP1"
FT                   /db_xref="InterPro:IPR001497"
FT                   /db_xref="InterPro:IPR004026"
FT                   /db_xref="InterPro:IPR014048"
FT                   /db_xref="InterPro:IPR016221"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR035451"
FT                   /db_xref="InterPro:IPR036217"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036631"
FT                   /db_xref="UniProtKB/TrEMBL:Q8YAP1"
FT                   /protein_id="CAC98291.1"
FT                   /translation="MITNQRDIDKYYDMLVEKNSNYEGVFFVGVKTTGILCRPTCPAKK
FT                   PLKENCEFFSTAKEALLASYRPCKRCEPLSNPTKLSPAVKLLVDAIEKNPEKKWTDKDF
FT                   DDLSISANTARRQFKKQFGMTFIEYARSRRLGLAFKHIRGGNSIINAQLDSGYESGNGF
FT                   RDAFSKTMGEVPHKSKDITILYSAWLETKLGSMLAISDDDSLLLLEFVDRKGLETEIKK
FT                   LRMRLNAAITPEKTIIIQQIEAELAQYFNGELIDFKTPIRYIGSDFQENVWEELRRIPI
FT                   GETISYKGLAEKLGRSTASRAVARANGANQLSLIVPCHRVINTNGALGGYGGGLARKEW
FT                   LIKHEKMVPK"
FT   regulatory      complement(80850..80885)
FT                   /gene="lmo0077"
FT                   /regulatory_class="terminator"
FT   regulatory      80854..80891
FT                   /gene="lmo0076"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(80892..81530)
FT                   /transl_table=11
FT                   /gene="lmo0077"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="InterPro:IPR001646"
FT                   /db_xref="UniProtKB/TrEMBL:Q8YAP0"
FT                   /protein_id="CAC98292.1"
FT                   /translation="MKKITAPRIPDGDLTVYPNDTYFIEDIGEVSEQIFRKTTLTGEIF
FT                   EHFHLETIIFDGCVFDSVSLVSANLTDVVFKNCDLSNLDLMGAIIHRVRFENCKLIGMN
FT                   FSDATLRNCVFVDCYADYVAFRYANLKWVAFEAGAYTNSDFSGAQLVDTYLERLDLNKA
FT                   QFLNCALNGIDLSSCIFESITAMPQDLKGMSIDFSHAPALMPLFGIRVK"
FT   regulatory      complement(81539..81544)
FT                   /gene="lmo0077"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      81648..81653
FT                   /gene="lmo0078"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        81661..82617
FT                   /transl_table=11
FT                   /gene="lmo0078"
FT                   /note="similar to phosphoglycerate dehydrogenase"
FT                   /db_xref="GOA:Q8YAN9"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR029753"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q8YAN9"
FT                   /protein_id="CAC98293.1"
FT                   /translation="MTASVFVAGKLLPETMEALSKWDVKAFSGEENITEAELINNVTEV
FT                   DAIICPLSSPISAKVLESAKNLKIVANIGAGFDNIDVKKAQELGIAVTNTPDVSTEATA
FT                   ELTLGLILDVARRISEGDRLCRETPEQFKGWAPTFFLGTELSGKTLGIIGLGRIGQAVA
FT                   KRAAAFGMNIIYSGHQPKEAAKEWNAEFVSQKELLKRSDVVTIHAAYSPSLKHLLNETT
FT                   LKTMKSSAFLINAARGPVVEEAALIKALETGVIAGAALDVFEFEPKIGEDFAKLDNVVL
FT                   TPHIGNATVETRAAMGKIAIANVEAVLAGKAPLHSVY"
FT   regulatory      82630..82654
FT                   /gene="lmo0078"
FT                   /regulatory_class="terminator"
FT   tRNA            82705..82777
FT                   /product="transfert RNA-Lys"
FT                   /note="tRNAscan-SE vs 1.3 result - Cove score = 78.43"
FT   regulatory      82946..82951
FT                   /gene="lmo0079"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        82959..84437
FT                   /transl_table=11
FT                   /gene="lmo0079"
FT                   /db_xref="InterPro:IPR006829"
FT                   /db_xref="UniProtKB/TrEMBL:Q8YAN8"
FT                   /protein_id="CAC98294.1"
FT                   /translation="MSRIDIGEIQAFLYQLRATNEPGRKTIQSIKAAVTKYVGDNSLKG
FT                   KAVDASKNYYQMTYFPLCDAIIEAMDESEERLGQYIQDFHAEVDSSPDAKIDADGLYEL
FT                   GKMIDRIESKKEALAQRMNSGTEGQMQNYRSQLAIAYKQENILEKYLSFEQSHANFFDH
FT                   LIDLVQAVQQTIRELQSNIQFNSQTGTYDLSKLNSATVSRMQQALNKSRGIKEDIIKEL
FT                   RDYTVLAVVYLDSNGKEQVMWLLERDGVGVENAELKAYLTENGKYLNPEDYTIITNEEL
FT                   NKKINQSWRDGVYYLNGNKYDGLTGGVLSTSAYVEAGKGYIDKSGFADVVLGLGLSTAA
FT                   IRGSLVYKKVNGPYKQNIKNRYPNEVQQGKIFDYTLENGQVKIRDGIKEVDFIIDLQGN
FT                   LKVGRGHAHLSNGGDVQAAGKLKVDSNGNVRRITNESGHYTPTLGQAKNYQQIFENTGI
FT                   NTKNAWLETYQLDVTKSGYVDLAKLKRIDSVKLK"
FT   regulatory      84438..84443
FT                   /gene="lmo0080"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        84451..84849
FT                   /transl_table=11
FT                   /gene="lmo0080"
FT                   /db_xref="UniProtKB/TrEMBL:Q8YAN7"
FT                   /protein_id="CAC98295.1"
FT                   /translation="MSKTTQMNSEIFQINLEKTLKEIMVAKGLQSDEIRFVIVPVEEKG
FT                   KMLDGSDEMMKRLVLTKENIGNKQLVLKDVVDVLGGLFPKAPIWINVSFLEMNGEKAIF
FT                   KLETSLRFRKPTLLRNAETGHAPFKAIT"
FT   regulatory      85009..85014
FT                   /gene="lmo0081"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        85025..85627
FT                   /transl_table=11
FT                   /gene="lmo0081"
FT                   /db_xref="UniProtKB/TrEMBL:Q8YAN6"
FT                   /protein_id="CAC98296.1"
FT                   /translation="MFKTIVDTLIAQRRDRKIKESERRQENYRAKRENLTEVYRSLILI
FT                   VNLFPNESPTDIIKNIKYGPYYSLENYNGIFRTLDYKIEDYEKRKSFSNLDYEEKNDID
FT                   IEISNIEYAKDKLARNRKSYQKAVKCFNQFKDSDKAIFDLYAGTHVQNCLVNFEITINN
FT                   VFISGMSVGIPDSPYENSIKIASRKLISAMKKDIGIT"
FT   regulatory      85892..85897
FT                   /gene="lmo0082"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        85902..86228
FT                   /transl_table=11
FT                   /gene="lmo0082"
FT                   /db_xref="GOA:Q8YAN5"
FT                   /db_xref="UniProtKB/TrEMBL:Q8YAN5"
FT                   /protein_id="CAC98297.1"
FT                   /translation="MKKLKQLTNQLFTSTIFLVTMLFIIPPTFAIADGSKVSFYEYIYG
FT                   APLRWLTVISTTEKKGAFLEMFFSENEGINIQWLNLIINFLLVFLVITIIFSLAKKFYN
FT                   KKNA"
FT   regulatory      complement(86222..86253)
FT                   /gene="lmo0083"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(86323..86691)
FT                   /transl_table=11
FT                   /gene="lmo0083"
FT                   /note="similar to transcription regulator (merR family)"
FT                   /db_xref="GOA:Q8YAN4"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="UniProtKB/TrEMBL:Q8YAN4"
FT                   /protein_id="CAC98298.1"
FT                   /translation="MSFSIGEFSELVGIPSSTLRFYEKEGLITPDRDKNNLRTYSEEDA
FT                   NWLKFLLHLKGAGLSIEELKQYTIWRTAGDSTISERLNMLKEKKIVLEQEIENLQKDLD
FT                   TVVRKIGIYEEKVAKLDV"
FT   regulatory      complement(86699..86704)
FT                   /gene="lmo0083"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(86747..87730)
FT                   /transl_table=11
FT                   /gene="lmo0084"
FT                   /note="similar to oxidoreductases"
FT                   /db_xref="GOA:Q8YAN3"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:Q8YAN3"
FT                   /protein_id="CAC98299.1"
FT                   /translation="MKKRQLGNAGLVTSELGFGCMGLNYHRGPAKDRNEMIEVVRTAMD
FT                   AGITMFDTAEVYGPYTNEELVGEALVGKRNHVQIATKGGFKINGLNNEVDSRPESIKAA
FT                   VEGSLKRLKTDYIDLYYIHRIDPSIPIEEVAGTIQNLKQEGKILHWGLSEASAKTIRRA
FT                   HKVEPLAAVESEYSIWWREAEKEVFPVLEELGIGLVAYSPLGRGYLTGKLDINADFNAN
FT                   DNRGGLPRFQKEAMEANQVLLDFMKEIADEQNVTTAQLALAWILDQKPWIVPIPGTTRP
FT                   SRIEENIASTEIHFDDGARQKIADALSQIEIVGDRYSAAENKRIGK"
FT   regulatory      complement(87739..87744)
FT                   /gene="lmo0084"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      88106..88111
FT                   /gene="lmo0085"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        88121..88810
FT                   /transl_table=11
FT                   /gene="lmo0085"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q8YAN2"
FT                   /protein_id="CAC98300.1"
FT                   /translation="MKYIDYHDYMHKDAIIYAYLQNNFPYIRKRIKAWESFTLDREDIL
FT                   LVKSGAIFEEVNGKKKGIARCFFSKSLIFPTRDPIVLKAFETSEICFINAERAFGKLEE
FT                   DQILSNFFLQIAEKNEEDMRRQAFLGTENSKNKIISTLNFLLENNKSNSKTPIFPIWLQ
FT                   INVLAKLANCSISTISSTVNELHAEGILDIKSSPWKLKGKEKKIEILENENQKMKLNER
FT                   KHKSNVF"
FT   regulatory      88873..88878
FT                   /gene="lmo0086"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        88888..94767
FT                   /transl_table=11
FT                   /gene="lmo0086"
FT                   /db_xref="UniProtKB/TrEMBL:Q8YAN1"
FT                   /protein_id="CAC98301.1"
FT                   /translation="MKKNILVVIIVSVLAISAIVSAFFLMRDDAYAIETEGFTYSPKGK
FT                   VVDFSSEAKYNDTWINNEKTITDKKEMKPINLARTLFLKDGRIQFLGKSVAVKSASDLI
FT                   ELPSKTSITESKGSYKAKSDSNKTLAQLPKGTVVKLAEGRYIILDNAYLKNKQGLNKKL
FT                   PKNVLVSIDENKKVMLMGDKTIEELGGDDAYIEMENNHYHFDLKKEMLVSQTAKETDID
FT                   IRSIKVEIDDNAEKRSLKTAKETEKETTKDSTEKESEKQSNDASGQKSAQNNERSESKD
FT                   DQTQDASGNNTNGSANNNTARSNGTGGSNSDTNGSQPGGTQNKPNEGDVNKANEIIKKL
FT                   NEAENTNTFQVPIVDVNLTVKGQVAAAKLKLTDSSKRLNSLEAILYDSKNNIVKKEKLN
FT                   STKANQNFTFNNLKYGETYQVVVQGSYKSASNKNQDTIFFRQTVEAKPVVLTPKVTERG
FT                   EDYMKAELTATELYGHIDKLVLKIKENNSNVITSQKVTVDASQLTKDGQVEVKFNSLSS
FT                   DKEYIIEMEELIVDGKNVTDDGWYFISSTLKAKPTIEGLNLSYSTDKGEFVASPVNLVD
FT                   RDESITSIRYVAYLEDDYKVNGSNAKEYAYSVVDANQKKTAVKVGRTVDMNDGNYIFVG
FT                   YISGNNGQSDYTFATPASNSVVVGKKTKPTVEFSLKEAEQDKLTINYEVFDADNTLLFD
FT                   NLTHPTLKLYKSDAQGMYSGNPVATVDLTKKSDITNLLEFDGLESEAYYVVVMTGSYNL
FT                   DDGAGIMVDELIGQSSVFRTTEITKVNASFSLDSVDTTKVAINVKLSDAAVNLNDANLK
FT                   IYEKKTNTLVKTVPLHGDFEKLMSDSGNSYLFENLSINKEYLVKVEDGYDSGMNHVPVE
FT                   GQFIFKTKKESPETDKVLLDYKASEMKLGGLAGIAATEKPLIDDYNAVSSITYSIYKAD
FT                   DLNTPLVEQEVSTAADFEKNVYFDLTNKLLGRGYSYVIKADVVWNDNYEDHHIEISSDT
FT                   IQIKKEKPTVEYEILSRTASEIKLNVYVEDEEESIVPGTLEITSTTGGNEQLQSGKNNV
FT                   TLPLSSEGTTTIKTTGDYIITSGSSAISDIFMTKQLAALNTTTPQVGAKIAMDASGKSM
FT                   TIAPEPNAVAKTSVMRTKYDLKDAASSKPDYSITKSGPNQFNTQNLNLPLGNIWFDNSY
FT                   QLTLDMKMNYTENKIDNQNLANNYYLSIGNGASFVSSLSGAVSTTNNVNSADVFKVTKA
FT                   STDLEGNISGVTFKNIWTDKYIAYRNGILISNSETPDSFKLIRQADGSYVPELSGRYVN
FT                   FSVGLVTDEAAGSKIDLYSTQEKLEQVSEAISVKALEEPAISAENIGVYDKRVKLDVIG
FT                   EDKDNTTVKKANKNELFVNVYKADGTTLVNSIRVDGLPTRDVSVTELSPDTDYVVKVEG
FT                   KYDLLDGNGEKDKVYYSETIKTEKSLPSMTSTDYSWSPAYGQRAIKGKIDFADESSVLT
FT                   NIEYRLYDAATISSSLSNLVALEQELGNKTPVSTFDNMTNNPEFSIYNGSGTQNFVSGK
FT                   TYVIAAYMKTSLTRAPIFLSDAKAVYISPPSNVSAPITLENVSTREATLKFSYNDPQSY
FT                   FVGGTNKDFQYVLKNTTTGTEVKKGSFQGGNTASWINTFEDLEPATGYTLTISTQYDNL
FT                   NGGLVRAWNTSFNFTTDDEYVTSNSLTIQLDAGAKAVKLQAKEVRPGSTTIENIKMEFY
FT                   ELIDYGGNNERTQLVETKNITLPSSYPATIAADFNVAGKKKNQSFLGKMIVTYRTPTNE
FT                   VKTYEKTSNFITLQEDIAAGLKSFKSVRATNDALEVKLDIPQDNSTDKGSYTYELKNEN
FT                   GDVIDTEKVAAEDISKTVSLSMEPTSNYTLTVINPDNQPVALYQGNNEENNLKAEIKKD
FT                   SFTLMSNNTADAKTTMTVTVEPKELTAWQTVQSWFGKDFTETYNIQKDELDTGVKIDTN
FT                   YQDTKVTVEETKSGKNFGIIELEESK"
FT   regulatory      94751..94756
FT                   /gene="lmo0087"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        94764..97070
FT                   /transl_table=11
FT                   /gene="lmo0087"
FT                   /db_xref="GOA:Q8YAN0"
FT                   /db_xref="UniProtKB/TrEMBL:Q8YAN0"
FT                   /protein_id="CAC98302.1"
FT                   /translation="MKPTWKIGIIVAAVPLIIIAVVLWGSFKEARYNLVSLPDDGVVLN
FT                   NEQETLQFQKGNTLYRSWNSDQLIAKNDKEDTRNEIMESTILYLNKEALMFTKSVPVID
FT                   TNGVSSKLKGRQVYQQTNSSYKYKNSEIVENSIVKLANRQYYLNADATLYLGGKEIKKV
FT                   TKPLLLIDKTGSVTIYENKKKSRFLGHMTLKVNDKTVLDASNETYTVGERKIDLASFGG
FT                   TDNEKIVVKEDEKKEDKKKTAESAKKTASNTSQSENESNQTTKGTGNQLNATKKYGNNL
FT                   NVGNGTSDSEPNDGKDTKNNGSGSNANGGTNQSGLNEIDDYEAVLRKIEDLNKKLERNI
FT                   PVLRIGYIAPGVTSVKVSYNYADPNNTLIGVTKISAVDEKTGKTVNTQYVSAVDTEATL
FT                   KGLSPNGKYHLEFTYQYDLGTNKGIQEVKMQSDSFTTQTVAAIYQMQSVTSTTMKVNIA
FT                   LDAQIDDVKRARIKVTKSDGDFFYMNVSANFLNGNGEILNATGLKPSTAYQFQTVIEMK
FT                   NGETIELNSSEKYYTMQATVLKNLKASQSVNKVLQVQYDWSSADYTLNQAIIELEDEED
FT                   NTEVDYQIVNQEKGNIHLVPDTKSELINLKAKLVLKTTNNNTKESKTFEYPVKQEIEYD
FT                   KQAKLTMDLTPFQTEENSEAQTEKQDVVAEKETNGNDLTAKMEDVLAPQNATYDMSFSM
FT                   QRKALETYQLAFERKIAGIDDDNWTMWKSQQVTTDEAGQVKVTETISKLAKDSFDYRVA
FT                   VYDAQGALQLYVYQK"
FT   regulatory      97113..97118
FT                   /gene="lmo0088"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        97127..97369
FT                   /transl_table=11
FT                   /gene="lmo0088"
FT                   /note="similar to ATP synthase C chain"
FT                   /db_xref="GOA:Q92FH2"
FT                   /db_xref="InterPro:IPR000454"
FT                   /db_xref="InterPro:IPR002379"
FT                   /db_xref="InterPro:IPR035921"
FT                   /db_xref="InterPro:IPR038662"
FT                   /db_xref="UniProtKB/TrEMBL:Q92FH2"
FT                   /protein_id="CAC98303.1"
FT                   /translation="MDLVVACSVIGAALAIGLATLGAAIGQGIAVSRATEIIGKNPNAK
FT                   KEVMGGLFLGLLMIVALMLFALAIAVILLWVNPFI"
FT   regulatory      97368..97373
FT                   /gene="lmo0089"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        97381..98412
FT                   /transl_table=11
FT                   /gene="lmo0089"
FT                   /note="weakly similar to ATP synthase delta chain"
FT                   /db_xref="GOA:Q8YAM9"
FT                   /db_xref="InterPro:IPR000711"
FT                   /db_xref="UniProtKB/TrEMBL:Q8YAM9"
FT                   /protein_id="CAC98304.1"
FT                   /translation="MEKMIQTIILYSVFAVGFLYLLHFTLRKLENILTSFFYEVSQDQS
FT                   LEKESLLRRLKRQKVATTQEEQKNRQLAIESEQKEVLFLEEIDQLIAQNKSYEQQLQAW
FT                   ENEQPKQIIEVPTFETTPHAPYKSLSSYINEIFQQVFIESEEDEARLFTEAIREFDALV
FT                   RTEKIRCALPYKVILHLFEMYSPEQLHLFAQSFQRYSERSSKLPVKQIYQSSYLSPEQK
FT                   LKVMQEEGTLDELDAEFIQFLFYMMTHYSYRQTRNLYRNFLEVYNIHFYRGLICIHVAS
FT                   KGSANHFEKLWQPAHRSYKIEYQVQKELIGGVIIQYGSKSIDMSYQELIKRSTEKMEAE
FT                   VKL"
FT   regulatory      98396..98401
FT                   /gene="lmo0090"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        98409..99905
FT                   /transl_table=11
FT                   /gene="lmo0090"
FT                   /note="similar to ATP synthase alpha chain"
FT                   /db_xref="GOA:Q8YAM8"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR000793"
FT                   /db_xref="InterPro:IPR005294"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR023366"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036121"
FT                   /db_xref="InterPro:IPR038376"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8YAM8"
FT                   /protein_id="CAC98305.1"
FT                   /translation="MKTIHFDMNKYETHVDLEYLKEHGRVEKISDGVIFCSGLENAALH
FT                   QAVLIDERHRGVILELNEEFVGIGLIDKTNDILEGMHVGVSGKFIEVDLFEEMAGRIID
FT                   TTGKMLYEESEEKPTATSPLFCVTPAIMTIDSVTRPLNTGLAVIDSITPIGRGQRQLIL
FT                   GNRQSGKTQIAVDTIINQHDQNVHCIYVAIGLKAAYIAEVIETLRNHGAMEYSTVVATA
FT                   ASDSLTAQYLTPYAGMALAEALRDQGKDVLIILDDLTKHADAYRAITLLFNRPPGREAY
FT                   PGDSFYIHSSLLERAVQMNEEHGGGSITAIPMIETLSDDVTAYIPTNVISITDGQLFLK
FT                   SDLFNRGQKPAVDVGVSVSRIGGDAQHPIIRKLSKNLTLILSQFEELKELLDFGNALDD
FT                   GSMKMVSDGRLLTELFKQKILSPLSVTELIVILYAFQNGFLTKIPPANIQTFKGLLLEK
FT                   AHMHKDFESFSAQIEAINELNESHVEMLEEIIRETGRLFS"
FT   regulatory      99888..99893
FT                   /gene="lmo0091"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        99902..100771
FT                   /transl_table=11
FT                   /gene="lmo0091"
FT                   /note="similar to ATP synthase gamma chain"
FT                   /db_xref="GOA:Q8YAM7"
FT                   /db_xref="InterPro:IPR000131"
FT                   /db_xref="InterPro:IPR035968"
FT                   /db_xref="UniProtKB/TrEMBL:Q8YAM7"
FT                   /protein_id="CAC98306.1"
FT                   /translation="MSSIDQARKTIKALNSTYKIVHVTELATLGKLSALREKAEAAVSY
FT                   YETILKSLRWVRKTMYTSNNQIKEEKNVTAIAITSERGLCGAYNSEVFAEIDQLIESLG
FT                   DQVTINWVVVGEQGHRYLTKLGQNITSYLQFSLENIDLETTTAVTADFIDLIHSEQMDA
FT                   LYVIFTKYLNAVQSEAMCEKIYPEIPEDSDTELIEVDYVLDFETDDEQVEQLLLENYLC
FT                   GLLYSMFRYSVASEYCMRRIAMKQAKDNIQKQLEEAIFDARKQALQQKTGELLDIISGA
FT                   QTIRKDEE"
FT   regulatory      100758..100763
FT                   /gene="lmo0092"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        100772..102142
FT                   /transl_table=11
FT                   /gene="lmo0092"
FT                   /note="similar to ATP synthase beta chain"
FT                   /db_xref="GOA:Q8YAM6"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005722"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR024034"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036121"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8YAM6"
FT                   /protein_id="CAC98307.1"
FT                   /translation="MKKHTGTIISISGFVLRIEFNESELPEIGFALEYHTHQGTYLAEV
FT                   VQHTGINTVSAIAIGEVSGLARGTEVVNLGHPIEVPVGETVQGRMLNVYGKAIDGKPEP
FT                   AAEVKWPIFRAQPLLRELDTNKEILYTGIKVIDLICPILKGGKTGLFGGAGVGKSVLMQ
FT                   ELINNISMLGGNSVFTGVGERVREGIGLYKELEASGVLPQTTVVLGQMNESPGVRMRVA
FT                   LTGLTIAEYLRDEEKKDVLLFIDNVFRFIQAGSEVSSLQGKIPITGGYQSTLSKEVGDF
FT                   QDRIASTKNGSITSIQCVFLPADDIDDPSAVATFSHLDSTIVLERSIAALGIFPAVNPL
FT                   QSFSRALNPTFVGERHYQLAVQVKFILQRYMELQEIINVLGMAELSDEDRKLVHRARKI
FT                   RNFLSQPFYVSEKFTGTEGTFVEIEDLLGSIERILNGDYDERSERDFLFIGSYKDLK"
FT   regulatory      102141..102146
FT                   /gene="lmo0093"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        102155..102478
FT                   /transl_table=11
FT                   /gene="lmo0093"
FT                   /note="similar to ATP synthase epsilon chain"
FT                   /db_xref="GOA:Q8YAM5"
FT                   /db_xref="InterPro:IPR020546"
FT                   /db_xref="InterPro:IPR036771"
FT                   /db_xref="UniProtKB/TrEMBL:Q8YAM5"
FT                   /protein_id="CAC98308.1"
FT                   /translation="MKLKIVSPMGQFFEGEVEGFVINTKEGQQTVLEEHIDCLSFFDYS
FT                   EISILDAVASDPIFVALGYLHLVQNEANIMAQFASADAEQAERIFERLNKRKQTESRRS
FT                   NDK"
FT   regulatory      102455..102460
FT                   /gene="lmo0094"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        102468..103028
FT                   /transl_table=11
FT                   /gene="lmo0094"
FT                   /db_xref="GOA:Q8YAM4"
FT                   /db_xref="UniProtKB/TrEMBL:Q8YAM4"
FT                   /protein_id="CAC98309.1"
FT                   /translation="MTSEFFSTLLLIIGLLIGFFLAILLILAGIRRFFCSAEEPLKRIR
FT                   RYQVWHNRYQFNEEVTSFFTVIGATLLVSLITVQITAIPFQYTVLIFWSSWLFHLLSFW
FT                   KKIRVPKKMKNEMIQLAGFLLITALYFVGYFAMKSLHFSIIHVADFPGVIQFGIRTYLT
FT                   ICSLFVASGALIVWQRIYVKLLK"
FT   regulatory      103065..103094
FT                   /gene="lmo0094"
FT                   /regulatory_class="terminator"
FT   regulatory      103189..103194
FT                   /gene="lmo0095"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        103204..103836
FT                   /transl_table=11
FT                   /gene="lmo0095"
FT                   /db_xref="UniProtKB/TrEMBL:Q8YAM3"
FT                   /protein_id="CAC98310.1"
FT                   /translation="MTFLEFHQLVKEDLLIYSWIIKNFHLTRQKLMAGGEITMNREQVI
FT                   VMEKGLLVQVNEEGKNDLYRVFIDQRIIFTTKGDITLTALEDTSYSIIRTDELIGKLED
FT                   QHLLPTFFLQIAEDFEKGLDWQRTLISVDPAERAEMILVKIIERYEINSENKPEFPRWL
FT                   RINVLARFAKCSVSTMSSVVNELVNEGDLNIKGTPWLLTRPYQASCA"
FT   regulatory      103854..103889
FT                   /gene="lmo0095"
FT                   /regulatory_class="terminator"
FT   regulatory      104121..104126
FT                   /gene="lmo0096"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        104134..105099
FT                   /transl_table=11
FT                   /gene="lmo0096"
FT                   /note="similar to PTS system mannose-specific, factor IIAB"
FT                   /db_xref="GOA:Q8YAM2"
FT                   /db_xref="InterPro:IPR004701"
FT                   /db_xref="InterPro:IPR004720"
FT                   /db_xref="InterPro:IPR013789"
FT                   /db_xref="InterPro:IPR033887"
FT                   /db_xref="InterPro:IPR036662"
FT                   /db_xref="InterPro:IPR036667"
FT                   /db_xref="UniProtKB/TrEMBL:Q8YAM2"
FT                   /protein_id="CAC98311.1"
FT                   /translation="MVGIILATHGEFAEGILQSGTMIFGEQENVKAITLMPSEGPEDIK
FT                   AKMEAAIASFDSQDEVLFLVDLWGGTPFNQANGLYELHKDKWAIVAGLNLPMLIEAFSS
FT                   RFTMESAHEIAANILAPAQEGVRVKPEELQPQVTATEQPQAEIAAVGDGKIEFVLTRVD
FT                   SRLLHGQVATAWTKATHPTRIIVVSDAVAKDDLRKKLIEQAAPPGVKANVIPVQKMIEI
FT                   SKDPRFGNTKALLLFENPQDVLRAIEGGVEIEQVNVGSMAHSVGKVVVSKVLSMGKDDV
FT                   ETFEKLKEKGVKFDVRKVPNDSSANMEDIIKKAKHELKTQ"
FT   regulatory      105111..105116
FT                   /gene="lmo0097"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        105123..105929
FT                   /transl_table=11
FT                   /gene="lmo0097"
FT                   /note="similar to PTS system mannose-specific, factor IIC"
FT                   /db_xref="GOA:Q8YAM1"
FT                   /db_xref="InterPro:IPR004700"
FT                   /db_xref="UniProtKB/TrEMBL:Q8YAM1"
FT                   /protein_id="CAC98312.1"
FT                   /translation="MSVISIILVVLIAFLAGIEGILDEFQFHQPLIACTLIGLVTGNLT
FT                   ACIILGGTLQMIALGWANIGAAVAPDAALASVASAIILVLGGQGVAGIPSAIAIAIPLA
FT                   VAGLFLTMIVRTLAVPIVHLMDRAAEKGNIRSVEWLHISAICMQGVRIAIPAAALLFIP
FT                   ADSVQSFLEAMPAWLTDGMAIGGGMVVAVGYALVINMMATKEVWPFFVIGFVVAAISQL
FT                   TLIAIGALGVALALIYLNLSKMGGGNSNGGGGGNSRDPLGDILNDY"
FT   regulatory      105937..105942
FT                   /gene="lmo0098"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        105951..106862
FT                   /transl_table=11
FT                   /gene="lmo0098"
FT                   /note="similar to PTS system mannose-specific, factor IID"
FT                   /db_xref="GOA:Q8YAM0"
FT                   /db_xref="InterPro:IPR004704"
FT                   /db_xref="UniProtKB/TrEMBL:Q8YAM0"
FT                   /protein_id="CAC98313.1"
FT                   /translation="MAEKIELSKRDRLRVAWRSTFIQGSWNYERMQNGGWAFSMIPAIK
FT                   KLYKTKEDRSQALKRHLEFFNTHPYIASPILGVTLALEEERANGAEVDDVAIQGVKVGM
FT                   MGPLAGVGDPVFWFTIRPMLGALGASLALSGNILGPILFFVAWNVIRWGFMWYTQEFGY
FT                   KAGSKITDDLSGGLLQDITKGASILGMFVLAALVQRWVNIQFAPIISKVKLDEGAYIDW
FT                   SHLPQGAQGIKTALEQQQAGLALSEIKVTTLQNNLDNLIPGLAAVALTFLCMWLLKKKI
FT                   SPIIIILGLFVVGIVGHLIGLL"
FT   regulatory      106877..106912
FT                   /gene="lmo0098"
FT                   /regulatory_class="terminator"
FT   regulatory      106974..106979
FT                   /gene="lmo0099"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        106988..107377
FT                   /transl_table=11
FT                   /gene="lmo0099"
FT                   /db_xref="InterPro:IPR010360"
FT                   /db_xref="UniProtKB/TrEMBL:Q8YAL9"
FT                   /protein_id="CAC98314.1"
FT                   /translation="MVQSINTKVDLTIDATAYTGLTDYGKIMIGDKGFEFFNSRDVRKF
FT                   VQIPWEEVDQVIVSVMLKGKWIPRYAIKTKRNGTYTFASKRPKEVLRKIRVYVDPANMV
FT                   SSLSFFDVMKRSFRSIFSKKKNKNK"
FT   regulatory      107396..107434
FT                   /gene="lmo0099"
FT                   /regulatory_class="terminator"
FT   regulatory      107484..107489
FT                   /gene="lmo0100"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        107499..107849
FT                   /transl_table=11
FT                   /gene="lmo0100"
FT                   /db_xref="InterPro:IPR014580"
FT                   /db_xref="InterPro:IPR023204"
FT                   /db_xref="UniProtKB/TrEMBL:Q8YAL8"
FT                   /protein_id="CAC98315.1"
FT                   /translation="MKKPRIYTMSFASVYPLYIQKAEKKDRTKEEVDEIIFWLTGYDQD
FT                   SLQQAIDQAIDFETFFAEAPKMNPNASLITGVICGYRVEEIEDKLMQQIRYLDKLVDEL
FT                   AKGKKMEKILRK"
FT   regulatory      complement(107846..107880)
FT                   /gene="lmo0101"
FT                   /regulatory_class="terminator"
FT   regulatory      107857..107891
FT                   /gene="lmo0100"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(107915..108208)
FT                   /transl_table=11
FT                   /gene="lmo0101"
FT                   /note="similar to transcription regulator"
FT                   /db_xref="GOA:Q8YAL7"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q8YAL7"
FT                   /protein_id="CAC98316.1"
FT                   /translation="MKKLNELSKSDLLLIFQALSDPIRLDIFLCLLKSKEKRFSGTTYN
FT                   ISKSTMSHHIKLLKEAKLINLRKEGTTHIYSVNQELVSLISHFFEECGEKDE"
FT   regulatory      108304..108309
FT                   /gene="lmo0102"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        108320..108610
FT                   /transl_table=11
FT                   /gene="lmo0102"
FT                   /db_xref="InterPro:IPR007138"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:Q8YAL6"
FT                   /protein_id="CAC98317.1"
FT                   /translation="MLHIEAQITVKKEQTEAFLQAAKEVIAASRAEAGNHGYELVQSTE
FT                   NETVFYMLEKWADMDAIQQHNDSEHFKKFQKAAADFVAKELEISVLTPLAR"
FT   regulatory      108610..108615
FT                   /gene="lmo0103"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        108624..109256
FT                   /transl_table=11
FT                   /gene="lmo0103"
FT                   /note="similar to NADH oxidase"
FT                   /db_xref="GOA:Q8YAL5"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="UniProtKB/TrEMBL:Q8YAL5"
FT                   /protein_id="CAC98318.1"
FT                   /translation="MTYLNNDFEDLMKNRRSIREYDETVKISQEEMKAILEDAVTAPSS
FT                   VNMQPWRFVVVESDAGKEKLSSLVRFNTRQNESSSAMILVFGDLQNFENGEKIYGESVE
FT                   RGLMPAEVKEQQMAKLSQYFASIPRSEAERVVLIDGGIVAMQLMLVARAHGYDTNPIGG
FT                   FERTEVAEAFNMDPERYVPVMIVSIGKAKNSGYQSYRLPITDVTTFA"
FT   regulatory      109264..109299
FT                   /gene="lmo0103"
FT                   /regulatory_class="terminator"
FT   regulatory      109333..109338
FT                   /gene="lmo0104"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        109349..109720
FT                   /transl_table=11
FT                   /gene="lmo0104"
FT                   /db_xref="GOA:Q8YAL4"
FT                   /db_xref="UniProtKB/TrEMBL:Q8YAL4"
FT                   /protein_id="CAC98319.1"
FT                   /translation="MTIKITRKTGIGSGITPVKIRIENEEIVKLDNHQSHFFMPKMEKT
FT                   KVCVTDWFYGSQEAVLENSNDVVVRINRKALLLNYSMFPFLFYGFVMTSLFATLIALGL
FT                   CLVSFFYSRKHWFEFVKIK"
FT   regulatory      109732..109767
FT                   /gene="lmo0104"
FT                   /regulatory_class="terminator"
FT   regulatory      109996..110003
FT                   /gene="lmo0105"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        110013..112283
FT                   /transl_table=11
FT                   /gene="lmo0105"
FT                   /note="highly similar to chitinase B"
FT                   /db_xref="GOA:Q8YAL3"
FT                   /db_xref="InterPro:IPR001223"
FT                   /db_xref="InterPro:IPR003610"
FT                   /db_xref="InterPro:IPR003961"
FT                   /db_xref="InterPro:IPR011583"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR029070"
FT                   /db_xref="InterPro:IPR036116"
FT                   /db_xref="InterPro:IPR036573"
FT                   /db_xref="UniProtKB/TrEMBL:Q8YAL3"
FT                   /protein_id="CAC98320.1"
FT                   /translation="MKKLFSITSVVLLVLSLVVVSIGAEPKRAKAAENVPQYRNVMYYG
FT                   DWSIWGGEGNFYPKDIPADQLTHLNFAFLDFNSNGDLVFTDKDAAVGAPVGQEGVQWGG
FT                   ANAGVLNAIQDLRAQNPNLKIGVSVGGWSKSGDFSTVAADPTKRANFVKNVMKFVKYTN
FT                   MDFVDLDWEYPASVRDADLVDNKNDEGTPNAKPADKQNFITLLQDLRTALDKQGVDINK
FT                   KYELSVALPAAKSTLENGIDVANLFKVVDFANVMTYDLNGAWTPNSAHHTALYGNPKDP
FT                   NYDSGFSVDQTVKYLKEKGAVSNKIVVGAAFYTRGWNKVAAGTDTALPGLFQAAEKTNK
FT                   DADGSLTYGANNENPIKTGDGGRAGGVWAYRSIDALKAKTPTLKEYWDDTAKAPYLYSK
FT                   ETGEFYTYDNTRSIGYKAQYVKDNNLGGMISWMQSQDKTTTSTKRDELTKAIKTGLFGT
FT                   SAIPQNAITYANLNVVATVKPYSENGVGYEITITNNEKADETNEVLKSTELSFETVKLP
FT                   KFYIPVKAGETLTAGDYKAGTVTTSGGNTVVDLASVYDAQQIPQGASYTFRLKSSASSV
FT                   DVANISKIDLTQRMVKSSVEFGKQTIFGGGTVVPDPSDTEAPTVPKALASSNVTDKSAT
FT                   LTWTASTDNKAVAGYKVYRNGTEVGSVSGTTFTDSGLTAKTAYTYTVKAYDAAGNFSAA
FT                   SSALTVTTLDAATPPATPAWDAAKTYNKGDRVSYKGKTYEAQWWTQGNEPGAEQWGPWL
FT                   LIN"
FT   regulatory      112294..112330
FT                   /gene="lmo0105"
FT                   /regulatory_class="terminator"
FT   regulatory      112371..112376
FT                   /gene="lmo0106"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        112386..113288
FT                   /transl_table=11
FT                   /gene="lmo0106"
FT                   /note="similar to transcription regulator"
FT                   /db_xref="InterPro:IPR000600"
FT                   /db_xref="UniProtKB/TrEMBL:Q8YAL2"
FT                   /protein_id="CAC98321.1"
FT                   /translation="MYFVYDIGGTFVKFALMENNGTVKMKDKFPTTAKSAEELVAQMVE
FT                   KWRPYRTEVKGIAVSCPGVVDTEKGVIYQGGSLLFMHEKNLAEMLARECHVPVVLQNDA
FT                   KSAALAELWLGVAKNVHSAAILTLGSGVGGGIIMDGKLQSGYHLMAGEVSFMETSFDTK
FT                   KLRGTFFGRTGSAVELIKRIASKKNLPNKKDGEHVFELINQGDEEANAIFDAYIYELAS
FT                   QILNIQYLIDPEIIAIGGGISAQPVVVERLNDAVAEIKAANPYHAAQPKIVTCHFQNDA
FT                   NLYGALYNFFLQMDAQNKR"
FT   regulatory      complement(113273..113306)
FT                   /gene="lmo0107"
FT                   /regulatory_class="terminator"
FT   regulatory      113284..113317
FT                   /gene="lmo0106"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(113313..115094)
FT                   /transl_table=11
FT                   /gene="lmo0107"
FT                   /note="similar to ABC transporter, ATP-binding protein"
FT                   /db_xref="GOA:Q8YAL1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:Q8YAL1"
FT                   /protein_id="CAC98322.1"
FT                   /translation="MARNKFDIDEELETAFSAAHLKRILVYVKPYQKSIYITLFVILLA
FT                   NVATMIGPYLTKIVIDDTIPNKNMTQLFWIAVIFIVSVIVTGLCMRYRIRSITLIGQDI
FT                   LKDMRTAIFGHLQKLPFSYFDSRPHGKILIRVVNYINMLSDLLSNGLINLISDILSVIV
FT                   TLGFMLMIDPVLTLYSLALIPVLFVIVMVIKTAQRKAYQVLSNKQSNMNAYIHESIAGI
FT                   KVTQSFSREEENFEIFTEVSNEYRRSWMKAVKIQFLLWPGVQNIAVMTTCLIYFVGIKG
FT                   YGVDVSTGTLIAFIGYVGNFWNPVINIGNFYNSLITATTYLERIFETMDVEPDIKDIPN
FT                   AKKMPPIVGNVDFKDVYFRYEEGVDILKGINFHVDAGESIALVGPTGAGKTTIINLLSR
FT                   FYNINSGEILVDGENVEEVTLRSLRSQMGVMLQDTFIFSGTIIENIRYGKLDATEEEII
FT                   AAAKVVRAHDFISGLKDGYYTEVKERGSTLSAGQRQLISFARALLADPKILILDEATSS
FT                   IDTQTEILLQEGLERLLEGRTSFIIAHRLSTIKNSSRIFYIDNGRIQEAGSHEELMAQH
FT                   GYYYNLYQSQFDMLQAL"
FT   CDS_pept        complement(115087..116829)
FT                   /transl_table=11
FT                   /gene="lmo0108"
FT                   /note="similar to ABC transporter, ATP-binding protein"
FT                   /db_xref="GOA:Q8YAL0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:Q8YAL0"
FT                   /protein_id="CAC98323.1"
FT                   /translation="MESMKWIWQYVRKYRLLMIGVFILIFIASGISIIYPLLGGKVIDD
FT                   VVYQNKTNLLIPLLLIMIISTIIRTICRYTYQIMCERIGQNSLFRIREDLYKKLQSLDF
FT                   DFFNNTRVGDIMARMTGDTDAIRHFVSWVSYNILENVFLFSFAIIIMATIDWKLTLALV
FT                   IVTPLIAVLTMKMSSKAQPVFYEIRESFSRLNSMVEENISGNRVVKAFAREDFEMKKFH
FT                   EHNEDFKKRNLDSADVSRTYLPVLDSLAGMLVVITLIFGGYLVIKGQMTLGDLVAFNGF
FT                   LWMLNGPMRMSGWLINDVQRFIASSFKIQDMMVTDAKIPIHAEKPAPSLQGHVEFKNVS
FT                   FHFEDDPNTDVLKNISLKASPGQTIAILGETGAGKSTLVNLICRFYDPTSGEILIDGVD
FT                   ARKWHVRELRNHIATVMQDIFLFSDTIEGNIAFGAPDATMEDVRRMARIADADHFIETM
FT                   PESYDTIVGERGVGLSGGQKQRISLARALLKNPSILILDDTTSAVDMETEVKIQGELKK
FT                   ITENTTTFIIAHRISSVKEADEILILNHGEIIERGTHTSLLAEKGYYFDIYNKQLGTEA
FT                   NVNG"
FT   regulatory      complement(115104..115109)
FT                   /gene="lmo0107"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      complement(116837..116842)
FT                   /gene="lmo0108"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      116959..116964
FT                   /gene="lmo0109"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        116972..117805
FT                   /transl_table=11
FT                   /gene="lmo0109"
FT                   /note="similar to transcriptional regulatory proteins, AraC
FT                   family"
FT                   /db_xref="GOA:Q8YAK9"
FT                   /db_xref="InterPro:IPR003313"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR037923"
FT                   /db_xref="UniProtKB/TrEMBL:Q8YAK9"
FT                   /protein_id="CAC98324.1"
FT                   /translation="MLKINTTTFNPQILYIANCYTNEVRVGENHHHDFLEISIICEGNV
FT                   IYDIEGERVKLGKGDMLIFNPGVSHYDITEPGMTNAQLHIGFRNFALEGYTRNTFPFKK
FT                   AFLRKKEEESAILSISKQIIEEKDAGKPGYDLILKAFVMQLIIHVLREATPEQLENNGV
FT                   KLSTDEQQKQILVNEIIHYMEKHHTEDVSLSTLSQTMYISPAYISKVFKEETGESPINY
FT                   LIKIRLTRAEELLKNKDVSVKQAANMVGYNDAYYFSKLFKKYYGFPPSENWRKSS"
FT   regulatory      117827..117832
FT                   /gene="lmo0110"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        117841..118956
FT                   /transl_table=11
FT                   /gene="lmo0110"
FT                   /note="similar to lipase"
FT                   /db_xref="GOA:Q8YAK8"
FT                   /db_xref="InterPro:IPR013094"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="InterPro:IPR033140"
FT                   /db_xref="UniProtKB/TrEMBL:Q8YAK8"
FT                   /protein_id="CAC98325.1"
FT                   /translation="MDYEKALAFIKSNSTLEQEEGTEVIFKQAQETARGNLDPFLLKDL
FT                   KQHLGGTNDAIKEAPQEIQMPDFSNLEIATAAALQMRATMGSPNIDLSNGVTTEYRVVE
FT                   GDYGDIPVRIYRHEEATKPVPAFIFYHGGGFVGGTPAVVENFCKGIAEKLPAVVINVDY
FT                   HLAPEFPAPAAPKDCYRVLEWVVEQSNELGIDASKIGVSGDSAGGTLAAAVSYMDYEAE
FT                   TNYVGFQALLYPALTLVDEDNDKYQWDISKFGASEDTLPLVAPGIIGMNSSGELLRKAY
FT                   VRDENPAAPIYSPLSAVDKSIYPPTLIASAEFDALRAFADVFAKELRASGVQTKAIVYQ
FT                   GMCHAFIDKYGIFPQAEDVADEIVQMMKEIF"
FT   regulatory      118968..119000
FT                   /gene="lmo0110"
FT                   /regulatory_class="terminator"
FT   regulatory      119053..119058
FT                   /gene="lmo0111"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        119063..119770
FT                   /transl_table=11
FT                   /gene="lmo0111"
FT                   /db_xref="GOA:Q8YAK7"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="PDB:3KZP"
FT                   /db_xref="UniProtKB/TrEMBL:Q8YAK7"
FT                   /protein_id="CAC98326.1"
FT                   /translation="MGLMKFQLFIQPKLDVLQGNIVEYEILLRDDSAVPRFPLSELEAV
FT                   LADEELYLAFSEWFSEAFLDVLKKYPNDRFAINIAPQQLFYIETLHWLDKLKSESHRIT
FT                   VEMTEDIFDVPGHKRHLNANDKNAFILNKIKVIHGLGYHIAIDDVSCGLNSLERVMSYL
FT                   PYIIEIKFSLIHFKNIPLEDLLLFIKAWANFAQKNKLDFVVEGIETKETMTLLESHGVS
FT                   IFQGYLVNKPFPV"
FT   CDS_pept        complement(119740..120435)
FT                   /transl_table=11
FT                   /gene="lmo0112"
FT                   /note="weakly similar to transcription regulators, Fnr/Crp
FT                   family"
FT                   /db_xref="GOA:Q8YAK6"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR012318"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q8YAK6"
FT                   /protein_id="CAC98327.1"
FT                   /translation="MLHTIDFSDIFSSDYSSKISFKKGEIIHSYRDYEEKAPQIGAILE
FT                   GTAVLEGPTNEGRWMINALIGQHALFGMESLLETKTAPELTEYRVRALENGTVLFIDRE
FT                   FLLNYLYANPQFFHLILDEVIVRYLFTSKNYKNINQAPIVKVTRILVEIIELLHLHQTE
FT                   GSIELPVYVTQTFLADYCRSSRARVTEVLEELRESGLLLSKKPITISSHENLLDQVDSF
FT                   QTGNGLLTR"
FT   regulatory      complement(120443..120448)
FT                   /gene="lmo0112"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      complement(120618..120651)
FT                   /gene="lmo0113"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(120654..121106)
FT                   /transl_table=11
FT                   /gene="lmo0113"
FT                   /note="similar to protein gp35 from Bacteriophage A118"
FT                   /db_xref="InterPro:IPR010359"
FT                   /db_xref="UniProtKB/TrEMBL:Q8YAK5"
FT                   /protein_id="CAC98328.1"
FT                   /translation="MYEKLVNKYQDEVTIREEKMPYKLPGLYLNGMIFISKDQSSIEKG
FT                   CVLVEELMHYKYTVGNITKQETIMDKKQEIFARRKGYEELIPLDDIIACFYLGLREYFE
FT                   VAEFLEVTEEFLRHTVSHYAEKYGPMYDYGGYFINFGNSIDVYKKF"
FT   CDS_pept        complement(121112..121447)
FT                   /transl_table=11
FT                   /gene="lmo0114"
FT                   /note="similar to putative repressor C1 from lactococcal
FT                   bacteriophage Tuc2009"
FT                   /db_xref="GOA:Q7AP97"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:Q7AP97"
FT                   /protein_id="CAC98329.1"
FT                   /translation="MELNKFVGNKIKQYREERGLNQEALAEKLHTTRQTISRYENGDRK
FT                   ANQDVLFELAKIFNKRLDDFFPERNLPPVDERLVTIAAHIDDDVTEEEMRDILAYIEMK
FT                   KKLHRGM"
FT   regulatory      complement(121115..121120)
FT                   /gene="lmo0113"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      complement(121457..121462)
FT                   /gene="lmo0114"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      121649..121654
FT                   /gene="lmaD"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        121664..122092
FT                   /transl_table=11
FT                   /gene="lmaD"
FT                   /note="similar to Antigen D"
FT                   /db_xref="UniProtKB/TrEMBL:Q7AP96"
FT                   /protein_id="CAC98330.1"
FT                   /translation="MDRKLLKEKQIQLIFQLEQEENRFIRKRLIEELEFFEALGDREKG
FT                   LLTAEQKLLILTPSEYREYKRTKSDVQISRIIGVSRSSLAEWKRKKGLNRKKSQPVQQE
FT                   MIDVLAFHLDKTKEEIGALPASAIECQYEAFVINEANN"
FT   regulatory      122092..122097
FT                   /gene="lmaC"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        122104..122520
FT                   /transl_table=11
FT                   /gene="lmaC"
FT                   /note="similar to Antigen C"
FT                   /db_xref="InterPro:IPR006524"
FT                   /db_xref="UniProtKB/TrEMBL:Q7AP95"
FT                   /protein_id="CAC98331.1"
FT                   /translation="MQVLVLPENKDINYIKTVQEVKRFFADFERFRMITGLSKKPHLLR
FT                   NGFLEEPQFEPVAFSARHNKEVILEARWLVEKYTEMLNQMDDLYRTILMECYVERKQDV
FT                   AVMMDLPYEIAQFKRIKKRAVLELATLMGILVRK"
FT   regulatory      122783..122788
FT                   /gene="lmaB"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        122798..123187
FT                   /transl_table=11
FT                   /gene="lmaB"
FT                   /product="antigen B"
FT                   /db_xref="UniProtKB/TrEMBL:Q7AP94"
FT                   /protein_id="CAC98332.1"
FT                   /translation="MKSLSFMRVLEAVRTMLQEKGGLDISIVMRDQVEMPTTMIEMIDQ
FT                   EEEESQTAWKEKYRFAIHHYTNETDLAGVEKIDTLIQTGFTLPEGYKLIAVRHYGKQNL
FT                   VKENTLIHAKTSFEVSICRELKVKI"
FT   regulatory      123186..123191
FT                   /gene="lmaA"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        123200..123712
FT                   /transl_table=11
FT                   /gene="lmaA"
FT                   /product="antigen A"
FT                   /db_xref="InterPro:IPR011855"
FT                   /db_xref="UniProtKB/TrEMBL:Q7AP93"
FT                   /protein_id="CAC98333.1"
FT                   /translation="MAFEENLYCDYTPGAAKAVAGKDVILAVFNAAGDKLLAVAGQQGL
FT                   TVNRSKDSIEITSKDTVGGWKSKIGGMKEWSIENDGLYVADAESHKELAKYFESDSPVC
FT                   VKIINQASKKGLFGGLAIVADYSFEAPFDEAMTYSVKLDGMGALVDLTITEGGDQMPGE
FT                   TPVAPAE"
FT   regulatory      123747..123752
FT                   /gene="lmo0119"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        123760..124062
FT                   /transl_table=11
FT                   /gene="lmo0119"
FT                   /db_xref="UniProtKB/TrEMBL:Q7AP92"
FT                   /protein_id="CAC98334.1"
FT                   /translation="MFEVNDTTYILRFNKQKVKTVELTSGISLVAALTANKGILSYQVI
FT                   ETLFVSGLVEEKGLVPVKQKEALEIFDKLVEEQGLISLNVAVIEKLQEDMGFLFR"
FT   regulatory      124093..124098
FT                   /gene="lmo0120"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        124104..124508
FT                   /transl_table=11
FT                   /gene="lmo0120"
FT                   /db_xref="UniProtKB/TrEMBL:Q8YAK4"
FT                   /protein_id="CAC98335.1"
FT                   /translation="MDSEMNHDFDLEKQFAFFVVNFRMSKHDFEELTEVEKNFIMKEWE
FT                   NKVIFESTMLRNAVLNAEQNLNRKRNSRFIDLHKKRQKKADVNYTVNALQAISENEAKE
FT                   GKAWIDRIYGANGLRRPKNKEERRNVNGGF"
FT   regulatory      124482..124487
FT                   /gene="lmo0121"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        124495..126363
FT                   /transl_table=11
FT                   /gene="lmo0121"
FT                   /note="similar to bacteriophage minor tail proteins"
FT                   /db_xref="GOA:Q8YAK3"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:Q8YAK3"
FT                   /protein_id="CAC98336.1"
FT                   /translation="MADSKSFTFELNESVLTAQVGRLDEMAMVVEQRFSELKMTIEDVG
FT                   NADPGSKISESLGGLQSGLGTISSAFGQLGSSSEAITSGFGTAVGSVGGITDAFKNLGS
FT                   SVQNGTLFSSLATGIGGMSTMLGGVSGGVQGITNLASGFMELKNHLGGLMSSIGGVGGI
FT                   MGKLTSPMGLVIIGIVALVAAFAYLMTTNESFRNTVMSVVTQVAQLFGQLVASLMPIIM
FT                   QIVTAVMQIGAALMPMVMQFISFFAQLLAQLMPFINMLISMLMPVIMQIVQVVMSLVSA
FT                   LLPSIMTVIQGIMSVIQFLIPIIMQIATVVVQIVVTIISYISKIMPIVMTIIGVIVSII
FT                   TTIISYVVIIATTIASVIGKIISFIASVITAVIGIVQPIIAFITNIFTTIVTIIGAAFQ
FT                   MVFTVASKIWNSIMSTISGIIDGIKAVITGISTTVSSVFNGVKRIITGVFDGIKSAWGG
FT                   LTDFVGNIFDGVSSAIQTVVDNVKGFVNVVIRGINGAIGLINKIPGVEIGKIPQLISGT
FT                   TNFQGGFARMNEGGRGEMVVLPSGSQVIPHDATMKYARESARGNKSMLYTSQGADLARV
FT                   ENLLERLLQKNPVIKMDDKVVAEVVSRNQANSFDQYNYTMGGAAYS"
FT   regulatory      126345..126350
FT                   /gene="lmo0122"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        126360..127178
FT                   /transl_table=11
FT                   /gene="lmo0122"
FT                   /note="similar to phage proteins"
FT                   /db_xref="InterPro:IPR008841"
FT                   /db_xref="UniProtKB/TrEMBL:Q8YAK2"
FT                   /protein_id="CAC98337.1"
FT                   /translation="MSDLFLELNGKVHSLSETFPGLSVQEVSRQSPQLSMETAEIAGTD
FT                   GVIPGMTQFKPFIFSAKCNLQALDIPDYHLAVREIYEFLFQRDSYYIWSDQMPGIRYEV
FT                   HPKPVDFSRESDRVGLLTIEFDVFKGYAESRGTSLDPMTFEVDLWQMGMNLSNRDDLFY
FT                   IFKENTFRVYNAGSDRVNPLMRHELDIAMTANGTPTIHNLTTGESFEYQKELRKTDVLL
FT                   LNNIYPLVNNRRVGKDTNHGIITLEKGWNDFEIKGVTDVTIAFNFPFIYR"
FT   regulatory      127177..127182
FT                   /gene="lmo0123"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        127188..128324
FT                   /transl_table=11
FT                   /gene="lmo0123"
FT                   /note="similar to protein gp18 from Bacteriophage A118"
FT                   /db_xref="InterPro:IPR010572"
FT                   /db_xref="UniProtKB/TrEMBL:Q8YAK1"
FT                   /protein_id="CAC98338.1"
FT                   /translation="MDYVIIQSMDKEVEEILTDIDYGSFSYDYEKNTSRAISFTVNKTK
FT                   QNAAIFDLVGNEAILTYQGQQFVIKKCTPKSIGGTLSKQITAQHICYTVQDHVQYNVKS
FT                   GRKKYSIQTVLEFALQDNVLGFSYEIQGSFPLVELEDLGNKNGLELVNLCLEEFGAILF
FT                   ADNKKLYFYDEKSWYVKTEKQFRYLYNTEEVSVDTNTDNLKTEIKCYGKQKENADKLTG
FT                   DNKYMAVVTYTSPNEAIYGKRMANAKSDDKITNNDDLLIFAKKQILDVPETALTISYKG
FT                   KEPVSERDVWYFIHEPMGFETEVKVTKIKSSHPWSKKFQEIGFSNSRRDMVRIQTQIAN
FT                   QVKKASVDTNKINSFSSIAMNAYDSRILTEVVGVVDGD"
FT   regulatory      128300..128305
FT                   /gene="lmo0124"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        128314..128613
FT                   /transl_table=11
FT                   /gene="lmo0124"
FT                   /db_xref="UniProtKB/TrEMBL:Q8YAK0"
FT                   /protein_id="CAC98339.1"
FT                   /translation="MATEIRVLKNVDDTVFYPKTHVTAVEGLDSATTTTSGLMPASDKT
FT                   KLNGIEANAEKNNVTAIDIANWNKKQDAILVSENGSNFKITVTNAGELKATKVE"
FT   regulatory      128616..128621
FT                   /gene="lmo0125"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        128628..129203
FT                   /transl_table=11
FT                   /gene="lmo0125"
FT                   /db_xref="UniProtKB/TrEMBL:Q8YAJ9"
FT                   /protein_id="CAC98340.1"
FT                   /translation="MKLDLWKWEMLLQGREFRNKTNDNWQKLMDWSDFISTGLSAIYVY
FT                   VNKADATLNNKIDTVDKAVNARVNELISGTEQLSEVVDARSDAFGARYPVLRERLNQEQ
FT                   LNFSKKSTIQFDASTIISMEKQDIGLLTSKKISEAQTVCFLNISSLDEEADIVLEKTGE
FT                   TSFSDNLTSLVFAKIGTNERYQMEPVGA"
FT   regulatory      129204..129209
FT                   /gene="lmo0126"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        129218..129697
FT                   /transl_table=11
FT                   /gene="lmo0126"
FT                   /db_xref="UniProtKB/TrEMBL:Q8YAJ8"
FT                   /protein_id="CAC98341.1"
FT                   /translation="MTEIKRMLQTKEDNSKEQFYPETHVAGIVGLTEYVSGQLPTGVVS
FT                   VNGKAGRVLLDAEDVHAAKKSHTHEVATYTTDGFMSSFDKQKIDQLVSPEAGVTSINGK
FT                   TGIVDLFASDLDAAEINHTHAEATTTESGFLSIDDKEKLDAIQVIALETIKEVIE"
FT   regulatory      129681..129686
FT                   /gene="lmo0127"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        129694..130230
FT                   /transl_table=11
FT                   /gene="lmo0127"
FT                   /note="weakly similar to protein gp20 from Bacteriophage
FT                   A118"
FT                   /db_xref="UniProtKB/TrEMBL:Q8YAJ7"
FT                   /protein_id="CAC98342.1"
FT                   /translation="MTKIVKMSEKNEHGTLEQFYPETHAEAVKGLVSVSEEEKTIWDQK
FT                   ESTAGAEQKANTALNSAKDYVDTIGEGTVIFKGANLMGAGQSFKWDASKLKFGMTLLFS
FT                   RYDAANNTPQDYYYHSVFLSKAQLVELAGKGILVQMPSTTYGDRKYLYVSTTGLSGHFD
FT                   NSNYAAWALRQVTIM"
FT   regulatory      130237..130242
FT                   /gene="lmo0128"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        130249..130671
FT                   /transl_table=11
FT                   /gene="lmo0128"
FT                   /note="similar to a protein from Bacteriophage phi-105 (ORF
FT                   45)"
FT                   /db_xref="GOA:P58702"
FT                   /db_xref="InterPro:IPR006480"
FT                   /db_xref="UniProtKB/Swiss-Prot:P58702"
FT                   /protein_id="CAC98343.1"
FT                   /translation="MEVILKFGILGFGAIFGYLFGEVDLLVKVLVCFIVADYISGLLAS
FT                   GYLGELSSKMGFKGIAKKIAILILVAIAHQIDLILGTHNTTRDAVIFFYLANELISILE
FT                   NFVRMGMKVPEVLKNLILIFDAKSGEDEEKHDKDMD"
FT   regulatory      130637..130642
FT                   /gene="lmo0129"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        130652..131380
FT                   /transl_table=11
FT                   /gene="lmo0129"
FT                   /note="similar to autolysin: N-acetylmuramoyl-L-alanine
FT                   amidase"
FT                   /db_xref="GOA:Q8YAJ6"
FT                   /db_xref="InterPro:IPR002508"
FT                   /db_xref="UniProtKB/TrEMBL:Q8YAJ6"
FT                   /protein_id="CAC98344.1"
FT                   /translation="MTKIWIDAGHGGKDSGASGNGLVEKNWVLTVAKQLQTELVKAGFE
FT                   VGMTRTNDTFYELSDRAKKANSFKADLFISLHFNAGGGKGYEDYIYTSVPAATVEIQKI
FT                   IHKNIITKVTKHGMNDRGMKKANFAVLRETAMDAILLEAGFCDSTDALILEKKAYQTDY
FT                   CLGIVSAVQEIFGAMVTKYRAGKYLTSDDAISGTNIKGYLEAGTKVFVYKETEKTLNLT
FT                   TTKGVPGSWVLKTEVNTGKR"
FT   regulatory      complement(131375..131408)
FT                   /gene="lmo0130"
FT                   /regulatory_class="terminator"
FT   regulatory      131386..131419
FT                   /gene="lmo0129"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(131419..133773)
FT                   /transl_table=11
FT                   /gene="lmo0130"
FT                   /note="similar to 5'-nucleotidase, putative peptidoglycan
FT                   bound protein (LPXTG motif)"
FT                   /db_xref="GOA:Q8YAJ5"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR006146"
FT                   /db_xref="InterPro:IPR006179"
FT                   /db_xref="InterPro:IPR008334"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="InterPro:IPR036907"
FT                   /db_xref="InterPro:IPR041498"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8YAJ5"
FT                   /protein_id="CAC98345.1"
FT                   /translation="MKVNKFFKKTTHVLLVAGLTIGLTAPFTGTTAQAAADTVPIQILG
FT                   INDFHGALETASKDASGSPIGGADYLATNLDNATNSFLQANPGATTDNAIRVQAGDMVG
FT                   ASPAVSGLLQDEPTMKVLQKMNFEVGTLGNHEFDEGLPEYKRILDGVSTNKFGPIVEAY
FT                   PRVKSDMKIVAANVVNKGTNTVAEGFLPYYVKEIDGVKVGFIGIVTTEIPNLVLANHIK
FT                   DYDFLDEAETIVKYSAELRGQGVNAIVVLSHVPALSTGNPNTGTKQDVAGEAANMMTKA
FT                   NELDPNNSVDLVLAGHNHQYTNGLVGKTRIVQSYNNGKAFSDVTGELDKTTGDFVSPPD
FT                   AKITYNTRSVTPNADITAVTEDAKSRIEGVINETIGLANKDVISRDTNPDNKAIDDKES
FT                   ELGNMITDAQRYMANKAGADVDFAMTNNGGIRSDLTTRLANGQNEITWGAAQAVQPFGN
FT                   ILQVVEMTGADILEALNQQYLSNQTYFLQISGLKYTFTDTDDLDHAYKVASVTTEDGTP
FT                   LKTDQKYKVVINDFLFGGGDGFSAFKKANLVTAIDPDTETFINYIKDQKAAGKVITAQK
FT                   EGRKVYKSQAEIDKETKDAAIKAIKEATKINKLAEKDKTLTGTTLPGATVSVQKATANA
FT                   RMALAAGPNATADANGKFSVDVTSLNLKKGDQITTTITDPNGYSTTFQATVQAAATTPP
FT                   DNGNGGTDNGNGNGNNGGTDGNGGTNNGNGSGTNGGTTTTEDPTTTTSNTSTTGTSSNT
FT                   SLPTTGDTAGLATVFGVILTTTALYVLRKRS"
FT   regulatory      133949..133954
FT                   /gene="lmo0131"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        133961..134710
FT                   /transl_table=11
FT                   /gene="lmo0131"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="PDB:4Q6J"
FT                   /db_xref="UniProtKB/TrEMBL:Q8YAJ4"
FT                   /protein_id="CAC98346.1"
FT                   /translation="MDISSTEIWDAIRRNSYLLYYQPKVDAKTNKIIGFEGLVRLKTAT
FT                   TILAPIDFFDDIVLLNATREMQDFVAETAIKQINQLGGRFSISINIPAHYVASSTYMTF
FT                   LHDYVKEHLKYPECLEIEIIERGEITELAIADKNLRKIKDLGVKVSMDDFGKGYSSLAY
FT                   LRSLPIDIVKTDMSFIALLKTDRKQQIIIRAIVNLCHDLGGKVVTEGVEDMEQVEKLRE
FT                   MKVDYFQGYYFSRPLPMEEIKQKYSIV"
FT   regulatory      complement(134719..134773)
FT                   /gene="lmo0132"
FT                   /regulatory_class="terminator"
FT   regulatory      134731..134785
FT                   /gene="lmo0131"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(134782..136290)
FT                   /transl_table=11
FT                   /gene="lmo0132"
FT                   /note="similar to inosine monophosphate dehydrogenase"
FT                   /db_xref="GOA:Q8YAJ3"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR001093"
FT                   /db_xref="InterPro:IPR005990"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR015875"
FT                   /db_xref="UniProtKB/TrEMBL:Q8YAJ3"
FT                   /protein_id="CAC98347.1"
FT                   /translation="MAFYFEEPSRTFSEFLLVPGYSSAECVPTNVSLKTPIVKFKKGEE
FT                   SAITMNIPLVSAIMQAVSDDNMGIALATEGGVSFIFGSQSIESEAAMVSRVKNHKAGFV
FT                   ISDSNISPDKTLQDILDLKEKTGHSTVAVTEDGTAHGKLLGIVTSRDYRVTRMSPDEKV
FT                   ADFMTPFEKLVTANKSTTLKEANNIIWDNKLNALPLVDDNEHLVHMVFRKDYDSNKENK
FT                   LELLDSSKRYVVGAGINTRDYEERVPALVEAGADILCIDSSEGYSEWQKRTLDYVRGKY
FT                   GDTVKVGAGNVVDRDGFRYLAEAGADFVKVGVGGGSICITREQKGIGRGQATALIDVAK
FT                   ARDEYFEETGVYIPICSDGGIVYDYHMTLALAMGADFIMLGRYFSRFDESPTNKVNLNG
FT                   TYMKEYWGEGANRARNWQRYDLGGDKKLSFEEGVDSYVPYAGSLKDNVAISLSKVRSTM
FT                   CNCGALNIPELQQKAKITLVSSTSIVEGGAHDVVVKDASNNLIK"
FT   regulatory      complement(136301..136306)
FT                   /gene="lmo0132"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      136456..136461
FT                   /gene="lmo0133"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        136469..136702
FT                   /transl_table=11
FT                   /gene="lmo0133"
FT                   /note="similar to E. coli YjdI protein"
FT                   /db_xref="InterPro:IPR010693"
FT                   /db_xref="UniProtKB/TrEMBL:Q8YAJ2"
FT                   /protein_id="CAC98348.1"
FT                   /translation="MDEETLLERGYRKYRGADVDIYFNTNVCEHSGNCVKGNVELFNLD
FT                   RKPWIMPDNVSKEEAKRVIHTCPSGALQYIEK"
FT   regulatory      136701..136706
FT                   /gene="lmo0134"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        136714..136992
FT                   /transl_table=11
FT                   /gene="lmo0134"
FT                   /note="similar to E. coli YjdJ protein"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR031165"
FT                   /db_xref="UniProtKB/TrEMBL:Q8YAJ1"
FT                   /protein_id="CAC98349.1"
FT                   /translation="MEYKNGENRIYAVNDEGVEVGEVTFVPTGEDMFIIDHTGVDDAAR
FT                   GQGIAQELVKRAVEKAKSEGKKIVPLCPFAKAEFSKKPEYQEVEASK"
FT   regulatory      137000..137034
FT                   /gene="lmo0134"
FT                   /regulatory_class="terminator"
FT   regulatory      137306..137311
FT                   /gene="lmo0135"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        137323..138897
FT                   /transl_table=11
FT                   /gene="lmo0135"
FT                   /note="similar to oligopeptide ABC transport system
FT                   substrate-binding proteins"
FT                   /db_xref="GOA:Q8YAJ0"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="PDB:5ISU"
FT                   /db_xref="UniProtKB/TrEMBL:Q8YAJ0"
FT                   /protein_id="CAC98350.1"
FT                   /translation="MKKFLLVAVISVFALVLTACGGSGASSDKANGSGKAKDGGSLIIG
FT                   VTGDPEVINPNYASDRVTLTIQQAVYAPLFWEVDGKPALAKSLDISDDNLTYTVKLKDG
FT                   LTWHDGKPLTADDVVFTVNSILDTKQNSPNRGNFVFDDKPVKVEAVDDTTVKFTLPTVA
FT                   PAFENTIKTFFPIPKHIFEGVENIEKSDKNKNPIGSGPYKFVEYKTGEYVSLERFNDYF
FT                   DGKPKLDKVTFRITKDQNAANLALQNGEINLKSIQPSDRNKVEKASAVNIITYPENRLS
FT                   YATFNENQPALKSKELRQALSYALDREEIIDAAYGSDEYAKPASSFLTENTKYFTDKVE
FT                   TYDQDIAKAKKLVKESGFDTSQKLTVYYLNNSKSQESIALYLQQQYKEIGVTLDLKPTD
FT                   PNALSNITLDRKNADYSIALNGYIMGNDPDAYKSLYLSDAPYNYSNYHNKDLDALWEKG
FT                   AVTADDKERQEIYEKIQNTIADDAVIYPISYDNAVLALDSRYGGQKAATPQPVTMFRDL
FT                   SKLYLTE"
FT   regulatory      138922..138967
FT                   /gene="lmo0135"
FT                   /regulatory_class="terminator"
FT   regulatory      138987..138992
FT                   /gene="lmo0136"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        138999..139949
FT                   /transl_table=11
FT                   /gene="lmo0136"
FT                   /note="similar to oligopeptide ABC transporter, permease
FT                   protein"
FT                   /db_xref="GOA:Q92FC3"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q92FC3"
FT                   /protein_id="CAC98351.1"
FT                   /translation="MLKTIIKRVLQIIPMLFIISIISFALIKLAPGDPVNSFVTPDMNP
FT                   DDVERIRQSLGLDQPIYVQYFIWLGNLLQGNLGYSIVNSQPVLQQILERIPATLGLVGT
FT                   SLVLTLLLSIPLGLVAANYENTWIDKVLNGISYIGISIPIFWFGMILIDVFSIQLGWLP
FT                   SLGMRTIGVDSFWDMAEHAILPVITLTFQGCAAYYRYVRSNTINQLKEEYVLFGYAKGL
FT                   SKVQIMGHHVLKNSLLPVITLLGMSLPQVITGAFITESIFSWPGMGSLGINAIFQLDYP
FT                   VIMAITLFSALLLIIGNLLADLAYMIVDPRIREMG"
FT   regulatory      139946..139951
FT                   /gene="lmo0137"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        139960..140853
FT                   /transl_table=11
FT                   /gene="lmo0137"
FT                   /note="similar to oligopeptide ABC transporter, permease
FT                   protein"
FT                   /db_xref="GOA:Q8YAI9"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR025966"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q8YAI9"
FT                   /protein_id="CAC98352.1"
FT                   /translation="MRLDFSKKTMQDFERDAEVVHATRERSFWRFMLADRRAVFATSVL
FT                   ILITVACIFAFLSPYDPNALSVQDKLMPPNSSHWFGTDDHGRDYLTRVLYGGRVSLLVG
FT                   VFAMMIAVVVGTLAGTVSGYFGGFIDNIVMRFLDIFMSIPSFFLLMILNAYLKPGISNI
FT                   IIIIGLLSWMEVARIVRAETLTLKEREFILYSKSSGGGFFHIMFKHIIPNAMPSIVVAA
FT                   SLNVATAILTESALSFLGLGVQQPNASWGSMLNNAQGYVGEATYLALFPGLLILMTILS
FT                   FNVLGDVLRKGLSRRY"
FT   regulatory      140863..140896
FT                   /gene="lmo0137"
FT                   /regulatory_class="terminator"
FT   regulatory      141039..141044
FT                   /gene="lmo0138"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        141052..141336
FT                   /transl_table=11
FT                   /gene="lmo0138"
FT                   /db_xref="InterPro:IPR021477"
FT                   /db_xref="UniProtKB/TrEMBL:Q8YAI8"
FT                   /protein_id="CAC98353.1"
FT                   /translation="MSEIKVKEATLAKYATKLESKGKSTEYLPMKGGNMSYSQANSINH
FT                   FRTALFDLVDAVDNFQGVVGTDAKRLKELGASFTRKDQELERSMGLGGK"
FT   regulatory      141324..141329
FT                   /gene="lmo0139"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        141337..141705
FT                   /transl_table=11
FT                   /gene="lmo0139"
FT                   /db_xref="UniProtKB/TrEMBL:Q8YAI7"
FT                   /protein_id="CAC98354.1"
FT                   /translation="MDAKSQQAEAQLQLLKKEQSAAKDFLQDLQRQQNEQEWLAEDVAR
FT                   VHQEERESLELLREVWQGAESRSFGYYLADLQEEEKQKWHKKIQANEEECQQKITACRK
FT                   NIYQLENQQQDLQKELLQ"
FT   regulatory      141607..141613
FT                   /gene="lmo0140"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        141618..143006
FT                   /transl_table=11
FT                   /gene="lmo0140"
FT                   /db_xref="InterPro:IPR006829"
FT                   /db_xref="UniProtKB/TrEMBL:Q8YAI6"
FT                   /protein_id="CAC98355.1"
FT                   /translation="MPTKNHRLPKKHLPIRKSTTRFTKGVVTVSRIDIGEIQTFAYQLH
FT                   TANEAARKSIKDIKNAVKNYTEDGSLKGKAIDASKNYYQMTYFPLCDAIIEAMNESEER
FT                   LAQYIADFHAQVDSSADARIDADGLYELGKMIDRIEAKKEALAQRMNTGTEGQMQSYRS
FT                   QLSIAYKQENILEKYLAFEQSHGGFFDNLTDLVRGIQQTIRELQSNIQFNSKTGTYDMS
FT                   KLNFTTVTRMQNASGKALNDNAKTFNFDEYQKTYRGQMWVLMKNGIVDVEATNAYNAAV
FT                   LGGEMPHESNEAQEEAELLQAVVQSVKEGTDPVTGQEISKAQGFGIISGLIFRYTAGGY
FT                   KGKKFKIPRDWLHRRKKNNGVEVGTDFGKIGKLVNHPNIKINWSEYAEHGMSRLKQRGL
FT                   SKSQVDDFVEHGKVLSQNEGEKFAFITEDGVAIVSKDGKLVTAWGKKDFDEGMKKIIGK
FT                   LYGK"
FT   regulatory      143002..143007
FT                   /gene="lmo0141"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        143016..143258
FT                   /transl_table=11
FT                   /gene="lmo0141"
FT                   /db_xref="InterPro:IPR015053"
FT                   /db_xref="InterPro:IPR023162"
FT                   /db_xref="UniProtKB/TrEMBL:Q8YAI5"
FT                   /protein_id="CAC98356.1"
FT                   /translation="MYEKVEKIINDWDPIELFPLAPKDEYSQEINKIISIVQENPNIDM
FT                   NVLGKGIRKIFIDSFGENLIFKNNEDEIAEKILAL"
FT   regulatory      143350..143355
FT                   /gene="lmo0142"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        143366..143722
FT                   /transl_table=11
FT                   /gene="lmo0142"
FT                   /db_xref="UniProtKB/TrEMBL:Q8YAI4"
FT                   /protein_id="CAC98357.1"
FT                   /translation="MINSRFYEGFEGEAELSFVAGDNKLLIWNGYFETILDNLLDCNVE
FT                   REGVLKEYFNHEGWYDDSPWMIEDNSLTIIQLKCFDINKINQTSMKDDLEEVVKTIISF
FT                   LENNRFSKIYIEYE"
FT   regulatory      144083..144088
FT                   /gene="lmo0143"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        144097..144273
FT                   /transl_table=11
FT                   /gene="lmo0143"
FT                   /db_xref="UniProtKB/TrEMBL:Q8YAI3"
FT                   /protein_id="CAC98358.1"
FT                   /translation="MKYLENCDADNLYWISEIFEDISANLKSQKFIDYLRKLDKKFPEL
FT                   EMTQDIDIAESYF"
FT   regulatory      144382..144386
FT                   /gene="lmo0144"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        144397..144840
FT                   /transl_table=11
FT                   /gene="lmo0144"
FT                   /db_xref="UniProtKB/TrEMBL:Q8YAI2"
FT                   /protein_id="CAC98359.1"
FT                   /translation="MEEQEIIEKVEILPNNFSENDSIYISQENIKNLVLFSKENQTVLE
FT                   LLITPFLICVNSGLKYELHYYEISTEISKNDTEIIGFPFGNKLPKEITDNISPKLFVRR
FT                   EDYSAFENFLSQYFNAMKSMGFADDKQAIGMIEHGATLFYEVL"
FT   regulatory      144875..144919
FT                   /gene="lmo0144"
FT                   /regulatory_class="terminator"
FT   CDS_pept        145085..145171
FT                   /transl_table=11
FT                   /gene="lmo0145"
FT                   /note="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:Q8YAI1"
FT                   /protein_id="CAC98360.1"
FT                   /translation="MPDWDFNNPESMKAWDLASGSYAEQVSG"
FT   regulatory      145338..145343
FT                   /gene="lmo0146"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        145354..145560
FT                   /transl_table=11
FT                   /gene="lmo0146"
FT                   /note="hypothetical protein"
FT                   /db_xref="InterPro:IPR028148"
FT                   /db_xref="UniProtKB/TrEMBL:Q8YAI0"
FT                   /protein_id="CAC98361.1"
FT                   /translation="MKFDLENGYVVKADGEMLVGGKFVVFKDSMKNWEPPYENKKLSES
FT                   EVQEIIQQVKQSTNENTVQISFE"
FT   regulatory      145857..145862
FT                   /gene="lmo0147"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        145869..146306
FT                   /transl_table=11
FT                   /gene="lmo0147"
FT                   /db_xref="UniProtKB/TrEMBL:Q8YAH9"
FT                   /protein_id="CAC98362.1"
FT                   /translation="MKIKKILPQTIKSEVYFIDEIKNFDIVTEKMNDNFYTYRLGSNVM
FT                   MWLNDEGVIGEIECIFPAQIDNLITLWEEKNTVVQNGFPMIDTDIVENKTFIPKVRIFN
FT                   HGDYFILYFSNMYKYNKEIISENLTFYAKDTELIAIKAELT"
FT   CDS_pept        146306..146656
FT                   /transl_table=11
FT                   /gene="lmo0148"
FT                   /db_xref="UniProtKB/TrEMBL:Q8YAH8"
FT                   /protein_id="CAC98363.1"
FT                   /translation="MLKNYYTGFEGYPEIDFYTYINGEKTGIEMWEGYFDNIMNEFSPV
FT                   DGRWVSLAYYYHLYEGWYDESPWVIPDNKKALEQFGTIDIKVLDNVTQEIMMKLIKLLK
FT                   DNLDSEIFIEYS"
FT   regulatory      146666..146705
FT                   /gene="lmo0148"
FT                   /regulatory_class="terminator"
FT   CDS_pept        146764..147381
FT                   /transl_table=11
FT                   /gene="lmo0149"
FT                   /db_xref="UniProtKB/TrEMBL:Q8YAH7"
FT                   /protein_id="CAC98364.1"
FT                   /translation="MWVLMKNGIVDVEATNAYNAAVLGGKMPHESNEAQEEAELLQAVV
FT                   QSVKEGTDPVTGQEISKAQGFSIISGVIFYYAGGGYKGKKIKIPKKWLDRRRNVNRIDF
FT                   LQSVNIKDFVVKDKHLRNSTAKRARKFDAETSEEANLIVQDALKNGKVKKIEDNGLGSQ
FT                   RQKSYSAIIDTEKNVGTKGESHIKIVYDELNNVWTVYPVPAP"
FT   regulatory      147382..147387
FT                   /gene="lmo0150"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        147399..147764
FT                   /transl_table=11
FT                   /gene="lmo0150"
FT                   /db_xref="UniProtKB/TrEMBL:Q8YAH6"
FT                   /protein_id="CAC98365.1"
FT                   /translation="MNNIDSIMSKYNKQQVSKIKDFLLSEIDSDNIEETIDFVKSNNQE
FT                   KMGKFQDILYDGGIYSGLFIEGNQYLISSSNRKVLIIDAVSEENGVDKELTRIECSLED
FT                   FTFLLRNIKDVLRYEEF"
FT   regulatory      147869..147874
FT                   /gene="lmo0151"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        147884..148291
FT                   /transl_table=11
FT                   /gene="lmo0151"
FT                   /db_xref="InterPro:IPR040547"
FT                   /db_xref="UniProtKB/TrEMBL:Q8YAH5"
FT                   /protein_id="CAC98366.1"
FT                   /translation="MDQKIKDIYHIDDSFSIDNEKYNKWLKSLLNKTRGEITENDVYTM
FT                   LLQQELEDLAIEKAIEFIKIDPLAGEMWDGQFLEQLAGISVDKLVAYKEELQKLIPYMD
FT                   NQINEILWDFETEKEEFLFRYAKFKDKVANL"
FT   regulatory      complement(148294..148328)
FT                   /gene="lmo0152"
FT                   /regulatory_class="terminator"
FT   regulatory      148305..148339
FT                   /gene="lmo0151"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(148354..150009)
FT                   /transl_table=11
FT                   /gene="lmo0152"
FT                   /note="similar to oligopeptide ABC transporter-binding
FT                   protein"
FT                   /db_xref="GOA:Q8YAH4"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:Q8YAH4"
FT                   /protein_id="CAC98367.1"
FT                   /translation="MHFLKKTLPIFAILTVLLLTACGNDNEKSTTKTSPDKIKFLETSE
FT                   LLTLNTTAEEDFASFTAQNQVFEGLYTLDQKDNFVPGVADGMPEISTDQTKYTIKLKKN
FT                   AKWSDGSQVTADDFVYAWRRAVDPKTAPGYSALFKDSIKNATEINEGKLPVTDLGVVAT
FT                   DPTTLEITLKKPVPYFISLLSFETFFPQKESYVKKQGDKYGTDSAHTLYNGPFVMKDWG
FT                   GNITNKWTYAKNDQYWDKDNVKVNEIDVQVAKDINAGVNLYNTNEADRVPLSGDFAKQY
FT                   KDKKDFQTEKDALISYLRMNQKRDGKATPLANNSLRHALNLAVDKKQLTDRILGDGSFP
FT                   ANGLLPKDFVQNPTTGADFRTDSGNHLVYNKEEALKYWKQAQKELGTDKVTIELLGDDQ
FT                   ETTKTIFAYLKAQFEDNLPGVTIKVKNMPSKSATQLTSDGNYDLSLAAWMPDFKDPWTY
FT                   SSLFLSDYFNNHMSYNSPAYDKLVKSTDTTLATKPEERWNAFVASEKVLLDDDAAILPL
FT                   YQHQTAVLQRTDITGVQKHAFGSPYSYKFIRVEK"
FT   regulatory      complement(150018..150023)
FT                   /gene="lmo0152"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      150220..150225
FT                   /gene="lmo0153"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        150232..151173
FT                   /transl_table=11
FT                   /gene="lmo0153"
FT                   /note="similar to a probable high-affinity zinc ABC
FT                   transporter (Zn(II)-binding lipoprotein)"
FT                   /db_xref="GOA:Q8YAH3"
FT                   /db_xref="InterPro:IPR006127"
FT                   /db_xref="InterPro:IPR006128"
FT                   /db_xref="InterPro:IPR006129"
FT                   /db_xref="UniProtKB/TrEMBL:Q8YAH3"
FT                   /protein_id="CAC98368.1"
FT                   /translation="MKKWSFLVVTVLAFVLVLAGCGASNDKVSGDKDKLKVVTTFYPMY
FT                   DFTKNVAGDNASIEMLIDAGTEPHDYEPSAKDIAKIEAADVFVYNSEDMETWVPSVLKS
FT                   LDSKKLTVIDASKGIELVEGTEEEDHDHEHEEGHHHEHDPHVWLSPVLAEQEVTNIQNG
FT                   LTKADKTNADTYKKNAETYKEKLKTLDNKFKTAFEGAKQRDFVTQHAAFQYLAKEYDLH
FT                   QVAIAGLSPDQEPSPARLAELQKYVKENNISTIYFEEVASPKVAETLANETGAKLEVLS
FT                   PIEGITDKEQKKGMDYIAYMEQNLQALQKTIK"
FT   regulatory      151173..151178
FT                   /gene="lmo0154"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        151186..151890
FT                   /transl_table=11
FT                   /gene="lmo0154"
FT                   /note="similar to high-affinity zinc ABC transporter
FT                   (ATP-binding protein)"
FT                   /db_xref="GOA:Q8YAH2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q8YAH2"
FT                   /protein_id="CAC98369.1"
FT                   /translation="MKYIDIANIGFKYESEPVLENISFQVSAGEFIILTGENGAAKSTL
FT                   LRIILGILQPDKGSVTFAKKNADGGRLLTGYVPQQIASFNAGFPSTVLELVRSGRFPNG
FT                   KWFKRLTTKDHAHVEKALKSVEMWDYRHKRIGELSGGQKQRICLARMFATDPDILILDE
FT                   PQTAMDKQSKIRFYNLLKHEAQVHGKAILMVTHDSEEMEDFVDKHIRLIRKEDVSWKCF
FT                   SMDLCKEPSKRP"
FT   regulatory      151826..151831
FT                   /gene="lmo0155"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        151839..152645
FT                   /transl_table=11
FT                   /gene="lmo0155"
FT                   /note="similar to high-affinity zinc ABC transporter
FT                   (membrane protein)"
FT                   /db_xref="GOA:Q8YAH1"
FT                   /db_xref="InterPro:IPR001626"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:Q8YAH1"
FT                   /protein_id="CAC98370.1"
FT                   /translation="MEMFLYGFMQRAFQASMIIAIIAPLLGVFLIIRRQSLMADTLSHV
FT                   SLAGVAFGLVLNVNPSVTTLIVVVIAALGIEYLRGVYVTYSELSIAILMAGGLAVALVL
FT                   MSLDQGGITTSVQQYLFGSIVTISKAQVQLLVILGVAIVVLFLVFKRFMFVLTFSEDVA
FT                   VAEGVPVRLISLLFSVVTGIAIAVIMPIAGALLVSALIILPAAIGMRISKGFLMCVISA
FT                   ILIGLVGMFSGLVSSYQLGTPPGATITLMFIILFIISTVVLKLIRK"
FT   CDS_pept        complement(152648..153328)
FT                   /transl_table=11
FT                   /gene="lmo0156"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="UniProtKB/TrEMBL:Q8YAH0"
FT                   /protein_id="CAC98371.1"
FT                   /translation="MPKNLYNYQEFIRLSHEGKIAYEQIDVPKNASLLTEKIDIDNHIY
FT                   LVVDGYIALILNDGSQNSKIYSIQGKGTFLNYFTLLDQSNNHFNFKTLSGCSLYKYSKA
FT                   DMEYFLSMFPENFGFQFFIMKNQTTHVYFKSLMASSPASEKLKTTFSNMALLHGVLSDD
FT                   GTVILPQAIKTSHLLSYSNLSKSCFYKDLQYLKTTNQIEKKEKCWIIHDQALYTMIQNG
FT                   QTSF"
FT   regulatory      complement(153337..153342)
FT                   /gene="lmo0156"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      153595..153600
FT                   /gene="lmo0157"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        153608..155947
FT                   /transl_table=11
FT                   /gene="lmo0157"
FT                   /note="similar to ATP dependent helicase"
FT                   /db_xref="GOA:Q8YAG9"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR006554"
FT                   /db_xref="InterPro:IPR006555"
FT                   /db_xref="InterPro:IPR010614"
FT                   /db_xref="InterPro:IPR010643"
FT                   /db_xref="InterPro:IPR011604"
FT                   /db_xref="InterPro:IPR014013"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042493"
FT                   /db_xref="UniProtKB/TrEMBL:Q8YAG9"
FT                   /protein_id="CAC98372.1"
FT                   /translation="MRKVRISVRRLVEFVRRSGSIDNRMTSSDRALEGTKIHQLLQKEA
FT                   GEEYAAEVRLNLDRIVDGIAFSLDGRADGIINGRMIDEIKTTETPMDEITENFRPLHWA
FT                   QLICYGFMLAEKSDLAEVTLQLTYYQVVDKEVKQFQRVMSREELSVFVDDLLSQYAIWA
FT                   KASAAWEMKRNKTIQELTFPYDSYRSGQRELAIAVYRTISSEESLFCEAPTGIGKTMST
FT                   LFPGIKAMGEGKTDKLFYFTAKTITRQVAEDALDEMRRKGLAARSVTITAKDKICFLDE
FT                   RKCEPDHCQFARGYYDRLNEALFDMLQSEEAITRQVVESYARKYTLCPFELSLDVALFC
FT                   DVIVCDYNYLFDPVVYLKRFFAEGPGKYTFLVDEVHNLVDRARSMYSATLKKSAVMQVK
FT                   RGLDAKNNKRLLNAINVMNKDMIALNKKLKDLDGTIYVQKNELIDWNESVLKFTFVAKE
FT                   WLPQNTQSEIQADVLELYFESLRYVAIADFYDDRYVTQVTKSHGDLEIKQVCLDPSFLL
FT                   SERLKLGSSSVLFSATLRPIDYYTNLLGGQEDTSRMIFSSPFKQKNMHLLVADYISTKY
FT                   QMRENSMEAVVDALYALVSGENGNYLFFFPSFLYLQKVYDLFKEKYPNIRLQKQETAMD
FT                   EERREHFLERFQAENVETLIGFCVLGGVFSEGVDLRGNRLVGAAVVGVGLAQLNHESDL
FT                   IKDYYNETIGRGFDYAYQIPGMNKVLQAVGRVIRGESDRGVVLLIEERFSADRYRALFP
FT                   THWNHAKTVKSTDDISREVAGFWRNS"
FT   regulatory      155982..155987
FT                   /gene="lmo0158"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        155993..156805
FT                   /transl_table=11
FT                   /gene="lmo0158"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="GOA:Q8YAG8"
FT                   /db_xref="InterPro:IPR000150"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:Q8YAG8"
FT                   /protein_id="CAC98373.1"
FT                   /translation="MYKIIAIDIDGTLLNDTHEITPAVRDSIKAAKAKGVKVVLCTGRP
FT                   LAGIKKSLIELDLLDEGDYAITFNGAVVLETASEKTLADITLNKTELEEIYAFCHAENV
FT                   NVTYFDGKNMYVPSRKITEITCQDSLLLGTPLYHLPVEEAPESIHVSKVMLLDSPEKIT
FT                   DVIKKLPENIKEKFYVVRSVPYNLEFLQKGVNKGSALASLADKLGVDQSEVMSIGDQEN
FT                   DITMIEYAGMGVAMGNATEHIKEIANYTTTTNNEDGVAQAIQMLILDR"
FT   regulatory      156885..156924
FT                   /gene="lmo0158"
FT                   /regulatory_class="terminator"
FT   regulatory      157075..157080
FT                   /gene="lmo0159"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        157089..159470
FT                   /transl_table=11
FT                   /gene="lmo0159"
FT                   /product="putative peptidoglycan bound protein (LPXTG
FT                   motif)"
FT                   /db_xref="GOA:Q8YAG7"
FT                   /db_xref="InterPro:IPR008456"
FT                   /db_xref="InterPro:IPR008966"
FT                   /db_xref="InterPro:IPR011252"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR019931"
FT                   /db_xref="InterPro:IPR041033"
FT                   /db_xref="InterPro:IPR041171"
FT                   /db_xref="UniProtKB/TrEMBL:Q8YAG7"
FT                   /protein_id="CAC98374.1"
FT                   /translation="MSKNGNFLKKVGLAFLSILIVASTIFQTTVVKAATSYGSQFLNTV
FT                   ELLDKDGVPQTDFGYYDNMDVHYTWSIPNSTNVKAGDTMDFTLPSQLALATDLAFDVKD
FT                   SKGQVVGTATVKKATNQVTLVFSDYVEKHSDVKGELDFWTAFNQKVITGNETVDLVFPL
FT                   ENGTTVIDVEVGEKTPVSPTETLFKYGWVDASNPSLIHWVVRVNYAKVNIPNAVFTDII
FT                   GAKQTLNFDSIKAFHGTYSADRVFTAGAPISSTNFSATSDGFSVALGNLTDSVQISYTT
FT                   TTTDGGKSTQYDNTAKLAGTDFVTKQTSTWTPASGGGGEGGGTTGSVTLTKEDAKTKAT
FT                   LEGAEFKLVDSKGTVLQENITTNASGQLSIADLKFDTYQLIETKAPTGYKLDTTPVEFT
FT                   IGENNQAITVTKENTLNTGSVELTKLDAATKATLAGATFELQDKEGNTLQTDLKTDENG
FT                   VLKVTDLVPGSYQFVETSAPTGYKLDNSPVSFEVIAGETDQVVKVTKENTLEVGSVELT
FT                   KLDSATKATLAGATFELQDKEGNTLQTDLKTDENGVLKVTDLVPGSYQFVETSAPTGYK
FT                   LDNSPVSFEVVAGETDQVVKVTKENTLEVGSVELTKLDSATKATLAGATFELQDKEGNT
FT                   LQTGLTTDENGVLKVTDLVPGTYQFVETKAPIGYELDTTPVSFEIVAGETDPIVKVTKE
FT                   NTLVPPTPVPPTPVPPTPVPPTPVPPTPLPPVPYEPTVPPTKPEVPVTPKKTENSEDSP
FT                   KTTPIRITQSLPKTGDTNSFAGLGVILIALSLSGLLLKRK"
FT   regulatory      159477..159513
FT                   /gene="lmo0159"
FT                   /regulatory_class="terminator"
FT   regulatory      159649..159654
FT                   /gene="lmo0160"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        159663..161378
FT                   /transl_table=11
FT                   /gene="lmo0160"
FT                   /product="putative peptidoglycan bound protein (LPXTG
FT                   motif)"
FT                   /db_xref="GOA:Q8YAG6"
FT                   /db_xref="InterPro:IPR008456"
FT                   /db_xref="InterPro:IPR008966"
FT                   /db_xref="InterPro:IPR011252"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR019931"
FT                   /db_xref="InterPro:IPR041033"
FT                   /db_xref="InterPro:IPR041171"
FT                   /db_xref="UniProtKB/TrEMBL:Q8YAG6"
FT                   /protein_id="CAC98375.1"
FT                   /translation="MKERTTMMSNLKKFGLAFLSVILLVNVIFQTNFVKAATNYGSDFL
FT                   KTVELLDADGNPQTDFGYYDSIKVHYTWEIPNSTNVKEGDTMEFVLPPELKIVTDLDFS
FT                   LKDHDGNTVGHVIAKKSTGQVVITFTDFVEKNSNISGYLDFWTNWDKSLVEGNENVPVE
FT                   FPVNGTTETIDVGVGGKNQIDPDESLYKYGWADAENPELIQWVVRVNYSKQNIQNAVYE
FT                   DFIGPKQVVDFNSIKAFHGEFDPDDNFTPGAEVPSSAITQTTDGFKVDLGNLTDSVKIS
FT                   YYTTSTDNGASPNYTNKGQLTGDNFIKQEIEVATPTSGGGGGGEGTTGSVELTKTDDSS
FT                   QKNPLEGAEFKLVNGAGATVQTGLKTNADGKLAISNLKYDTYQLIETKAPQGYVLDASP
FT                   VKFTIDDTHQSLFVSKENTAIKGSVSLEKVDRDTKSLLADAEFELQDKDGNTLKTNLKT
FT                   DQKGKLTVADLLPGEYQFVETKAPTGYILDTTPLKFKISTEALNVTVTKENTKKPEIPK
FT                   VPVPPKKPEKPDKIISEDSKQTALPKTGDSPLVNGWGLLLVAISASGLIALRRK"
FT   regulatory      complement(161375..161413)
FT                   /gene="lmo0161"
FT                   /regulatory_class="terminator"
FT   regulatory      161386..161424
FT                   /gene="lmo0160"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(161420..162250)
FT                   /transl_table=11
FT                   /gene="lmo0161"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="InterPro:IPR038284"
FT                   /db_xref="UniProtKB/TrEMBL:Q8YAG5"
FT                   /protein_id="CAC98376.1"
FT                   /translation="MNESNGSMELYLREHTEEIINNWLSKIYENTYTSFVYSPQYKDEL
FT                   RADSEQTADLIISYFAGKKAFFEKLDKWLDNMYARRMENEVPLPEVITTLDKLRREFVT
FT                   AVGDFCIHNDEVSKCEFSSSMAMVNHGFDRINEAFSAMYYNDIVKHLEQQHRLIEEIST
FT                   PVISITDKLAILPLMGRVDRERAEKLSEITANKCVHLGVEQLCIDLSGITYFDDALGEM
FT                   LTNLVTMLKLLGVEAFISGIQPKMAQQINRVDLNLSIPAYHSLKAVLQDQTRTI"
FT   regulatory      complement(162260..162265)
FT                   /gene="lmo0161"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      162455..162460
FT                   /gene="lmo0162"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        162467..163459
FT                   /transl_table=11
FT                   /gene="lmo0162"
FT                   /note="similar to B. subtilis DNA polymerase III (delta'
FT                   subunit)"
FT                   /db_xref="GOA:Q8YAG4"
FT                   /db_xref="InterPro:IPR004622"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q8YAG4"
FT                   /protein_id="CAC98377.1"
FT                   /translation="MGLQDELTMMQPVVMKIFSKSVRENRLSHGYLFEGTRGTGKKRTA
FT                   LWLAQSLFCLESTETELACGKCTNCTRIASHNHPDVHLLEPDGASIKIDQVRALKQELS
FT                   KRGMESDQKVVIIYDAEKMTVQSANSLLKFIEEPEGGLLLLFLTTNPGQILPTIQSRLQ
FT                   PVTFKSLTFDSLLASLTAAGISEQKARIYASITGSVEEAKAFEESEWFSEARNVVIKLY
FT                   EGIHHQGTSPLIIIQESWMPLFKEKDKMALGLELLLLLYRDRLHLTLDENYEPICTAQK
FT                   EMLGQDALRKSLSETTGEIEKILAAKSKLDSNMNTQLLMEQLVLEIQGR"
FT   regulatory      163451..163456
FT                   /gene="lmo0163"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        163465..164298
FT                   /transl_table=11
FT                   /gene="lmo0163"
FT                   /db_xref="GOA:Q8YAG3"
FT                   /db_xref="InterPro:IPR007557"
FT                   /db_xref="UniProtKB/TrEMBL:Q8YAG3"
FT                   /protein_id="CAC98378.1"
FT                   /translation="MLKIVGVRFKDVGKIYYFSPGELEITENQGVIVENAQGIEFGKTV
FT                   IEPRYVDEEDVVLPLKKVLRIATEADYKCVAENGDSCQKAFLLCDEKIRERELEMSLVD
FT                   VDYTFDRNKIIFYFTAEGRVDFRELVKDLASVFRTRIELRQIGVRDEAKLLGGIGPCGR
FT                   MLCCSTFLGDFEPVSIKMAKDQNLSLNPTKISGLCGRLMCCLKYENDEYEQAKREMPDV
FT                   GVKVKTPEGAEARVSGINLLSRILQVSLPEEETVIEYELDELRPYNEFLKQPAKS"
FT   regulatory      164295..164300
FT                   /gene="lmo0164"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        164309..164698
FT                   /transl_table=11
FT                   /gene="lmo0164"
FT                   /note="similar to B. subtilis YabA protein"
FT                   /db_xref="GOA:Q8YAG2"
FT                   /db_xref="InterPro:IPR010377"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8YAG2"
FT                   /protein_id="CAC98379.1"
FT                   /translation="MDKKAIFDSVSNMEEQIGELYQQLGDLKTNLGEMLEENNRLNLEN
FT                   EHLRRRLSLTDEATPEPKAETEAEHGVMAPNRKEAMQQMIELGEGYDNLVQLYKEGFHV
FT                   CNVHFGSPRGNDEDCLFCLSLLNKK"
FT   regulatory      164742..164747
FT                   /gene="lmo0165"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        164756..165508
FT                   /transl_table=11
FT                   /gene="lmo0165"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="GOA:Q8YAG1"
FT                   /db_xref="InterPro:IPR007848"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q8YAG1"
FT                   /protein_id="CAC98380.1"
FT                   /translation="MEKLKLIGDERLDYLLAENLRIIQSPSVFSFSIDAVLLAKFSYLP
FT                   VRKGKIIDLCSGNGIIPLLLSTRTEAQIVGVEIQERLADMAKRSISYNQLEEQIEMIEY
FT                   DLKNITDLIPKERADIVTCNPPYFATPDTSLKNTNEHFRIARHEVMCTLEDTIRVAASL
FT                   LKQGGKANFVHRPERLLDIIDIMRKYRLEPKRIQFVHPRIDKEANTVLVEGIKDGKPGV
FT                   KYVPPVIVYDELGEYTPVIKEILYGESE"
FT   regulatory      165480..165485
FT                   /gene="lmo0166"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        165492..165764
FT                   /transl_table=11
FT                   /gene="lmo0166"
FT                   /note="similar to B. subtilis YazA protein"
FT                   /db_xref="InterPro:IPR000305"
FT                   /db_xref="InterPro:IPR035901"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8YAG0"
FT                   /protein_id="CAC98381.1"
FT                   /translation="MAKASEHFFYVLKCSDNSYYGGYTTDVLRREAEHNAGIRCKYTKT
FT                   RRPVKVIHFEKFETRSEATKAEAAFKKLSRKNKDAYLIQREEESE"
FT   regulatory      165748..165753
FT                   /gene="lmo0167"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        165761..166642
FT                   /transl_table=11
FT                   /gene="lmo0167"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="GOA:Q8YAF9"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR008189"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR018063"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:Q8YAF9"
FT                   /protein_id="CAC98382.1"
FT                   /translation="MIKSQKSFSGTSQGALYLVPTPIGNLEDMTFRAIRMLKEADIIAA
FT                   EDTRNTVKLLNHFEITTRMTSYHQFTKENKEDNIIQRMLGGEVVALVSDAGMPSISDPG
FT                   YELVQSALDANIPVIPLPGANAALTALIASGLAPQPFYFYGFLPRQNKERTQAIEKLAA
FT                   REETWILYESPHRLKETLKAIIKITGNDRKIVLCRELTKRFEEFLRGTVEDALNWAMDE
FT                   EIRGEFCLIIEGNSNPQLAEEQLWWQELDIKTHVSTVMEQENVSSKDAIKTVMKARNLP
FT                   KREVYSAYHEIK"
FT   regulatory      complement(166635..166681)
FT                   /gene="lmo0168"
FT                   /regulatory_class="terminator"
FT   regulatory      166646..166692
FT                   /gene="lmo0167"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(166687..166971)
FT                   /transl_table=11
FT                   /gene="lmo0168"
FT                   /note="similar to B. subtilis transcription regulatory
FT                   protein AbrB"
FT                   /db_xref="GOA:Q8YAF8"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="InterPro:IPR037914"
FT                   /db_xref="InterPro:IPR040678"
FT                   /db_xref="UniProtKB/TrEMBL:Q8YAF8"
FT                   /protein_id="CAC98383.1"
FT                   /translation="MKSTGMVRKIDELGRVVIPIEIRRTMNLNVKDPLEIFTDEDAIIL
FT                   KKYSAGLVCDVTGEFSVDNKKFVDGKLTLSKEGAAALMEEIKRRFGDTL"
FT   regulatory      complement(166979..166984)
FT                   /gene="lmo0168"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      167072..167077
FT                   /gene="lmo0169"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        167086..167943
FT                   /transl_table=11
FT                   /gene="lmo0169"
FT                   /note="similar to a glucose uptake protein"
FT                   /db_xref="GOA:Q8YAF7"
FT                   /db_xref="InterPro:IPR010651"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8YAF7"
FT                   /protein_id="CAC98384.1"
FT                   /translation="MNIVIALIPAVMWGIMPLVVSKIGGKPRQQIIGTTFGALAFAIGV
FT                   FIFTNPEYTATIIIASFVSGAFWSLGQMNQFRAFTQVGVSKTMPLSTGMQLVGTSLFGV
FT                   FAFHEWGTTSKLVLGFSALALIIIGIFLTSYQQHKDENSGQNMKKGIITLLISSVGYVG
FT                   YVVITRWFDISGWDAILPQAIGMVVAGLLFSIKSEEKRFTKQTWLNMIPGVMWATGNLA
FT                   LLFSNKLVGIATGFSLSQMGVVISTIGGILFLGEKKTKKELILVIIGVVLVIIGGTMIG
FT                   IAKS"
FT   regulatory      167994..167999
FT                   /gene="lmo0170"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        168005..169270
FT                   /transl_table=11
FT                   /gene="lmo0170"
FT                   /db_xref="InterPro:IPR010621"
FT                   /db_xref="InterPro:IPR010679"
FT                   /db_xref="InterPro:IPR037049"
FT                   /db_xref="InterPro:IPR037050"
FT                   /db_xref="UniProtKB/TrEMBL:Q8YAF6"
FT                   /protein_id="CAC98385.1"
FT                   /translation="MIMNANLEVNAELVKESYVYLLSRYLVLRQENFDTKEDKIPYNTL
FT                   KHNSVSPADANFVNPNFDVVYSEAWIAVDDEHAVVLEVPEIKNRYYTVQLLDGWGEVVT
FT                   NINERNFPEHPHGKFAFVKKGTNPSIPSDAIKIELPSEKVKVLLRVEQKDDPEGAVKLQ
FT                   KAFKFDAPDNIKIKEPLEIPHFTNAEFLLEEIYSNLEELLATYPDKMPKAAEFQDKARK
FT                   VAAYIELGDDQKAEVRNLIVKEALPYFTNGAKGFGTQKGGWSVTYVAGAFENDILARAI
FT                   INYGGIWANSIQEALYFIGQKGTDDELLTGDKIYKIHFSADELPAELANAFWSVTLYSV
FT                   PDYHVIPNELNKFCINNYTGPKLSEDGSLTLYIASEKPADVDPGNWLPSKAGKEFSLNF
FT                   RLYVPKKEVLEGKVFLPPLEVF"
FT   regulatory      169283..169326
FT                   /gene="lmo0170"
FT                   /regulatory_class="terminator"
FT   CDS_pept        169510..172008
FT                   /transl_table=11
FT                   /gene="lmo0171"
FT                   /note="similar to internalin proteins, putative
FT                   peptidoglycan bound protein (LPXTG motif)"
FT                   /db_xref="GOA:Q8YAF5"
FT                   /db_xref="InterPro:IPR009459"
FT                   /db_xref="InterPro:IPR012569"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR019931"
FT                   /db_xref="InterPro:IPR019948"
FT                   /db_xref="InterPro:IPR032675"
FT                   /db_xref="UniProtKB/TrEMBL:Q8YAF5"
FT                   /protein_id="CAC98386.1"
FT                   /translation="MRKIPVVVSLALCFSLVSPSLYASADTITAVQITKEATTDTTEPT
FT                   TIDQPSRMDNSQTAPQKMTASSSEEAATTNSTEEENTPKNNLKSTSENSKTYAELFPDV
FT                   NLAKIIAKNISGTEDINAEVSEAELQTITNLVATNQNITSLTGIEHLTALENINVNNNE
FT                   LTTIDSLFNIPTLKSISANNNKITGNFSLVKTLPELHTLEVLGNAITELDIENQPNLVT
FT                   LSADELELKKLTLKNLSQLNGLGRIASSISIDWGDLESVTLMNLPEIISVDISGNYLDS
FT                   DDIHLENLPAVKNLDISSNELTRLPKINDFPLLTTINVRSNKIDRLESSKLVDVPKLAT
FT                   LNADKQAVTLSKTIAAGNFTIPNNVENLAGQMVTPKIISNNGTYSDQSIAWASGELSGL
FT                   SKVSYTFDEVINSPAIAGKYTGTVNQPIEVKAVPVIVADKSVSYAPVNAKDEATFLQDI
FT                   RASASENAQITSDYSEVVDFATPGDYTVTLHAKNEFDLKADPVTVVVHINDIQKPQVAV
FT                   NSNDISFEVGTELTSEVLLAKSGAVVTDLYDEAIKMEVDLSEVDSSKLGTYEATIIAKS
FT                   KSGASSDPIKLSVKIVDTEKPIIQINNPEIIIEKGSELTEGQIIDQVGITATDNYDQDL
FT                   NIHMDLSKVDTSKPGSYEVTIYTEDSSGNRSETVTITVKVPEARIGKITIQYMDSENNE
FT                   LAESNTITGEVGETYETLAKEIEGYTLKENPANSSGVFEETRQTIQYIYVKDIINPEFP
FT                   VYSENNVTPELPSNNNNSVNGSRQTPSKSVKKQSKAYSKINQMPMNLPETGDSTNLLFI
FT                   FMGVLLLAGLTLSKAKRKNQ"
FT   CDS_pept        complement(172072..172458)
FT                   /pseudo
FT                   /transl_table=11
FT                   /gene="lmo0172"
FT                   /note="similar to transposase C-terminal part"
FT   regulatory      172073..172127
FT                   /gene="lmo0171"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(172410..172931)
FT                   /pseudo
FT                   /transl_table=11
FT                   /gene="lmo0173"
FT                   /note="similar to transposase (N-terminal part)"
FT   CDS_pept        complement(172903..173208)
FT                   /transl_table=11
FT                   /gene="lmo0174"
FT                   /note="similar to transposase"
FT                   /db_xref="GOA:Q8XFU0"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:Q8XFU0"
FT                   /protein_id="CAC98389.1"
FT                   /translation="MSTRVMYPAEIKEKAIKMKLAGKSTKEIMRTLNIKNPTQVKTWWR
FT                   WYRNEETHRFHQGVGKQYKYQKGVPELPEIEQLKIALRQKELELEILKKYKALERK"
FT   regulatory      complement(173216..173221)
FT                   /gene="lmo0174"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(173309..174556)
FT                   /transl_table=11
FT                   /gene="lmo0175"
FT                   /product="putative peptidoglycan bound protein (LPXTG
FT                   motif)"
FT                   /db_xref="GOA:Q8YAF4"
FT                   /db_xref="InterPro:IPR009459"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR019931"
FT                   /db_xref="InterPro:IPR019948"
FT                   /db_xref="UniProtKB/TrEMBL:Q8YAF4"
FT                   /protein_id="CAC98390.1"
FT                   /translation="MFNKKKTIASLIVLSSLASQIALTPISALADTHDTNNIALLQNTN
FT                   ENVPYKYTSTLTFPTLTNQTQEDYKLEIKLALPSGMNYTDLQVSVGGEDITNQVGTTSF
FT                   DNSTNTVTFKFDKVTSWDSLSKAKVKFDWKTSYSGEGGEAKIDSLVATATATSEDKAGN
FT                   KSTSTGSLKPKDISAPVVKAEETEITYSPGSDVTEEQFLTDIHASVTDNYDSTISLTSN
FT                   FTSAVNLAVSGDYSVNVQATDKAGNVSNTLNVTVHVSTPAPVAGANITVNHLDSNGNKI
FT                   AESDTLTGVVNSNYQSESKKITGYTLETTPTNATGTFTDTPQTVDYIYKKDTVTPTPIT
FT                   VNPVEPVKPVNPVVNKPVTVKPANDNTNPSTSNSVEKTTYSSLPTTGDTDQSKSSTIFG
FT                   ALLLLISAPLLLFKKK"
FT   regulatory      complement(174568..174573)
FT                   /gene="lmo0175"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      174820..174825
FT                   /gene="lmo0176"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        174834..175694
FT                   /transl_table=11
FT                   /gene="lmo0176"
FT                   /note="similar to glucose uptake protein"
FT                   /db_xref="GOA:Q8YAF3"
FT                   /db_xref="InterPro:IPR010651"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8YAF3"
FT                   /protein_id="CAC98391.1"
FT                   /translation="MNIMIALIPALLWGTVPLIITKFGGSTRQQTMGMTLGALTFAVIV
FT                   FFFTDPVYTLKTVGISFITGCLWTVGQMFQLQAFKIIGVSKAMPISTGMQLVGTTLCGV
FT                   ILFHEWDTTLRIILGFIALALIVGGIFLTSYAEKEEDGTNALKQGLITLFISACGYVGL
FT                   VVLIQGFKIDGINAILPQAIGMVISALIMTHSGGTEKRFNKRTLLLTIPGVIWAAGNVA
FT                   MVHANQLVGVATGFSLSQLGVVISTIGGIILLKEKKTQKEMLFVIVGVVLVVLGGILIG
FT                   VAKGA"
FT   regulatory      175752..175757
FT                   /gene="metS"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        175766..177760
FT                   /transl_table=11
FT                   /gene="metS"
FT                   /product="methionyl-tRNA synthetase"
FT                   /db_xref="GOA:Q8YAF2"
FT                   /db_xref="InterPro:IPR002547"
FT                   /db_xref="InterPro:IPR004495"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014758"
FT                   /db_xref="InterPro:IPR015413"
FT                   /db_xref="InterPro:IPR023457"
FT                   /db_xref="InterPro:IPR033911"
FT                   /db_xref="InterPro:IPR041872"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8YAF2"
FT                   /protein_id="CAC98392.1"
FT                   /translation="MPEEKNTFYITTPIYYPSGKAHIGHAYTTVAGDAMARYKRLKGYD
FT                   VFYLTGTDEHGQKIQAKAKERGISEQEYVDEIAEGFQELWKKLEISNTDFIRTTQDRHK
FT                   TSVEKIFEQLLEQGDIYLGEYEGWYSVSDEEYFTETQLEEVYKDENGKVIGGKAPSGNE
FT                   VELVKEESYFFRMSKYADRLVEYYNSHPEFILPESRKNEMINNFIKPGLEDLAVSRTTF
FT                   DWGIKVPGNPKHVVYVWIDALSNYITALGYNTDNDTKFQKYWPADVQIVGKEIVRFHTI
FT                   YWPIMLMALDLPLPKMVFGHGWILMKDGKMSKSKGNVVDPYMLIDRYGLDALRYYLLRE
FT                   VPFGSDGLFTPEDFVDRVNFDLANDLGNLLNRTVAMINKYFDGEIPAYQGNVTEFDQIL
FT                   VDFKNNVVKEYEGSMDHMQFSVALNQLWSLISRTNKYIDETAPWALAKDEDKRTELASV
FT                   MTHLAENLRIIAVLLQPFLTRTPGEIFLQLGLQEENLKKWDSIYGYGEIPAGTTVVKKG
FT                   TPIFPRLDAEVEVTYIQDEMKGSAPAPAEEVAEVEALETPQIGIEDFDKIDLRVAEVKQ
FT                   VDKVKKADKLLCFQLDLGEGKLRQVLSGIAEFYQPEELIGKKVIVVSNLKPVKLRGLMS
FT                   EGMILSGEKDGKLSVIEASSALPNGAKVK"
FT   regulatory      177768..177807
FT                   /gene="metS"
FT                   /regulatory_class="terminator"
FT   regulatory      177912..177917
FT                   /gene="lmo0178"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        177924..179138
FT                   /transl_table=11
FT                   /gene="lmo0178"
FT                   /note="similar to xylose repressor"
FT                   /db_xref="GOA:Q8YAF1"
FT                   /db_xref="InterPro:IPR000600"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="PDB:5F7P"
FT                   /db_xref="PDB:5F7Q"
FT                   /db_xref="PDB:5F7R"
FT                   /db_xref="UniProtKB/TrEMBL:Q8YAF1"
FT                   /protein_id="CAC98393.1"
FT                   /translation="MDILRKGNKDLIKDINRYTVLNLIREKGEITRTEIAKKCDFGMST
FT                   LTYILDDLQQEGIILEGAETSSTGGRRAKLVRFNKDYGFVVSVKVEEEQLLFALTDLNA
FT                   EIIENTSIPFSSEKKPEEAIELIAKNVKKMCGNRDMNHLLGVGIAISGLVNRKKGTVIR
FT                   STMLGWENVALEAMLHAHFPDIPVYVDKNINCYTLAELWLGEGKQSNNFATVSVGAGLG
FT                   LSVVINRQIYYGAQGGAGEFGHTTIQPGGYKCHCGQKGCLEMYASEFYFRNRGEELKEA
FT                   YPTSELNDFHFDKVAKSARAGDEMATELMGKMGEYLGYGIRNIINTFNPEKVIIVGEGL
FT                   HHRDLFLTKIDEIASQNFFSGAGFETEITTTSLEDPAWLQGAALLVIHQLFQVPIYEEE
FT                   QTLLR"
FT   regulatory      179158..179163
FT                   /gene="lmo0179"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        179174..180052
FT                   /transl_table=11
FT                   /gene="lmo0179"
FT                   /note="similar to sugar ABC transporters, permease
FT                   proteins"
FT                   /db_xref="GOA:Q92F88"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q92F88"
FT                   /protein_id="CAC98394.1"
FT                   /translation="MVGMTRKKTLFWLCIFLLPNLLGFLIFIAIPILGSLGISFTDWDL
FT                   VSTIHFTGFENYKRLFNDPEFWKSFRNTITFIIGYLPSVMILGLACALMLNQKIKLRPF
FT                   FRAVYFLPVITSWVAVSLVWKWLFNPSYGLINYFLSLIGIAGPNWLTDPQTAMIAVIIT
FT                   SAWKDIGFVMVLFLGGLQNISPSYYEAANMDGASKLRQLFSITIPLLTPTTFFVTIISL
FT                   INSFQVFDQVMIMTEGGPSGATMTLVQNIYNHAFRYFEMGYASAMSWILFIVIFIITII
FT                   QNKLQKRWSNY"
FT   regulatory      180035..180040
FT                   /gene="lmo0180"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        180052..180900
FT                   /transl_table=11
FT                   /gene="lmo0180"
FT                   /note="similar to sugar ABC transporter, permease protein"
FT                   /db_xref="GOA:Q8YAF0"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q8YAF0"
FT                   /protein_id="CAC98395.1"
FT                   /translation="MKTEKSGSPKWQLFKNILTYTIICLGGIIMLMPFVWMVSTAFKTG
FT                   AANMVLPPQFIPKEPTTANFTQVFEMFPMLRFLVNSVIVAVVTTLGQMLFCSMAAYAFA
FT                   RIPFWGRDKLFLLYLATMMVPAQVTMIPQFILMKQFGWLDSYAGLIVPALFSVFGTFLL
FT                   RQAFMGIPKELEEAAFMDGANHFTIFRKVILPLAKPTFATLGILTFMQSWNSYLWPLIV
FT                   TSSQEMATLPLGLSLLQGRYGTNYGLMMAGVLISVIPILAVYLFAQKYFIQGMAMSGMK
FT                   E"
FT   regulatory      180915..180920
FT                   /gene="lmo0181"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        180928..182184
FT                   /transl_table=11
FT                   /gene="lmo0181"
FT                   /note="similar to sugar ABC transporter, sugar-binding
FT                   protein"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="PDB:5F7V"
FT                   /db_xref="UniProtKB/TrEMBL:Q8YAE9"
FT                   /protein_id="CAC98396.1"
FT                   /translation="MKKGLLLLMVVVLSVFGLSACGGGSSSGDKTEITYYQFSAPADGK
FT                   ALDEMVKEFEKQNPDIKVNVQTIAFNDYFTKLQTQIAGGDAPDAFELNYETFMQYAEKG
FT                   VLADLTSYIEKDKDFDPSTLNKQAYDAFKYDGKQYGMVESFSNVVTIYNKDLFDKAGVE
FT                   YPTADWTWKDEEAAAKKLTDAKNKVWGTSQPVTMNEFYKVAAQNGGSIFNEDLTETTIN
FT                   SPENVEALTHLTNEVTDSKVAPSPADLSGQLPEDLFMNGQIAMLHTGIWLFDMFQDAPF
FT                   KWDVQVEAGNTQKATHFFANGIGVSKDSDKKEAAFKFASFMSANEEAAKIRIDNNWELP
FT                   ATENKEILQPYLDATPPDNREAVFESLQYMVLPPVVKDWNKISDYTNSEFEKVLNGDST
FT                   PEKALKNSEDNINKTMGFK"
FT   regulatory      182255..182260
FT                   /gene="lmo0182"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        182267..185569
FT                   /transl_table=11
FT                   /gene="lmo0182"
FT                   /note="similar to alpha-xylosidase and alpha-glucosidase"
FT                   /db_xref="GOA:Q8YAE8"
FT                   /db_xref="InterPro:IPR000322"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR025887"
FT                   /db_xref="PDB:5HOP"
FT                   /db_xref="UniProtKB/TrEMBL:Q8YAE8"
FT                   /protein_id="CAC98397.1"
FT                   /translation="MSKFTKLMQGYLHLIEGKNEKIKPILLETKPNFTTDSVLETASWL
FT                   WLSSKINHYDREEVEPVIAFLVENWNRPEKSIWGSAENDIYLATISSVYSALLDVKNTF
FT                   PKPELQQTITIIRDYCFDNLLKGDSILTGFNTRKVSTDQLLSVLPFGLFSPEDLVMVAA
FT                   VGKMEQQLVQDDGVLPYSGAPRVNSFATALMALYFLEKSDQDKALHYLNMAMKMEDNDE
FT                   LGAIFIEINQAFRAMESEVTAHISHDPFGHENRYEQQLTERTPHYPETEMHFSAACEVI
FT                   SEVEPIQVELVLKEKDWTILCEKKEKNDVQIWEALVPPLEEVGEYTYYFQATMKDQTTL
FT                   TSDDYKVEPIWKHWSEEAAICETEQGLMVLFKENPSSIIPVEFTVKSDELVIGLKPSFE
FT                   ASNVKTKSSGQLKKDDLEIIVSNNPVRLEVHFKGKLILESHKIYPALQWYTDKTGTINK
FT                   VKLHLDAPKEEEYYGFGERYNALGQRGNVLDCFVYNQYRDQGTRTYIPMPFYHTNRDYS
FT                   VFVDTARYTSFDLGNQLADKHTITVEINGCDTDICLLMGDIRSAVANYMKKTGKPAMVP
FT                   VWALGPWMSSNNWDRESVVRNEVETTQELQIPSTVVVLEQWSDEATYYMFNDAEYDEKA
FT                   PSEAYSYDEIRFPSWGRWPDPKGMVDYIHDNKMKLILWQIPIQKYLNRQQHPLKDREEA
FT                   YMIEKGYVVKNPDGSPYRIPENWFTESLIMDFSNEEGKKWWFDKRQYLIDIGVDGFKTD
FT                   GGEFVFGEGLQFADGRRGDEMRNLYPNDYVEAYYQFAQQNEGMTFSRAGYTGAQNFPAH
FT                   WAGDERSTFDAFRRSLIAGLSAGFSGIPFWSFDFAGFNGDIPTAELFIRSAEMATFCPI
FT                   MQYHAESKAEFNQDRTPWNIASRTGDDSVIPIYRHFANVRMNILPYIYNESLKCVETGL
FT                   PMMRALLLDYKEDPRVSDMYDQYLFGEAMLIAPVIEDGVRSREVYLPEGTWYDFWNGTK
FT                   VSGPTLRKCKADKEEIPVFVRGGKAVLCNVDATLKLGSWVGNTVEEYDTPLLKVYLDGD
FT                   FTEEITDHLFGKWLVKVTENADEVIVSVQTNTASYEVEVIGTTKKVQIKKGR"
FT   regulatory      185560..185565
FT                   /gene="lmo0183"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        185572..187863
FT                   /transl_table=11
FT                   /gene="lmo0183"
FT                   /note="similar to alpha-glucosidase"
FT                   /db_xref="GOA:Q8YAE7"
FT                   /db_xref="InterPro:IPR000322"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR025887"
FT                   /db_xref="InterPro:IPR030458"
FT                   /db_xref="InterPro:IPR033403"
FT                   /db_xref="UniProtKB/TrEMBL:Q8YAE7"
FT                   /protein_id="CAC98398.1"
FT                   /translation="MDASTSFAILPSNVKQKTAFERKVNQVKAASWTNNCLTGTLDIGQ
FT                   FSCYFVNEKIARVTVNPFGEVDLTPSIAAIHDNEKQAAKFTETNDCYELHFADKEVIVC
FT                   KNPFQIIMKQAGKRIFQTEGLAINRDKEHQISIQSEPGTAIFGLGEKTGALNKAGSIIS
FT                   MWNTDVYSPHNKDTVELYQSIPFMIADTAKTTYGLFYDNSHRTEFDFQSFEEMYTVLAE
FT                   GGQANLYIIFGEDVKEVVANYTDLTGKTPLPPKWSLGYHQSRYSYTSEEEVERIANTFK
FT                   EKEIPLDCVFMDIHYMDDFRVFTFNPDTFPNGPELIARLREQNIDVVPIVDPGIKKDVD
FT                   YSVYQEGIKNNYFCTKLEGSIYYGDVWPGVSAFPDFLSTTVQHWWGSLHKFYTDLGIRG
FT                   IWNDMNEPSVFNESKTMDLDVVHNLDGKNVTHKEAHNLYGLYMSKATFEGLKRLVPNER
FT                   PFSLTRAGYAGVQRYSAVWTGDNRSHWEHLEMSLPMIMNLGLSGVAFTGADVGGFSSDC
FT                   TKEMLIRWTQAGAFLPYFRNHCVQDSIYQEPWAFGADAEKIVKQYIELRYAFLPYIYTE
FT                   FQKTAESGLPLVRPLYMEFKDERDLIQVNDQFMLGENILVAPIVREGQAKRLVRLPKGL
FT                   WFNYWTKEQFVGGDYIIADAPIDTMPIYIKAGTILPVGSSVQNTKETQELTLEVYLDSE
FT                   TATGYVYNDDGKSYQYESGAVSKTTLTATFKNGEVLINATHQGEANLQQKVTTIQVFGE
FT                   KIDKITRAGI"
FT   regulatory      187849..187854
FT                   /gene="lmo0184"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        187867..189528
FT                   /transl_table=11
FT                   /gene="lmo0184"
FT                   /note="similar to oligo-1,6-glucosidase"
FT                   /db_xref="GOA:Q8YAE6"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="PDB:5DO8"
FT                   /db_xref="UniProtKB/TrEMBL:Q8YAE6"
FT                   /protein_id="CAC98399.1"
FT                   /translation="MKEKDWWKKSVVYQIYPKSFNDSNGDGVGDIQGIIEKLDYLKELG
FT                   VDVIWLSPVYDSPQDDNGYDIRDYQKIYEEYGDMATFDQLLQGLHDRDMKLVMDLVVNH
FT                   TSDEHKWFEESRKSKDNPYRDYYFWREENEINNWGSIFSGPAWELDEKTGEYYLHLFSK
FT                   KQPDLNWENPKLRQDVYNMMKFWLDKGIDGFRMDVINFISKNTDFPDGPVPDGQIYGDA
FT                   GNDFCNGPRIHEFLQEMNQEVTSKYDVMTVGEMPGASTTDAQIYTNPANNEVDMIFTFE
FT                   HMNLDSDSDNKWDLKPIYLPDLKENMSEWQVALQENGWNSLYWNNHDQPRIVSRFGNDN
FT                   RFRVRSAKMLATCLHMMKGTPYIYQGEEIGMTNVHFETLDDYRDIETLNMYKERKEQGH
FT                   SHESIMQSIYTKGRDNARTPYQWDNSENAGFTTGTPWLKVNPRYTEINNEEALKNPDSI
FT                   FYYYQNLIKLRKTTEIITTGNYRLLLPKDEAIFAYERYTENEKLVVLCNFTEEEQVISD
FT                   ETILNEIQKGSVLVNNVPNIIEGTLRPYEAIVYQIK"
FT   regulatory      189540..189570
FT                   /gene="lmo0184"
FT                   /regulatory_class="terminator"
FT   regulatory      189612..189617
FT                   /gene="lmo0185"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        189625..190398
FT                   /transl_table=11
FT                   /gene="lmo0185"
FT                   /note="similar to conserved hypothetical proteins"
FT                   /db_xref="GOA:Q8YAE5"
FT                   /db_xref="InterPro:IPR001130"
FT                   /db_xref="InterPro:IPR015991"
FT                   /db_xref="InterPro:IPR018228"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:Q8YAE5"
FT                   /protein_id="CAC98400.1"
FT                   /translation="MLFDTHVHLNDEAFDDDIEEVIKRAQENDVTRMAVVGFNKETIDR
FT                   ALELAEKYDFISLIVGWHPTDAITFTDEDLEWLRDLALTHPKVVALGEMGLDYHWDTSP
FT                   KETQFEVFRKQIRLAKEVNLPIVIHNREATEDVVRILQEEHAEEVGGIMHCFGETVEVM
FT                   EACLAMNFYISFGGTVTFKNAKLPKIAAQAIPIDRLLIETDAPYLAPTPNRGKRNEPGY
FT                   VKLVAEKIAELKEMKYSEIATHSTENAKRLFRIKD"
FT   regulatory      190679..190684
FT                   /gene="lmo0186"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        190690..191916
FT                   /transl_table=11
FT                   /gene="lmo0186"
FT                   /note="similar to B. subtilis YabE protein"
FT                   /db_xref="GOA:Q8YAE4"
FT                   /db_xref="InterPro:IPR007137"
FT                   /db_xref="InterPro:IPR010611"
FT                   /db_xref="InterPro:IPR011098"
FT                   /db_xref="InterPro:IPR036908"
FT                   /db_xref="UniProtKB/TrEMBL:Q8YAE4"
FT                   /protein_id="CAC98401.1"
FT                   /translation="MTMENSSNVAQSSKWKLPIMIAGFVIVVALVFYFVFEGTKNDITI
FT                   VNAGEKIESRTHAKTVSEALDEAGIKVSERDEIAPGKNAEIKDGMEIKYLPARQITIND
FT                   NGTKKDVWSTKANVADLLKDENITTRPQDVLNVALDTKLKNGLEVNINRAIQLSLQNGA
FT                   KKDTVWTTKTKVSDLLAEKNIKLDQDDRVSPAKDSNLKEKMTVEVTYVNSKAEKKNEQV
FT                   KFETVYKEDDSLNKGVEKVVQEGKNGKKVVEYKVTFENGKEKKRDVIKENVTSNKTDKV
FT                   VVRGTKEKVVATPVSNVSTSSATSSSSSSASSTPSGGKTYKMESTAYSGGGTTAYGINL
FT                   SANPGLKVIAVDPRIIPLGSKVWVEGYGEAIAGDTGGAIKGNIVDVYFPNESQCYSWGR
FT                   RMVTVKVLN"
FT   regulatory      191930..191963
FT                   /gene="lmo0186"
FT                   /regulatory_class="terminator"
FT   regulatory      192004..192009
FT                   /gene="lmo0187"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        192018..192593
FT                   /transl_table=11
FT                   /gene="lmo0187"
FT                   /note="similar to B. subtilis YabF protein"
FT                   /db_xref="GOA:Q8YAE3"
FT                   /db_xref="InterPro:IPR004466"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR025156"
FT                   /db_xref="InterPro:IPR034141"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8YAE3"
FT                   /protein_id="CAC98402.1"
FT                   /translation="MSGKPVIHEFIVVEGRDDTTAINRSVIADTIETNGSALSQETIEK
FT                   IRHAQELRGVIIFTDPDFPGEKIRKQIDSAVPGCKHAFINRQDALPKAGRGLGVEHASS
FT                   ANIREALENFHTSGAPTEKQFISKDILVHLGLLGGVGAKERREKIGNILKIGYTNGKQL
FT                   QTRLESFAISEEQLVAACQKIMQEEENE"
FT   regulatory      192574..192579
FT                   /gene="ksgA"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        192586..193473
FT                   /transl_table=11
FT                   /gene="ksgA"
FT                   /product="dimethyladenosine transferase (16S rRNA
FT                   dimethylase)"
FT                   /db_xref="GOA:Q8YAE2"
FT                   /db_xref="InterPro:IPR001737"
FT                   /db_xref="InterPro:IPR011530"
FT                   /db_xref="InterPro:IPR020596"
FT                   /db_xref="InterPro:IPR020598"
FT                   /db_xref="InterPro:IPR023165"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8YAE2"
FT                   /protein_id="CAC98403.1"
FT                   /translation="MSKDIATPGRTTEILKKYGFLFKKSLGQNFLIDSNILTRITDTAE
FT                   ITKETNVIEIGPGIGALTEQLAKTANEVVAFEIDQRLLPILDDTLSAYNNVKVVHGDVL
FT                   KADVEEVIAEQFAKPELPLKIVANLPYYVTTPIILKLLHDNIPADSMTFMLQKEVADRI
FT                   SAVPSTKSYGSLTIAIQFYMEAELAFIVPKTVFMPQPNVDSAVIHLKRRKEPLAEVNDE
FT                   EFFFEVTRASFAQRRKTLWNNLASKFPALKPRKDELVEGLNAIGIDLIRRGETLDIPEF
FT                   AKLSNFLGDFLKEK"
FT   regulatory      193580..193585
FT                   /gene="lmo0189"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        193593..193850
FT                   /transl_table=11
FT                   /gene="lmo0189"
FT                   /note="highly similar to B. subtilis Veg protein"
FT                   /db_xref="GOA:Q92F78"
FT                   /db_xref="InterPro:IPR009366"
FT                   /db_xref="UniProtKB/TrEMBL:Q92F78"
FT                   /protein_id="CAC98404.1"
FT                   /translation="MPKTIASIKTNLDSRLGKALTLKANGGRKKTIERCGILAETYPSV
FT                   FIVELDQDENNFERVSYSYTDILTDAVELVFTDDNKELAL"
FT   regulatory      193865..193898
FT                   /gene="lmo0189"
FT                   /regulatory_class="terminator"
FT   regulatory      193974..193979
FT                   /gene="lmo0190"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        193989..194870
FT                   /transl_table=11
FT                   /gene="lmo0190"
FT                   /note="similar to B. subtilis YabH protein"
FT                   /db_xref="GOA:Q8YAE1"
FT                   /db_xref="InterPro:IPR004424"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR013750"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036554"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8YAE1"
FT                   /protein_id="CAC98405.1"
FT                   /translation="MKISITAPAKINLSLDALYKREDGYHEVEMVMTTIDLADRLYLER
FT                   LDEDKIVLDVKAHFIPEDRRNLIYQAALLLKKRFDVKMGVRITIDKHIPVSAGLAGGSS
FT                   DAAAALKGLNVIWELGLSIEELAEISSEIGSDIAFCVYGGTALATGRGEKISALPNIPG
FT                   CWIVLAKPSISVSTPTIYKELQVDNVEHPDTQKMIESIKNGDLDGIFAATGNVLESVTL
FT                   EKNPQVKRIKDRMLAFGAEAALMSGSGPTVFALIKQYSRAKRVYNGLRGFCEEVYMVRP
FT                   WSEGENDTNINY"
FT   regulatory      194877..194882
FT                   /gene="lmo0191"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        194892..195629
FT                   /transl_table=11
FT                   /gene="lmo0191"
FT                   /note="similar to a putative phospho-beta-glucosidase"
FT                   /db_xref="GOA:Q8YAE0"
FT                   /db_xref="InterPro:IPR006879"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="InterPro:IPR022948"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8YAE0"
FT                   /protein_id="CAC98406.1"
FT                   /translation="MKIIFNADDFGISPGAVYGILESYKRGVVKSTTLLANSPAFDLAV
FT                   EVAKENPGLDIGAHLTLTFGSPVLQGLETLTDDDGRFRRNYTSLENGLADVDMNEVERE
FT                   LTAQIEKILDAGITISHFDTHHSIEPLIYPVQHKLAEKYGVSIRRHSDVSDFGAIKTPD
FT                   LFATEFYADGVSFETIKKLVQKHIGTNDVVEVMTHPAFIDETLREISSYVEPRIKEVSI
FT                   LTSRELQAYLGQQEVEIISFRDL"
FT   regulatory      195639..195676
FT                   /gene="lmo0191"
FT                   /regulatory_class="terminator"
FT   regulatory      195780..195785
FT                   /gene="lmo0192"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        195793..196611
FT                   /transl_table=11
FT                   /gene="lmo0192"
FT                   /note="similar to PurR, transcription repressor of purine
FT                   operon of B. subtilis"
FT                   /db_xref="GOA:Q8YAD9"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR010078"
FT                   /db_xref="InterPro:IPR015265"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q8YAD9"
FT                   /protein_id="CAC98407.1"
FT                   /translation="MKIRRSERLIDMTQFLLSHPRKLVPLTMFAERYGSAKSSISEDLV
FT                   IIKKTFEDRGIGTLETVPGAAGGVQYISIAGNDDVLDFVHTLCNRIAEPNRLLPGGYLY
FT                   LSDLLGEPVTLKAIGKILATKFNNQKIDAIMTVATKGIPIAQAVAEHLSVPFVIVRRDS
FT                   KVTEGSTVSINYVSGSSKRIEKMELSKRSLAEGSNVVIVDDFMKAGGTINGMKNLLEEF
FT                   NAHLVGIGVLVESEYAEERLVDDYVSLVKIKNVNMKEKQIEVVDGNYFNS"
FT   regulatory      196619..196650
FT                   /gene="lmo0192"
FT                   /regulatory_class="terminator"
FT   regulatory      196771..196776
FT                   /gene="lmo0193"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        196786..197463
FT                   /transl_table=11
FT                   /gene="lmo0193"
FT                   /db_xref="GOA:Q8YAD8"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="UniProtKB/TrEMBL:Q8YAD8"
FT                   /protein_id="CAC98408.1"
FT                   /translation="MKKWVKWLIVIVIIAVVAVGAVFLLSKNSGSVTQEKLVTAKVKQG
FT                   DMKINATGTGAISPVNTQVPDYDELQLVAQMDELDIPNIKKDQEVKVTVTALPDKTYTG
FT                   KVKEIAEQGQVQNGVSSFSVIISLDKTDDLKAGMTADASILVNEKKDALYVPIEAVQKD
FT                   SDDKYYVLVPEEKDNGKTKKVKKFVETGLHNEDNIEITKGVKKGEKVILPTQETSTVPG
FT                   APS"
FT   regulatory      197499..197504
FT                   /gene="lmo0194"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        197512..198204
FT                   /transl_table=11
FT                   /gene="lmo0194"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /db_xref="GOA:Q8YAD7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q8YAD7"
FT                   /protein_id="CAC98409.1"
FT                   /translation="MPKPLIDMKNLTKTYTLGGETFKALDDVTFTVEQGEFLSIVGPSG
FT                   SGKSTLMNMIGCLDVPDEGSYHLDDVDVFKLSDNKLSEIRNKKIGFIFQQFNLLPKLSA
FT                   FENVELPLIYAGLSVSAREKAAIECLEKVGLLEKRRNLPTQLSGGQQQRVAIARALAGK
FT                   PQILLADEPTGALDSKTGKEVMGILQELNRAGNTIVMITHDPTIASYGTRSIRIQDGKL
FT                   FHEEATQA"
FT   regulatory      198185..198190
FT                   /gene="lmo0195"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        198201..199409
FT                   /transl_table=11
FT                   /gene="lmo0195"
FT                   /note="similar to membrane protein (putative ABC
FT                   transporter component)"
FT                   /db_xref="GOA:Q8YAD6"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR025857"
FT                   /db_xref="UniProtKB/TrEMBL:Q8YAD6"
FT                   /protein_id="CAC98410.1"
FT                   /translation="MNVLQSMKMAWKQLKASKLRSFLTMLGIIIGVASVILLVSLGNGV
FT                   TQEVDDQMGDLGSNLITVVNSSVNPNDKYTYDEVMKYQNIDGVKSVSPELSGQVNATFD
FT                   YKNSSNKVIGTNDQYKAARSLEMKEGRFLLPIDTEYGQKVAVIGSTVASDLFGFGDPIG
FT                   ETIRLNGMPYKVVGVLKEKGASMMGSSDDQIFIPISSAQRLLKDTNVRTIYVETKSAED
FT                   VDFVVNTLESRLAIKFGDEKEQEKNASSAQMGPSYQVINQQEILNAFNTISTTLTTALG
FT                   AIAAISLVVGGIGIMNIMLVSVSERTREIGIRKALGAKKRAILLQFLIESIVISVCGGV
FT                   IGIIIGVSGALIFGSVAGISSGITAGTIIFSFVFSLCIGVIFGIAPANKASKLRPIDAL
FT                   RSE"
FT   regulatory      199420..199453
FT                   /gene="lmo0195"
FT                   /regulatory_class="terminator"
XX
SQ   Sequence 200050 BP; 66397 A; 33106 C; 42140 G; 58407 T; 0 other;
     taattaaatc taacaatttc gttacagatt tctttacaca caagttatac acaagttaac        60
     tggctgtgga caaccgtttt tcacatctgg acagttttgt ggatagattt ggtaagtcct       120
     tgctatcaga gtgattttct gatattataa ttcctgtcga atagaaatat agctggggaa       180
     aactaaagtt atccacaata catttttact ttgtggataa ttttttaaca gtgtttggat       240
     aaccttatcc atagcttttt ctatctgtgg ataactttat agcatccatt tacattacat       300
     aaaaaggggg ggtactagtg caatcaattg aagacatctg gcaggaaaca ctgcaaattg       360
     ttaaaaaaaa tatgagtaaa cctagttacg atacatggat gaaatcaaca accgctcatt       420
     cacttgaagg taacacgttt attatttcag cgcccaataa ttttgttcgc gattggttag       480
     agaaaagcta cactcaattt atcgctaaca ttttgcaaga aataactggt cgcttatttg       540
     atgtccgctt tattgatggc gagcaggaag aaaactttga atacactgtg attaaaccaa       600
     atccagcatt agatgaagat ggcattgaaa ttggaaaaca tatgcttaat ccacgttatg       660
     tttttgatac ctttgtcatt ggttcaggga acagatttgc ccacgcagca tcacttgcag       720
     tagccgaagc accagcgaaa gcatataatc cactcttcat ttatggagga gttggcctcg       780
     gtaaaacaca tttaatgcac gcagttggcc actatgttca acaacataaa gataatgcga       840
     aagtaatgta cctttccagc gaaaaattca ccaatgagtt tattagctct attcgtgata       900
     ataaaaccga agaatttcgc acaaaatatc ggaatgttga tgtcttactt attgatgata       960
     ttcaattttt agccggtaaa gaaggaacac aagaggaatt tttccataca tttaacacac      1020
     tttatgatga acaaaagcaa attattattt ccagtgaccg accaccaaaa gaaattccta      1080
     cactggaaga tcgactgaga tcccgctttg aatggggctt aattactgat attacgccac      1140
     cagacttaga aacccggatc gccattttac gtaaaaaagc aaaagcagac ggattagata      1200
     ttccaaatga agttatgctt tatatcgcaa accaaattga ttcgaatatt cgcgagctag      1260
     aaggcgctct catccgagta gttgcttatt cttccctcgt taataaagat ataacagctg      1320
     gtcttgcagc agaagcacta aaagatatta tcccctcttc taaatcacaa gttattacta      1380
     ttagtggtat tcaagaagca gtcggtgaat atttccacgt tcgtttagaa gattttaaag      1440
     caaaaaaacg gacgaaaagt atagcattcc cgcgccaaat cgccatgtat ctctcaagag      1500
     agcttacaga tgcctcatta ccaaaaatcg gtgatgaatt tggtggtcga gatcatacaa      1560
     cagttattca tgcacatgaa aaaatatcgc aactactaaa aaccgatcaa gtgttgaaaa      1620
     atgaccttgc cgaaattgaa aaaaatttaa gaaaagcaca aaatatgttt taatagacct      1680
     gtgtacaatg tggataactg aaacatactt acccacaagt tatcaacatg tggaaaactt      1740
     tatgcagcat ggcttgtaac ctacttatcc acaaatccac agcgcctatt actattacta      1800
     cgatttttta ttaattaatt aaaggttttt gaggttttac aaaatataaa aaaatggggg      1860
     atactcatga aatttgttat tgagcgtgat cgtcttgtcc aagcagtcaa tgaagttact      1920
     cgtgccatct ctgcaagaac aacgattcca attttaacgg ggataaaaat agtcgtaaat      1980
     gatgaaggtg taacactaac tggtagtgat tccgatattt ccatcgaagc atttattcca      2040
     ttaattgaaa atgatgaagt aattgtagaa gtagagagtt ttggtggaat tgtacttcaa      2100
     tcaaaatact ttggcgatat tgtccgtcgt ttaccagaag aaaatgtaga aattgaagta      2160
     acgtctaatt accaaaccaa cattagttct ggtcaagcct cctttacact aaacggctta      2220
     gatccaatgg aatatcctaa attacctgaa gtaacagatg gaaaaacaat taaaattcca      2280
     attaatgtac taaaaaatat tgttagacaa actgtttttg ctgtttctgc tattgaagtt      2340
     cgtccagtac ttactggtgt aaactggatt atcaaagaaa ataaactaag cgcagttgca      2400
     accgatagtc atcgtctagc tttacgtgaa attccacttg aaacagacat tgatgaagaa      2460
     tacaatattg ttattcctgg aaaaagttta tctgaattaa ataaactttt agatgacgca      2520
     agcgaatcta ttgaaatgac ccttgccaac aaccaaattc tttttaaatt aaaagattta      2580
     ttattttact ctcgtttact tgaaggtagt tacccagata catctcgatt aattccaact      2640
     gatactaaat cagaattagt cattaattcc aaagcatttt tacaagcaat tgaccgtgcg      2700
     tcgctacttg ctcgcgaaaa tcgtaataac gttattaaat taatgacgct ggaaaatggc      2760
     caagtagaag tatcctccaa ttctccggaa gttgggaatg tttctgaaaa tgtcttcagc      2820
     caaagtttta ctggcgaaga aatcaaaata tcttttaacg gtaaatacat gatggatgcc      2880
     ctacgtgctt ttgaaggtga tgatattcaa atttccttct caggtactat gagaccattt      2940
     gtacttcgac caaaagatgc agccaatcca aatgaaattt tacaattaat cacgccggtt      3000
     agaacttact aatctcgcaa aaaagcacat ccgtcttggt ttcaaggcgg attctttttt      3060
     tgttatagta cagtttttgg atagaaatgt atatttatgc aaacggaggt aattcttagc      3120
     atgatgaaag atatgacaac aggtaatccg acaaaattaa tttttttatt cgcgatgccg      3180
     atgttgattg gaaacttatt tcagcaattt tatacgatga ttgatgcggt tattgttggg      3240
     aaatttgtaa gtgtagatgc gctagctgct gttggagcga caaattcggt caattttttt      3300
     atgatttctt tgattattgg acttatgagt gggatttctg tcgtagttgc gcagtatttt      3360
     ggatttaaag attatgatcg tttgaaagat gttattgcta cggcgactta tgcggtggtt      3420
     ttttcggcga ttattttgac ggttgcgggc gttttacttg cgaagccact tcttattttg      3480
     ttacgaacac cggcaaatat tttggatgat tctactatct ttttaaccac cctttttatc      3540
     gggattttgc cgatgagtct gtataacggg atggccgcga tacttcgagc tcttggaaat      3600
     tcgattaccc cactgatttt tttgatttta tcgtctttaa tgaatattgc attagatttt      3660
     ttatttgttg tttatatgga tatgggcgtt cgcggggctg ctattgcgac agttttatcc      3720
     caaacagctg cagcgattgc tgttatttac tatgcttatc gtcacgtacc atttatgcgg      3780
     atagagcgtg caaaattcaa gctctccacc ccactcctta aagaaatggt gcgcattggg      3840
     ctgccttctg gattacaagg atcctttatt tctatcggaa atatggctct tcaaagttta      3900
     ataaatggat tcggttcatc ggtcgttgcg gcttatacgg cggcgagtcg aattgattca      3960
     cttacatatc aaccaggaat tgcttttgga gcagcttcct ccatgtttgc tggtcaaaat      4020
     atcggtgctg gaaaaattga ccgcgttcgc gaaggttttt ggtcgggaat taaagtcgtt      4080
     acagctatca gtattggaat cacaatttta gttcaacttt tcgctaggca gtttttatta      4140
     ctatttgtag attctagtga gacggaagtt attaatattg gtgtgagtta tttacttatt      4200
     gtctctttat tttatgtcgt agttggaatt ttatttgttg ttcgggaaac tttgcgaggt      4260
     actggagatg cgatggttcc tttagcgatg gggatttttg agttggtttc gagacttgtt      4320
     atcggatttg ttttgtcgct ttatattgga tacgtagggc tttggtgggc tacaccggtt      4380
     gcatggataa ccgcaacgat actcggcgtt tggagatata aatcaggagc atggcaaaaa      4440
     aaggcagtta ttcgacgaaa ataaccattt tagtaaaaaa acgccagaga agctcatatt      4500
     ttcttttttt gaataaataa tatcccccca ttagttttgc taaaaaaagc tgaaaaacga      4560
     atatatgaaa atattctttg tattattggc aaaactttag taaaatagaa ggtagtgata      4620
     aaaaaagatt gggcgtgaaa tttttggctg aaacagtaaa gataaatagt gagttcgtaa      4680
     cgcttggtca acttttacaa atgattgatg tagtttcaac tggtggaatg gcgaaagcgt      4740
     accttagtga aaatacgatt tacatcaacg gagagcaaga caatcgccgg gggaaaaagc      4800
     ttcgtaatgg cgatgttatc ttagttcccg gtgttggaaa agtgaaaatt gagcaaggaa      4860
     aataacagat gcatttagaa agtattgttt taagaaattt ccggaattac gaaaacttag      4920
     aactagaatt ttccccatct gtaaatgttt ttcttggcga gaatgcacaa ggtaaaacca      4980
     accttttgga agccgtattg atgcttgctc ttgcaaagtc acatcggaca acgaatgata      5040
     aagattttat tatgtgggaa aaagaagaag ccaagatgga aggtcgaata gcaaagcacg      5100
     ggcaatcagt gcctttagaa cttgctatca cccaaaaagg caagcgagct aaagtaaatc      5160
     atttggaaca aaagaaactt agccaatatg tcggtaactt gaatgtggtt atttttgccc      5220
     cagaggattt atcgcttgtg aaaggcgctc caggaataag acgtcggttt ttgaatatgg      5280
     aaattggaca aatgcagccg atttatttgc ataatctaag tgaataccag cgaatattgc      5340
     aacaacggaa ccaatatttg aagatgttgc aaatgaaacg caaagtagac ccaatattac      5400
     ttgacatttt gactgaacag ttcgcagatg tcgccattaa tttgacgaaa agacgagctg      5460
     atttcattca aaaactagag gcatatgcgg cgccaattca tcaccaaatt tcccgaggac      5520
     ttgagacgct gaaaatcgag tataaagctt ccatcacgct aaatggggac gatcccgaag      5580
     tgtggaaagc agatttactc caaaaaatgg aatcaatcaa acaaagagaa atcgaccgtg      5640
     gtgtcacgct tattggacca catcgggatg attctctgtt ttatattaat gggcaaaatg      5700
     tgcaagattt tggttcgcaa ggccagcaac ggacaacggc actttctata aaattagcag      5760
     aaattgacct aatccatgaa gaaactggtg aatatccggt ccttcttctc gatgatgtgc      5820
     ttagtgaact cgacgattac cgtcaatcgc atttgctcgg agccattgaa ggaaaagtac      5880
     aaacctttgt aacgacaaca agtacgagcg gaatcgacca tgaaacgctc aaacaagcaa      5940
     caactttcta tgtagaaaaa ggtacagtaa aaaaatccta atctaggtta atataatttg      6000
     atgaaaaaga aagtgcggtg gaataattaa tgtcagaaga aaatattaca aatgtacaag      6060
     aaaatgcttc agattataac gaagatcaaa tacaagtact ggaaggccta gaggcagtaa      6120
     gaaaaagacc cggtatgtac attggttcaa ctagccaacg cgggctccat caccttgtat      6180
     gggaaattgt tgataatgca attgatgaag cacttgctgg tttttgtaca gaaattgaaa      6240
     ttacaattga agctgataac agcattactg ttcgcgataa cggacgtgga attcctacag      6300
     ggattaatga aaaaatcggt cgtccaacag tagaagtaat ctttaccgtt ctgcatgctg      6360
     gtggtaaatt tggcggcggc ggatataaag tatctggcgg acttcacgga gttggtgcat      6420
     cggtagttaa tgccctttcc acatctcttg aagtatacgt tcaccgtgaa ggtcaaaaat      6480
     attaccaacg ctttgaacgt ggtgatgtag taatggatat ggaagaacaa ggcgaaacgg      6540
     attatcgtgg aacaattgtt cactttacac cagatccaca aattttcaca gaaacaacgg      6600
     aattcgattt tgatacgctt cgtacgcgta cacgcgaact tgctttcttg aatcgtggtt      6660
     taacgatttc aattgaagat aagcgcgaag aacacaaagt tcgtaaagat ttccactatg      6720
     aaggcggaat tcgttcttac gtggagcatt taaataaagc aaaagacgtt atccatgagc      6780
     caccaattta tttggaaggt gaacgcgatg atattatggt tgagatttcc atgcaatata      6840
     atactggatt ctcaagcaac atcatttcat tcgcaaataa cattcatacg tatgaaggcg      6900
     gaactcacga atctggcttt aaaacggcgt taacacgtgt tattaatgac tacgcgcgtc      6960
     gtaataaatt gtttaaagat agtgatgaca atctttctgg tgaagatgtt cgtgaaggtt      7020
     taacggcgat tatttctatc aaacacccag atccacagtt tgaaggacaa accaaaacaa      7080
     aacttggaaa ttcagaagcc cgttcaatca cggataagct attttctgag gctttaaata      7140
     aatttatgat ggaaaaccca gatgttgcta aaaaaatcgt tgagaagggc gttgtggctt      7200
     ctcgtgcacg tctggctgct aagcgcgcgc gtgaagttgc tcgtaaaagc agtgggctag      7260
     aaatttctag cttgccaggt aaattagctg actgttcttc ccgtaatcct gaaatcagcg      7320
     aactttacat cgttgagggt gactcagctg gtggttcagc taaacaaggt cgtgaccgtt      7380
     tattccaagc gattttgccg attcgtggta aaattttgaa cgtggaaaaa gcacgtttag      7440
     accgtattct agctaacgaa gaaattcgaa ctatttttac agcgatgggt actggttttg      7500
     gtggcgattt tgacgtttct aaatctcgtt accacaaatt aattattatg actgatgccg      7560
     atgttgatgg tgcacatatt cgtacactac ttcttacact attttatcgt tatatgcgtc      7620
     cactgcttga tgctggttat atctatattg cgcaaccacc gctttaccaa attaagcatg      7680
     gtaaacaaat agaatatgta tacagcgacg gacagttaga agactatctg gcttcccttg      7740
     acggagacac taaatacagc attcaacgat ataaaggtct tggagaaatg aacccagaac      7800
     aactttggga tacaacaatg aatccggaac accgtacact acttcaagtc aatatcaaag      7860
     acgctattga tgccgatgaa acttttgaaa tgttgatggg tgaccgcgtg gaacctcgtc      7920
     gtaaattcat cgaagacaac gcgcaatacg ttaaaaactt ggatgtttaa taaatatttc      7980
     ccgggtaata attgggttat taattgtttt taaaaggttt gaactagatt cagccttact      8040
     tttgaaaggg aggtttctct aacaatggca gaaacaccaa atcaacgaat aacagagata      8100
     aacttaaata aagaaatgcg gacatcattc ctagactatg cgatgagtgt aattgttgcc      8160
     cgtgccctac ctgatgttcg tgacgggtta aaaccagttc accgtcgtat tctatatgcg      8220
     atgaatgact taggtatgac ttctgataaa gcctataaaa aatcggctcg tatcgttggt      8280
     gaagtaattg gtaagtatca cccccacggc gatacagcgg tttattttac aatggttcgt      8340
     atggcgcaag attttagtta tcgtaatatg ctagttgatg gacatggtaa ctttggttcg      8400
     gttgatggcg atatggcagc agcgatgcgt tatacagaag ctcgtatgtc aaaaatttcg      8460
     atggaactac tgcgcgatat taataaagac acaattgatt acgctgataa ctacgatggt      8520
     tctgaacgtg agccagttat tttaccagcg cgtttcccta acttattagt caatggttcg      8580
     tcaggtatcg cggttggtat ggcaacaaat attcctaccc accatcttgg tgaagtaatt      8640
     gacggcgttt tagcacttag tcacgatcca gaaattacta ttcgtgattt aatggaatat      8700
     attccaggcc ctgacttccc aactgctggg atgattatgg gacgtagcgg aatccgtcgc      8760
     gcttacgaaa gtggccgtgg ttcgattact gttcgtggtc gtgtcgatat tgaagaaaag      8820
     aaaaatggta aagaaactat cgttattacc gaaattcctt accaagtgaa taaagcacgc      8880
     ctagttgaac gtattgccga actagctcgt gagaagaaaa tcgacggcat cacttcccta      8940
     aatgatgagt ctgaccgttc aggaatgcgg attgttattg aggttcgtcg tgatattagc      9000
     gccagtgtta tcgtgaataa tttattcaaa atgacagcac ttcaaactac ttttggtatt      9060
     aatatgcttg cacttgtcga taaccatcca aaagtgctta atttaaaaga aattctttat      9120
     tattatttgg aacatcaaaa agtagttatt cgtcgacgta cagaatttga gcttcgtaaa      9180
     gcagaagcac gcgcacatat tttagaaggt ttacgaatcg ctcttgataa cattgacgcg      9240
     attattaaat taattcgtgg atcaaaaact tccgatgttg ctaaagaagg cttgatgaca      9300
     caattcaacc tttctgacaa acaagcgcaa gccattctgg acatgcgttt gcaacgttta      9360
     acaggtttag aacgcgaaaa aattgaagaa gaataccaaa acttagtagc attaattaat      9420
     gatttaaaag ctattttagc tgatgatgag cgtattcttg aaattattcg tgaagaatta      9480
     gaagaaatca aagttaaata tgcggataaa cgtcgtacag aaatcttggc tggtgattta      9540
     gtaagccttg aagatgaaga cttaatccct gaagaagaag tagcaattac gctaactaaa      9600
     cgtggttata ttaaacgttt accactgtcg acttatcgta gtcagcgtcg aggtggtcgt      9660
     ggtattcaag gtatgtcaac acatgaagat gacttcgtag aacacctagt tgcaacgagc      9720
     acgcatgata cgttactatt cttcactaac actggtaaag tttaccgttc gaaaggttat      9780
     gaagtacctg aatacggtcg taccgccaaa ggtatcccaa taatcaactt acttggaatc      9840
     gaaagccaag aacaagtgaa cgccgtgata aatctatccg aattcaccga tgatagctac      9900
     ctattcttca cgacgaaaca tggtgtcgtg aagcgtacaa ccctttctca atttgcgaaa      9960
     atccgtcaaa gtggccttcg tgctgtagaa cttcgtgaaa acgatgaact catttctgtt     10020
     caaatgacag atggtagcaa aaacatgatt atcgcaacga aacatggtca atctatctac     10080
     ttcccagaag aaaatatccg tgtaatgggc cgtacagctg ctggtgttcg tggtattaga     10140
     cttcgtgaag acgatgaagt tatcggcatg gaagtactgg aggacgatga aaaagtactc     10200
     gttgtaacgg aaaaaggtta tggtaaacaa acgccagcct cccaatatcc gcttcgtaat     10260
     cgtggtggta tgggtgttaa aaccgttaca atcacagaga aaaatggtaa cttagtagca     10320
     atgaaaactg ttactggtga agaggactta atgctaatga cagtaagtgg cgtattaatt     10380
     cgtttcgaaa ttgatacagt atcacaaact ggtcgtagcg caatgggtgt taaactaatt     10440
     cgtcttgatg aagatgaaaa agtagccact gttgcaaaag taccaaaaga agaagatgaa     10500
     gttgagcttg aggaagaaat cgacgaaaca ttaatcacgc aagttcctga tgaaagtttt     10560
     gaagatgctc ctggaagcga catagaagaa taaaatcaag ctggaaatga ctctaatttg     10620
     cgaattagaa cgattttcca gctttttttc agtataaaaa agcgcttttt ggatgtattt     10680
     tatgtataat atccttaata cgtctaaaaa agggaagagt tgaaaaaatg cgcaaactga     10740
     ttcaatttct gtttatagca gtagttttat ttttagtgga atatgtttta atcaatcaag     10800
     cagctatatt attcttagta acaagtggga ttatccaact atgcggggtt attatcgcca     10860
     ttcgactact cctatttgac caacggaata ctagctcaaa agtcgcctgg gttgcggtta     10920
     tttttatttt gcctgtactc ggaacgatta gttaccttgt gttcggtaga aatccagcaa     10980
     ctagaaaatt cagcacagct caagtaaagg aaaaaacaaa attaattaat gcgattcatg     11040
     caattccaaa caacactaat gaaaaattgc cacgactatc aaaaagaata gcgcatttaa     11100
     cgtccataga gccaatcaag gggaataaaa tcgaaatatt aacaaatggt gaggaaactt     11160
     ttccagtgct cctagacgcg cttagaaagg ctgaaaacca cattcacatt caatattaca     11220
     ttttcaaaac ggatgcgatt tctactgaaa ttcgtgatat tttggtggaa aaggcgaaat     11280
     ctggtgttga ggttagattt atgtttgatg gtctcggatc aagcaaactg ggtaaagcct     11340
     ttttagctcc tttgaaagag gctggagtta gtattcacgc atttgatcca attgcctccc     11400
     cctggattgt aagaacagcc aatttaagaa atcaccgtaa aatcgtggtg attgatggcc     11460
     aaattggctt tacaggtggg cttaatattg gggaagaata tcgttccaat acacctgatt     11520
     ttcgtgtttg gcgcgataca cacataaaaa taacaggcca agctgtaatc gaactccaag     11580
     aatccttcct aaacgattgg gtatacatgg aaaatcaagc tggcgccgct gacgggttta     11640
     ttagcgaatc tggttcaaaa caatattttt ctccagtcga tatgggtgat gaatgggctc     11700
     aagttattta cggcggacca tatgataaag aaaaatgggt tcgggattcg atgcttgatt     11760
     tgattgattc cgctaaagaa tcagtttgga ttgtatcacc ctatttcgtt ccagatgagg     11820
     agtcgcttgc ggttattcgc cgggttgcga tgagtggtgt tgacgtgcgg gttattattc     11880
     ctggtaaagg cgatcgcggg atttcattcc acggaagtaa tgcttatgta aaaacaatga     11940
     ttgaagcagg cgcgaaaatg tatgcttatg ccgatgactc ttttgttcat gccaaagcaa     12000
     tgcttgtgga cggaacacgt gcggctattg gaactgccaa ttttgacgtg cgtagtttta     12060
     gattgaatca tgaattaatg gtattcttat atgatgaaag cgaggctatg catcatttaa     12120
     aacgtgactt caaaaaagat tttgaagata gccgactatt tacgatgaaa gatatggaaa     12180
     acaaaccatt attgactcgt ataaaagaag ttctatccag tttactatca ccaattttat     12240
     aatttaggag tggaaaaatg agtggagatt taaaacttag accgcttgaa cgagaagatt     12300
     taaaatttgt tcaccggtta aataatgatg cgaaaataat gtcttattgg tttgaagagc     12360
     catatgaggc gttcgtcgag cttcaggagc tatatgataa acacattcac gaccagtcag     12420
     aacgccgttt tattttagag ttagatggac aaatggttgg attagtcgag ttaatggaaa     12480
     ttgattatat tcacagaaga gccgaatttc aaattattat tgatcctaag tttcagggac     12540
     acggttatgc tgtttctgcc acaaaactag caatgaaata tgcttttcac gtactaaata     12600
     tgcataaatt atatttagtt gtcgataaag taaacgaaaa agcaattcat gtttatgaaa     12660
     aagttggctt tattcgtgaa ggcgagctaa ttgatgagtt tttcgttgat gggacttatc     12720
     atgatgctat tagaatgtgt attttccaac atcaataccg agaaatggat atttaaaaag     12780
     tgattggcgc gggaaaagtt gcgccagtca ttgttttggg tcaaaaaaag ttctataata     12840
     aggttttagt gaaaaaatta tggtatcatg aagtattaaa gtttgtatta ttttgatgga     12900
     gaaaggattg gcgtgcattg gctacaggca ttgggacagc taaaatgata ttatgcggag     12960
     aacatgcagt tgtatacgga gaaccggcaa tttcagtccc atttacacaa gcagtagtaa     13020
     cgacaaatgt agaaacttct ataaaaacca aattttcttc agcatttttt tcaggtgatt     13080
     tagatgatat gcctgatttc ttagcaggaa tcaaagcatt agtcgtagat gttttaaatg     13140
     aaattggaaa tggtgaatgt gtttcgattc atgtggtttc aggtgttcca atcggccgag     13200
     gattaggttc aagtgctgct gtagcaacaa gtattgcgcg tggcttatat aaatacttta     13260
     atcaagaatt agactcgaaa aaattattag ccattgtgaa tgctgcagaa aaaattgctc     13320
     atggcaatgc tagtggtgtt gatgctatca cggttgtgag tgaaaaacca gtatggtatg     13380
     agcgagatcg aaaactagaa attatgcatt ttccaaaaaa aattacgttc gtagtagcgg     13440
     atactggagt tccgagtgaa accagagacg cggtgaagga tgttcaagtt ttatataaag     13500
     aaaatcaagt agaaattggt aaaataattc atcaactcgg cgatatttcc cgggaaataa     13560
     agacacattt agaaggcgat gcagatactg tgaagatagg agctgcaatg aataaggcac     13620
     aatcttattt agaaactttg acagttagtg acagtagttt agagaaatta attaaagtag     13680
     ctagaagtaa tggcgcggac ggggcaaaac ttactggtgg cggtagaggt ggatgcatta     13740
     ttgctgtagc gaaaaatcaa gaaatcgctg aacaaataac gaaggcgctt cataatgctg     13800
     gagctgcaca agaatggatt tttacgattg gagaaggtag ttatgaaagc gacagccatc     13860
     gcacacacga atgtggcgct aattaaatac tggggaaaac gcgatgaaca cttgattcta     13920
     cctgcaaaca gtagtttatc cttcacggta gataaatttt atacaaagac aacggtagaa     13980
     tgggacgaaa aattaaccca agatacattt attttaaata atgaacaaaa aacggatgca     14040
     aaagtagctc gttttataga taaaatgcgg gaggaattcg gtatttctgc aaaagcaaaa     14100
     ataacttccg aaaatcacgt tccaactgca gcaggacttg cttcatctgc ttctgcattt     14160
     gcagctcttg cgcttgctgg atctaatgca gctggtagaa aagacacaaa agaatatatt     14220
     tccagactgg ctcgtttcgg gtctggttct gcttctcgtt ccgttttcgg tgattttgtc     14280
     atttgggaaa aaggtgagct cgcggatggt agtgattctt ttgccgttcc attcacgaat     14340
     aaattatgtg acaaaatgtc ccttgtagtc gcagtcgttt cagacaaaga aaagaaagtt     14400
     tccagtcgtg atggaatgcg tctaaccgtt gaaacatctc cttttttcga aaactgggtt     14460
     tctgctgctg aaatagactt ggaagaaatg aaacaagcca ttttagacga agatttcatc     14520
     aaagttggcg aaattacaga acgaaacgga atgaaaatgc atgcgacaac acttggtgca     14580
     gagccgccat ttacttattt tcaaccacag tcactcgaaa taatggatgc tgttagagaa     14640
     ctacgcgaaa atggtatacc ggcctatttt acaatggatg ctggaccaaa tgttaaagtt     14700
     atttgtgagc gtgcaaatga aaatatcgta gcagagaagt tgtcaggttt ggctaaaaac     14760
     gttctaattt gccacgctgg taaggaagcg agtgttgtat cagatgaaaa ataaactaca     14820
     ggttaaaata cccggaaaat tatatgttgc tggtgaatat gcagttgtag aatcaggtca     14880
     tacggctatt ctaaccgcgg ttaaccgtta tataacgcta actttagagg atagtgaacg     14940
     caatgaatta tggattccac attatgaaaa tccagtttca tggccagttg gcggcgaact     15000
     taaacctgac ggagaacatt ggacttttac agcggaagca attaatatcg cgacaacttt     15060
     cctgaaatca gaaggaatcg agctaacacc tgtgaaaatg attattgaaa cagaattaat     15120
     cgaccaatct ggtgcaaaat atggactagg ttcaagcgca gcggcgacgg ttgctgtaat     15180
     caacgcgcta atgacgaaat tttatccaga aatatctatg ctaaaaaaat tcaaactagc     15240
     tgcactttcc catttagtcg ttcaaggaaa cggttcatgt ggtgatattg catcttgtat     15300
     gtacggtggc tggattgcgt atacgacgtt tgatcaagaa tgggtgaagc atcgtttagc     15360
     ttataaatcg ctcgaatggt ttatgaaaga gccgtggcca atgcttcaaa tcgaaacatt     15420
     agaagaacca gtgccgactt tttctgtagg ttggacgggc acacctgtaa gtaccggaaa     15480
     actagtttcg caaattcatg cttttaaaca agaagatagc aagaattacc aacatttttt     15540
     aactagaaat aatgagatta tgaagcaaat aattcaagct ttccatacga aagacgagga     15600
     attgctctat tcagctatta aagaaaatcg tcgcattctt caagaacttg gaacaaaagc     15660
     tggcgtaaat attgaaacaa gcttgctaaa agaactcgcg gactcagctg aaaacatggg     15720
     cggcgcagga aaatcatctg gctctggcgg cggagactgt ggaatagcat tctctaaaac     15780
     aaaggaacta gccgaaaaac tagtgaatga gtgggaaaaa cttggtatta agcatttacc     15840
     tttccatacg gggagagttc aaattactga ataaatttta agtagtaaac taagataaat     15900
     agtttgctac tttttttgtt tcgaatttca caatctaggg aatagtgaac agaatgaaag     15960
     tttgtgaaat atttaatata tcaggttttt gaactaagat atcaaatcag atataatgaa     16020
     ttagagtatg aacatagtga ttttaaaaat gcggaacaat tttaaaaaag tttgtgagtt     16080
     tttttaaaag aactaaatag taaaagcatt ttttcagtta cataggagtt ctaacaagct     16140
     tctttcagca ctccggtaat ggtatttttg cgcaaaaata cacattagaa aacatcaaaa     16200
     ggaaaagagg ggattcgggt gtcaaaggta cttaaatctt tgctgcttac ggcactactt     16260
     ggggttaccg gccttataag cggttgtggt gacttgacgg tacttaatcc aaaaggacca     16320
     gttgctaaag gtcagtcgga cttaattatt tattcgatta tatttatgct ggttattgtt     16380
     ttgacgattt ttgtattgtt tacgattatg ttggttaaat accgcgaacg gaaagacatt     16440
     tcaaactacg agccagatat gcacggtagt aaaaaactag aaattttttg gacattgatt     16500
     ccagttgcta tcgttattgc tctagctatt ccgacggtaa aaacaattta tgcaggggaa     16560
     gaagcaccaa aagtgacttc gcataaagat ccaattatta tttacgcaac aagtgcagat     16620
     tggaaatgga tttttagtta tccagatgag tcgattgaaa cggtgaacta cgtaaacatt     16680
     ccaaccgacc gtcctgtatt attcaaatta acttccgcag atacgatgac aagcttttgg     16740
     gttccgcaat taggtgggca aaaatatgcg atgtctggca tgacgatgaa tttatattta     16800
     caagcagatg aagttggtac atacaaaggt cgtaacgcaa acttcaacgg cgaaggtttt     16860
     gcggatcaac gctttgatgt agtagctcaa tctgaaaaag atttcaaaaa atgggcgaaa     16920
     gaaacaaaag caagctcgcc agttattaca caagacatat atgatcgtct tttaattcct     16980
     ggaagctcta agaaaaagac ttattctggt acgcatttag catttgttga tgtagcagct     17040
     gatccagagt atgttttcta tgcctacaaa cgttttggtt atgagatgac aaatccgcat     17100
     aatccaaaca caaaatcaac catttctgat gaaccaatgc ttccggttcg tcctgtgaca     17160
     gtaactaatc cgcaatttga gcgtcatgat atgaagccac aaattattaa aaacggcgaa     17220
     ggttaccacg aggataaaca ccgcgaagat gaaatgaaga aaatggaaga agacatccaa     17280
     acaaatgaat tcaataaaaa agaatcggat gacgcaggga agtaaaaagg ggggacataa     17340
     ggcatgaaat ggaatgagtt tatcgtaact ggcgatccaa tgattttagg cgcgcagatt     17400
     tctatcgtac ttgtaagtat tggtgttgtt gcgttactaa cttatacaaa aaaatggaag     17460
     tggctcatga aagagtggat ttcttccgtt gatcataaaa aaattggtat tatgtacttg     17520
     cttgctgctg tcttaatgtt tttccgtggt ggtgtggatg cgctaatgat gcgtacccag     17580
     ctcgctttac cggatatgaa atttttagac gcacagcatt acaatgaagt attttctact     17640
     cacggaacca ttatgatttt atttatggcg atgccgttta tcatcggact gatgaacatt     17700
     gccgtgccac ttcaaattgg tgcgcgtgat gtagcatttc catttttaaa caacttgagt     17760
     ttttggacgt tctttatggg agcgatgcta tttaacttat cattcgtaat tggtggttcg     17820
     ccagacgctg gttggacaaa ctatgcgcca cttgcgacag attttagcgc gggatatgga     17880
     attaacttct atcttttagg tgttcaaatc gctggtattg gtacgctgat gacggggatt     17940
     aactttttcg ttacgatttt aagaatgcgt acaaaaggta tgacgttaat gaaaatgcca     18000
     atgtttactt ggtcttcatt aattacaagt ttgatcatta ttttcgcttt cccagtttta     18060
     acagtggcac ttgctttgat gtcatttgac cgactgtttg ggacagcatt cttcacactc     18120
     acgaatggtg ggctcccaat gatgtgggcc aacttgttct gggtttgggg gcatccggaa     18180
     gtatatattg ttattttgcc agctttcggt attttctcag agattatttc tactttctcg     18240
     aggaaaaaat tattcggtta tccggcgatg gttgccgcga tggcagttat ttctttacta     18300
     agtttcctag tttgggtcca tcacttcttt acaatgggat caggggcgct tgttaactcc     18360
     ttcttctcca ttacaacgat gatgattgcg ataccgaccg ggattaagat attcaactgg     18420
     ctctttacga tgtacaaagg gcgaataacc tttacaacgc caatgctttg gtcgcttgcc     18480
     tttatcccta actttgttgt tggtggggta actggggtta tgcttgcgat ggctgcggcc     18540
     gattatcaat atcacaatac gtacttctta gtatcccatt tccactacgt attaattgct     18600
     ggaaccgtgt tctcctgctt tgccgggctt acatactggt atccaaaaat ggtcggttac     18660
     agactaaatg aaaaaattgg taaatggttc ttctggattt tcgttgttgg atttaacgtt     18720
     tgtttcttcc cgcaatattt cctaggacta gatggtatgc cgcgtcgtat ttacacttac     18780
     gtacaaggtg atggctggac aacgcttaac tttatctcta cagttggcgg attcttgatg     18840
     ggtgtggcat tcttagttct ttgctacaac atctactaca gctacaaaaa ctctaaacgt     18900
     gaagttactg gtgacccgtg ggatgctcgt acgcttgaat gggctacaag ttctgcagtt     18960
     cctccaaaat ataactttgc tgttttacca gaatggaatg acttggatga tttctggaat     19020
     agaaaacaaa aaggcgatcc atatgtaaat gataaaaatt ataaaccaat ccatatgcca     19080
     agtaatacca tggttgggtt tgtaatgtct gtcttcttct tcattgcagg tttcggacta     19140
     gtcttctact ggtactggat gggaattatt ggtctagttg gtattttagg atgtatgatt     19200
     tatcgttcat tccaaaataa cgatggttac cacgttgaag tggaagaaat taaagcaaca     19260
     gaagaacata atgcgcgcga acttgcgact ggtgtgaagg agggaaaccc atggaatctg     19320
     tagaaacaaa taaaaatctg ccaattgaat atagatcaga acaaggtcga ttaaatattc     19380
     ttggattctg gattttcctt ggcgccgaaa ttgcattgtt tgcaacgctt tttgcgactt     19440
     actttgttat gaggaaggct ggctcgaatg cggggcatcc gccagcagaa atgttcgaac     19500
     tttggctagt gctaataatg acatttttac ttttaacaag tagttttacg tgtggtctag     19560
     caattggtga aatgcgtaaa ggcaatgtga aaatgttgac gatttactcg attatcacat     19620
     taattcttgg tgcgggattt gttggctttg agctttatga atttgcacac tatgtgacag     19680
     aaggagttac gatgcaagtt ggttcttact ggtcggcatt cttcgttcta ctaggaacac     19740
     atggacttca cgtaacggtc gggattttct ggattagttt tattctgatt caaattaaaa     19800
     tgcatggttt gacgccaaaa acagcatcaa aagtatttat ttccagttta tactggcatt     19860
     tcttggatgt tgtgtggatt ttcattttca ccggtgtcta tttgctaggg atggtgaact     19920
     aatatgacac aaaataataa atcaaatgca gcacatgcag aaggtggcat tccttggaaa     19980
     catattgttg gctttgcgct atcggttgtt ttgacgcttc tagcagtctg ggtagctctt     20040
     tattcaacgc ttacaacaaa tgttaaggta gttattattt tcatctttgc gttcattcag     20100
     gcagccctac agcttctgat gttcatgcat atgacagaag gccgcgatgg taaaatccaa     20160
     atcggtaata ttttattcgc agcatttatt gcgattgtcg tagttattgg ttcttattgg     20220
     gtaatggaaa ttggccatat gaatcatttg ttataaaaaa taagctgatg catggaacgg     20280
     tatacaccga actagcatca gcttttttta ttttgcggaa atatcaccat tactattaat     20340
     ggttgcattt ggagaaatgg attgcaggta atttaattgt gctgtcttgg aagaaccttc     20400
     aagcatatta atttgattgc ctgaaataat accaggatca aaatgggcag ttactttacc     20460
     ttgatcaaaa ttcagtttat aaatacctgt ttctgccgaa tgacctgaaa catagtcagg     20520
     gaataagaaa ttacctaatg aataagcaat tggaacatct ttgtatactt caaaaccttg     20580
     gagccagtgt ggatggctag caacaatcgc atccactaaa ttatcatcca cgagtttttt     20640
     aacgtattgg gtttgataat ctacaggtgt attcgtcttt tcaactcccc agtgaaaata     20700
     gacgaccata taatcaatat ctttattttt tgcgcgttct tctttgattt tttcttcgac     20760
     aaggtttaaa tcataaccat tagtaacccc tggagtatct tcgtcggcaa tccaacccgt     20820
     attcgggaaa aagtggcaaa acgacatgaa accaactttg tttcctttga tgtcagcaac     20880
     tttaagttga taggcttcat cttcattttt accggcgcca acataggcta ggttattggc     20940
     gcgtaaagca gccgttgtgt cgagtaatcc atcttcgtaa tagtctaaaa tgtggttatt     21000
     actaatatta accatatcaa cccctgcatt tttaagagct gttaaagaac taggatcact     21060
     tttaatccaa aattcttggt aggggacttt ttttgttcga gttgtaatag ctgtttctaa     21120
     atcaacaaat gtatagtcgc tcgatttcag ttcctcgcga acattattaa aaggataatc     21180
     cattcccttc tctgctaaaa cggggcgtaa atcccaatca aacataatat cacctgtaaa     21240
     atcaatgtta aatggttctt ttggttttgg aggtgtctct tttttctttt taacagcagc     21300
     gacggttttc ttttttggct tagcagtatc tttgttgttt gtcatgaggt tgttcactaa     21360
     taaaccaatg gaaaagatta gaataacgga cagtactaag ataatccctt tttttcttga     21420
     tttcattttt tctcctccta aattaaaaag ttatctaatt ctatcagtat ggagaaaaag     21480
     gtttttatcg aaaatagact tttttatgga ttttaatggc taaattgtga actttaaaat     21540
     cataaaatgg aagacgaatt taaaaaaatt gaaattattg cttgctatgt aatgcattac     21600
     atattctata gtggaaaagt aaattatatt cgtgagagga gatatacaaa aatgacagaa     21660
     tcaaaatttc ctaaagactt tttatggggc ggagcagttg ctgccaacca atgtgaagga     21720
     gcttatcttg aagacggtaa aggactttca cttgttgata tccttccaac agtagaggac     21780
     ggacgttggg aagctttatt caatccatcg aaagcgcttg ctacagatta tggtttttac     21840
     ccaagtcacg aatcaattga tttttatcat cgttataaag aagacattaa attaatggct     21900
     gaaatgggat tcaaatgttt ccgtatgtcc atcagttggc cacgtatttt cccgaatggt     21960
     gatgaaacga caccaaatga aaaaggttta gcattttatg atgcagtttt tgatgaatgt     22020
     cacaaatatg gtatcgaacc agttgttaca atcaaccatt ttgatactcc gctagaagtt     22080
     ttcaaaaaat atggtggttg gaaaaatcgt aaatgcatcg acttttactt gaatttctgt     22140
     gaagcaattt tcacgcgtta taaagataaa gtaaaatatt ggatgacatt taatgaaatt     22200
     aacatgattc ttcatcttcc atacattggt ggaggtttag acgttactaa agaggataat     22260
     ccagaggaag ttaaatatca agctgctcat catcaattag ttgcatcagc acttgcaact     22320
     aaacttggtc atgaaatcaa tcctgaaaat caaatcggtt gtatgcttgc agcgggtaac     22380
     acatatccaa tgacttgtaa tccaaaagat gtctggaagt ctatcgaggc ggaccgtgaa     22440
     ggctacttct tcattgatgt tcaagcacgc ggatactacc caagctacac taaacgtttc     22500
     ttcaaagaac ataacatcaa catcaaaatg gaagatggcg acttagacgc attacgcgat     22560
     cacacagttg attatgtggc attcagctac tattcttctc gtctaacaag cgcagatcca     22620
     gagaaaaaca aagaaacaga aggcaacgtt ttcgcaacac taaaaaaccc atacctaaaa     22680
     gcaagcgaat ggggctggca aattgatcca ctaggtctac gtattactat gaatacaatt     22740
     tacgaccgtt accaaaaacc acttttcatc gttgaaaatg gcttaggtgc agtggatact     22800
     gtggaagaag acggctcaat cactgacgat tacagaatcg actacatgcg tgaacatgtt     22860
     cgcgaaatgg gcgaagcaat cgaggacgga gtagaacttc ttggctatac accgtggggc     22920
     tgcatcgatc ttgtcagcgc tggctctggc gaaatgaaaa aacgctacgg cttcatctat     22980
     gttgaccgcg acaacaaagg caacggaaca ttaaaccgct cgaagaaaaa atcattcgac     23040
     tggtacaaaa aagtaattga aacaaatggt aaagatatcg actagtatat caaaaacccc     23100
     cactttcatc atcgaaagtg ggggttttat tttaatacga aatcgcgcgt tttgcttgtt     23160
     tgctccaaca tgtattaaag taactttgcg aaattcgtgc atttttttga ccagaccagc     23220
     tgtcattgta gtaaaaatta tttttatcat aaccggtaat ggtgattgcg tgaacggaaa     23280
     aaccgtggaa tttactcacc caagctacaa ctggacgttt tttattcaac tgatttttaa     23340
     taccagctaa atttgttcca gtcatattct tcgcgctccc agtatatttt ttaacttgat     23400
     taactaaagc cggtggataa atcgtccaac cgctcttaga aaatggattc ccgacaaaac     23460
     cataatttgg attggattta tgacgcttca tttctttggc aagttttact ttatcaacat     23520
     tttttccagc atagcgcagc atcatcgcaa tgtttgtaat ctcgcaacct gttggtaatt     23580
     gtggacgctg aacgattaat ggcacgttca tttgcacaat ttttggcgtt ggaggttttg     23640
     gagtcggagt tgcagttgcg gcttttacat atttcccaga tacgtagccg tttttccctt     23700
     taaagctaaa gcgataccag ttgttcgatg tttttgcaat cgctttgaac tttgtattgt     23760
     tcttaagcca gccaataact ttcccagaag tcgaattagt tgaacgaaca ttaaggcttg     23820
     cagttgttac catttgcttg ttaatcacag tctcttttgc cgccgcctga ccagctgtag     23880
     aaacactaaa aacactgaac actaatccaa ggacaagtat ccacttcccc catttactaa     23940
     aaaaagtccc cattatatcc ccctttgata cagattactt atgtataccc tattttggaa     24000
     aaataaaaag aaaacgcttg cataaatgaa gtggccgtga tactataaaa atgaacttaa     24060
     cgtgttaacc ggttattgtt aaaaagttca gtgattgcaa gctaattcaa gtttgcaatc     24120
     aaaaaattat catggtacca ttaacctaaa acttaacgtg ttaacgcgcg ggatgcttta     24180
     gggggaactt gttatggcgg aaccaaaata cgctattatt atcaatgata tcaagcgatt     24240
     aattagtgat ggaactttta agccagggga aaaaatttat tcagaagatg aactgaaaaa     24300
     gaagtataat gttagtaata ctacggttgt tcgcgcctta cacgaattag tacgagctgg     24360
     gattttagct cgttatcaag gaaaaggcac atacgtaagt aagtctatta tcaacgaaga     24420
     agttattttt aatgaatata cgacagtgcc gaacggaaga ttcaatcgca aaacaaaaat     24480
     tactaacgaa catacaaaag tagttgcaat aaatgaaatt caggatgcgc gaattgctaa     24540
     aaaattgcag attccacctg aaaatatgat tgttcatttt caacgaatcc gccttattga     24600
     tgatttacct tggactgttc aaaacaacta tatggcaaaa tccaatttga tcaatgtcga     24660
     tttaacaaat tttgaaaagt ttaattcttt atctgaagtg attaaagagc tttatggcat     24720
     taatattctg cacgaagcga tgaaagagag aattgaagtt gaatttccag taaaagataa     24780
     aaataatttc aaattactcg aaattgatac tgaattgcca ctttaccata ttgaaagaat     24840
     aacttatgtg cctgaggggc aaccctatga atatattgaa agctatttac ggcataattt     24900
     ttactctatt gaaattgaaa agaaaaaaca atagaaggga gttaattact tggattatat     24960
     tatcgcagca catggtcggt atgcgcagga agtaaaagat agctgccaaa tgattactgg     25020
     ccaaacaact aatatttcag caattacttt tactgaagaa atgggggtga cggatgtatt     25080
     agatgcctac atggcagttt attcacctgt aaatgaaacc gctatcattg tggatattgt     25140
     tggtggaact ccgtgtaatg cggctcaaat gtttagtaca aaacatccag aagttaaagt     25200
     tgtatcaggt ttgtcgctag gattaatcat tccacttagc cttggagaaa gtttagagga     25260
     ggcgatgctt ggagcaaaag ataatattca atttgtagag caaaaagcga gtcatacgat     25320
     agtaagtgat gatggggagg aagaggactg atgggaagca acggaattaa acacgtacgc     25380
     gtagatgaaa gactaattca cggacaagta gcaacaatgt ggaccaatac tataaaagca     25440
     acgcgaatca tgattgttga tgatgcagtt gtaaaaaatg aaatggaaaa agttgcctta     25500
     aaaaccgcag tacctgctgg tgtcaaacta agcattctga cagtaaaagg tgcagcaaat     25560
     aatatcaata atgataaata cgcagggcag caagttttct taatcgtaaa atcacctcat     25620
     gctcttcgcg gtttagtgga tgcgggcgta gaacttcccc aaatcaatgt tggaaatatg     25680
     tcgactaaag cagggagtcg ccaaataaaa aaatcagtta gcgtgacaga tgaaaatttg     25740
     gaagattttg attatttggc tcaaaaaggc attaaaatca ctgctcaaat ggttccgagt     25800
     gaagatgcag ttgaatttgc aaatttatta aaaaaataag ttataagaag ggagaactac     25860
     aatggattta gcaatttggc agattatatt gttagttata cttgcagctt gtaccattct     25920
     tgatgcttta actttagtaa taggacttaa tttccctgta ataacaggaa cgcttgctgg     25980
     aatcattatg ggtgatatgg tgctcggact tgcaattggg gcaacgttac agctgatggt     26040
     tctaggtgtt ggtacatacg gcggtgcgtc gattcctgac tttacaacgg gagcaatcgt     26100
     cggaacagta tttgccgttt tatcaggtca ggatgcggaa tttgcgattg gccttgcaat     26160
     tccagtgggg cttttaatgg ttcaattaga tattttagca agatttacta atacgttttt     26220
     cttgcaccgc attgattcta acatcgcttc aggaaacatc tcagcagtta aaaggaatat     26280
     ttggtacggc gcattaccat gggctttatc gcgcgcggtt ccagtattta tcatgttgac     26340
     tttcggacaa agcgtggttg attttattct taacgaaatt ccagaatggc taatgggtgg     26400
     actacgtgta gctggtggaa ttcttccagt agttggtatt gcgattctcc ttcgttactt     26460
     gccaacaaac aaattcgtcg cttatttaat tatcggattt gtagcagcag cttatctaaa     26520
     agtaccaatg ctaggcgtag cgctaattgg tgtagcatta gcaatcatct acttcaaaca     26580
     aaatttcaaa aatccagtag ctgcaggagc aaatggtgca gcgctagttg gggaggagaa     26640
     tgaagatggc gaatacgaag actgagcagg attttgagaa agtcctcaag agacgcgatt     26700
     taatagcagc aaactttcgt tggttgtttg ccagccaaat ctgttggaac tatgagcgaa     26760
     tgatgtcgac tggttatctt tatagtattt tgccaacgct tcggaagctt tataaaactg     26820
     atgatgattt aaaagatatg atgaatatgc ataaccaatt ctttaataca aatcctatgg     26880
     tcggtggttt gattttagga atggatatgg cgattgaaga gcgagaaaag aaagcatcaa     26940
     aagaagtcgt aactggtttg aagactggat taatgggacc gtttgctggt gttggtgata     27000
     cgattttcgg ggttatttta ccgacgattt ttggatcaat tgccgcatat atgggacttc     27060
     aaggtaatgt gacaggtgta gttatctggg tattagtaaa tattttggtt gtgggagcta     27120
     gatttacttt acttcctcta ggatataagc aaggtgcgaa actagtgacg gaattcgcgg     27180
     atagacttaa cgcgttaacc gatgcagcta ttttgctcgg ggtcacggtc gtcggggcat     27240
     taataccaac cgtaattaaa gcaactgtcc cattcgttta taaatcagga aaagtagagc     27300
     tcaaaatgca agacatgcta gatcaaatca tgccatcact cgttccagtc ttacttgtgg     27360
     cactaatcta tgcactttta ggccacaaaa aaatgacatc tacgaaggct attttattag     27420
     taatggttat tgcgattatt ttattcaacc taaaaattct aggttaaaat ataaaaattg     27480
     gaggaataga caaaatgggt ttaacatttt ttgacaaagc gcgtgaatta acggaggaac     27540
     tagaaaaaac acaggcggaa agtattcatc aagcagcaaa actggtggca gacagcatta     27600
     tgaacgacgg aattattcaa gcatttggta gtgggcactc atatgcggca gctattgaag     27660
     tatgtgggag agcaggagga cttattccct cgaaagttat tatggaccct gctggcggtt     27720
     attatgaatc tattgagggc gttggttcct tgcttactca tagattacaa gctaaaccga     27780
     atgatatatt cttccttata tctaattcag gtcgtaatcc aatgggaatt gagcttgcag     27840
     aatggattaa atcacagggc tgtaaattaa ttgttgtaac agcactcgat gcctcgcaaa     27900
     cagcagcttc gagacactct tctggaaaat tgttgtacga gtttgcggat gttattttag     27960
     ataatcgttc agtccaaggg gatgcggcac ttgaattaga gggattagaa ggaaaagttt     28020
     gtggaacctc ttcattctca gccgttctgc ttctccaaca aacaatctat gaagcagtag     28080
     aacttatgct tgaaaaaggc tatacaccac cagtttatcg tagtgcaaat attgatggtg     28140
     gctacgaata caattttgcg attgaagaca aattcgctga tcgtattttc cacttataat     28200
     aaaaatgggc gcgaaaatga acgttatttt cgcgcttttt tggaggcaaa atgatgattt     28260
     taaaagaagt ctgtattgaa aatactacta atttggtgaa cgttattgaa gctggagcta     28320
     atcgagttga gctttgtgat aatctagcgg agggcggaac ttctgttagt tatggggttg     28380
     cgaaacatgt tgtgaaaatt tgtcatgaac aaaatgtaag tgtaatggca atggtccgtc     28440
     cccgaaaagg caattttgtt tatacaaaag aagaaatttc ggttatgatt gatgacattt     28500
     tgatgtacaa gaaaatagcg gttgatggcg tggtttttgg ctgtattacg gattctggat     28560
     tgctagataa accagccata aatgaattat tgaaagctgc agcaggtctg gaagtgactt     28620
     ttcatatggc gtttgatgag ttagtagaaa cagaaaaatt atcggcaata gactggttag     28680
     ttgagcaagg cgttacaaga attctcacgc atggtggtga cggcgctaaa cttcccgaag     28740
     aaacttttgt tcaatggcga aaatatattg attacgcagc gggtcgaatc attattttac     28800
     caggtggagg aattaaatcg cacaatttag aatggattat aaaagaaact ggagcagctg     28860
     aaatacatgg cactgacttg tttggggagc gctaaaactc cccaaataaa tttattttaa     28920
     aaaaatgctt gcaaccgttt tctttatatg atatatttat ctcatcacaa aggattgtta     28980
     ccaattcatt gggcaaaacc taagctgatt tgtaggacac gtgtatgcgt ggagtcctcg     29040
     aatgagctta ggtttttctt tttgcccaaa aaaccaaaaa gaggaaggaa gtcgtcaaaa     29100
     tgaaatatga acaattagca aaagacatct tgaaaaatgt cggcggtaaa gaaaatatca     29160
     acagtgtttt ccattgtatt accagacttc ggtttaaact gaaagatgag aatattgcga     29220
     acacgaaaga aattgaaaaa cttgatggcg taatctctgt cattaaaagt ggtggtcaat     29280
     accaagtagt tatcggtaac cacgtaccag acgtatttaa agcagtatta gaagttggcg     29340
     ggatttcagc tgaaggtgac gaaggaagta gtgcaccagc aacaggtaat atcttcaacc     29400
     gcttcatcga tatgatttct ggcgtattta caccagttct aggtgtatta gccgcaacag     29460
     gtatgattaa aggtttcacg gcaatgtttg tagcatttgg ttggattaca gttacttcag     29520
     gtacgtacca attactttat gcaattgggg attgtttatt ctacttcttc ccaatcttcc     29580
     taggttacac agcaatgaaa aaattcggcg gaaacatatt tatcgggatg gctataggtg     29640
     gtgccttagt ttatccaaca cttgcaggta ttacagcagg tgacccactt tatacacttt     29700
     tcgcaggaac aatttttgaa tctccaattc acgtaacatt tttaggaatt ccagttatct     29760
     tgatgtctta tgcatcttct gttattccga ttatcgtagc aacatatttt ggttccaaag     29820
     tagaaaaagg cttcaagaaa atcattccag atgtaattaa aactttcgta gttccattct     29880
     gtacattatt aatcgtagtt ccaatcactt tcatcgtaat tggcccaatt gctacatggg     29940
     ctggtcaatt attaggagca ggaacaattt gggtttataa cttaagtcca attatcgcag     30000
     gtctaatttt aggtggtttc tggcaagtat ttgttatctt tggacttcac tggggtcttg     30060
     taccagtggc aatcaacaat ttaactgttc ttggacatga tccaatttta gcaatgacat     30120
     ttggtgcatc ttttgctcaa atcggtgcag tattggcagt attctttaaa tctagaaaca     30180
     aaaaaatcaa atctcttagt atcccagcat ttatttccgg tatctttggt gtaactgaac     30240
     cagcgattta cggtgttact ttacctctga aaaaaccatt tatcatgagc tgtatcgctg     30300
     gtggtattgg tggcggaatc attggttttg caggatctca aacatatatc atgggtggac     30360
     ttggaatctt cggtcttcct aacttcttca aaccaggtag cggtatttca ggcgaattct     30420
     ggtgggtagt tatcgcaatc gttatcagct tcatccttgg tttcatctta acttatgtag     30480
     taggtttcaa agatccagct gatgtagtag tagaacaatc taacacagta gaaggcgaaa     30540
     ctttaatcga acgtgaaaca attccagctc cagtagttgg cgaaatcgta actttagcag     30600
     atgtaaaaga cgaagcattt tcatccggtg cacttggaaa aggtgttgca attatcccta     30660
     ctgtcggacg cgttgtagct ccagcagccg gaacagtaac aactatcttc ccaactggtc     30720
     atgcaatcgg tattacaaca aaagatggtg cagaagtttt aatccacatc ggtatggaca     30780
     ctgttcaact tgaaggtaaa ttcttcacag cacacgttaa gcaaggcgac gtaatcgaaa     30840
     aaggtcaatt actaactgaa tttgatattg aaggcattaa agcagctgga tatgacgtta     30900
     caactccagt agtagtaaca aactccaatc aatatttaga cgtaatgatt acagatgcaa     30960
     aagaagcaaa actagaagaa cgtttaatca cactagtaat ctaagacttt taaataaaca     31020
     gcttgggcag taacttgctc aagctgtttt tatgttatac tgagaaaaaa cggacggtga     31080
     agcacctatg ctagtaaaag gcgatacagt gggaattatt tgttgttctg atggtcggaa     31140
     aaaagaagat gagaacagaa ttgcactgct tgagcaagtg ctaaaaacag aatttagctt     31200
     gcaagtagtt tttgctgaaa ctatttttca aaaagctgaa tcgccattta gtggtactcc     31260
     gcaagctcgt gcgatagaac tgatgaaatt ataccagcgt tcagatgtgc aaatgatttt     31320
     tgatatttct ggtggagatg cagccaatca agtattgcct tatcttgatt ttgatattat     31380
     ccgaaatgcg caaaaaccgt ttgttggcta tagtgatcta acggtgattt tgaatgctat     31440
     ttatacgaaa acagaacaaa tgggttataa ttatcaatta cttcatttag tcggtaaaga     31500
     tagtgagtta cagcagagtc attttagaaa aacatttttt gaaaatcgtg tattaattag     31560
     cggagagcag cttaatgagt ttgtgtggcg tggtggcgaa gttattggag gaaacattcg     31620
     ttgcttttta aagttagcag gaacaaattt tatgcctgat ttcactaata aaataatttt     31680
     gttagaaagt ctcggtggga aagaggcgaa gcttgcctca tatgtggctc aattagagca     31740
     attaggagcg ttttctaaat gtttaggcgt tattgtggga caacattccg aagcggagga     31800
     aaacggtgaa tatgaaagaa ttggtcgctt atatcaacaa attggtcgga agtataagtt     31860
     gccgattttc cgaacaagcg aaatagggca tagtgtagat gcaaaaccat gcttaattgg     31920
     tgcaaaagtt aatgtttcac gtgaaacatt aacaaatttt taataatttt attgcgaaat     31980
     gttcataatt aacctttaat atagaacttg taagcaagga atacaattag ttttactccc     32040
     tttttgctaa ttgtaaactt ccttaaaatc ctaaactccc ttttttggac cgacttgatt     32100
     gtcggtcttt ttttaatctt tcaagctgat aactattcaa ttttttgtta aaatgataac     32160
     atgaaagaaa atgcgtataa aaaaggagtt tttatcatga aagttgaagg attacttggc     32220
     tttttagggg cggcactggg tattggattt agtttgatgg ttctagttat tcctgatatt     32280
     tcacaggcat tagaagagga gtcatttttc ttctatatgt taacgattgg ttcacttgta     32340
     ctttcaggag tggggcttgc aggatcgttt attgtttcgc ataagccgcg tcttggtggg     32400
     gcgatgatgg ttgcagctgc aattggctgt acaatgtcga tttcgattat gttcttacta     32460
     ccaatcgtat tacttgctgt tggcggacta attgcactaa ttaactatga agaagctgct     32520
     tcagtagaag aataaatgaa aaaaagctgt ccacgtgggc agctttttta ttaacgatta     32580
     agatgttttt tcaaaaagta gtaaattcca tcggcatcat ttgcagtagt aacaaaatca     32640
     gcactttttt tcactagttc actcgcattt tccatcgcaa cccctgcacc agctacttca     32700
     agcatcccaa tatcattttc accatcacca aaagtaatca cattttctgg cttgatattt     32760
     aaatgtgccg cgagattttt cacggcatat tttttatcca tatcttttgg taagatttca     32820
     atattattgg catgggaaga aaggatagaa acatcggaga gtttttctag atcactgcga     32880
     aggactgcga gtttgtcgaa atcttcttcc tcgattacga taccattaat gaactggtcc     32940
     gcatgctcaa ggaaaatttc tcttgattta atcgctacga gttttgtggc gtttactcgg     33000
     cctttatctt cttcatccgt aaaataatat ggtggatttt tagtgtagaa aactgtatct     33060
     gttgaaaaga aaaatactgg taaatcatga ttttggcata ataaaaatgt ctcgagtaac     33120
     gcagattgtt tcattttttc ttgttgaatg atttcgccgg atactgcgac cacaccgccg     33180
     tttgaggcaa tgacatctgc ttttggatga acaagtttgg cgaagtctgt tgcggaattg     33240
     tacattcgac cagtggaaac ggcaaaatgg tgaccttctt ctattagttg ttgcaataaa     33300
     tttagtgttt ttggtgagat agtttgattt tttagcagta atgttccatc taaatcagaa     33360
     caaattaagt atttttccaa gtggaccttc ctttcgttat agcttagagc cgcaagattc     33420
     gcggataatt agttctggat tatggttgat aatcattggc tcgacttgac cgttaatggc     33480
     gctaattagt tgtaaaatag ccattttacc aagatattca ttgtgttgat ccatggaagt     33540
     taaacgcgga gtttggtaat cgccattcat aaattgatca cagctgacaa tagcgatgtc     33600
     ttcagggcaa gagagtttgg catcgttaat cgcccgaatt gccccgatag cgacattatc     33660
     attgatagct acaagcgctg tcggcaaagt agtgctattt tctaaaaggt gagtcatcgc     33720
     cgcgtaacca tcagccgtat aataatcaga tagaactacc cagtcgtcat ttaccggatg     33780
     ttgatagcta gtcattgctt ctttaaaaga ttctagtcgg taggtggtaa tttttacacc     33840
     agcttctccg ccaataaaac caatattttt atgcccaagt gcagttagat gactaactaa     33900
     ggttgttaca ccttttttta aattacgttc aataaataaa cagttgagct cagggatttt     33960
     tgacccgata acaactactg gaattgcatt atttaattga tttagagcag ttatatactc     34020
     ttttggaacg atttctttat cgatttctcc acctaaaata agtaaaccat ccacttgctt     34080
     ttctaaaatg attttcaagt aatcttcttc cgttagggga tgttgattat tcttattatc     34140
     tggctccgca agcattgtat tgaacaaaat cgtcgaaaac atataatcta gcgcgaattt     34200
     ttgaatttgc gttataagtg aaatgaaata gggattagaa atatctggta aaataacgcc     34260
     tatattcttc gtctgcttat tgaccatccc acgagcaaac acgctaggtg tgtaattatg     34320
     ttcatcaatg attgcttgga tttttttgcg tttcgcagct gaaacagaag gactgttatt     34380
     aagaacccgc gaaacagttg aaacggagac accactaagt ttagctattt cttgtatagt     34440
     tatttttttc attcgaaatg ttcacctcgt aagcattttt aactatttta agtgtagcgt     34500
     atttatgggt aaataacaag taaattttgg taacgttatc aaaaatatga taaaaagggt     34560
     tgacatatta aaaatatccg gttattctat gttagaaagc gctatcaaca aatgttttaa     34620
     tttggtaacg ttaccaaaaa tgaggtggaa tagttggaca tacaagaatc tgtcatcgga     34680
     attgatctag gtggcactaa aattttaatt ggcgaagtaa cgaaagatgg tgaggtgcta     34740
     aattccaaga gttatccaag taatacggag aatcagacca aagctaccga aacattgttg     34800
     aaggtattag ctgattacac acaaaatatt ggttttatag caccaaaaca aacgggtatt     34860
     ggtgtggggc tagttggtcg tgtggatcac aagtcaggtg tttggttaga gattgaacct     34920
     ggaaaaagca atccaacccc gcttgcaggc attttagaag caaaaacagg attacctgta     34980
     agtctgggta atgatgttgt ttgtgcaaca atggccgaaa agcaatttgg ttggggacgg     35040
     gaaacaaacg attttattta tttaaatgtt ggaactggtc ttgctgctgg gtttgtggtg     35100
     gatggacgaa ttacacaagg cgggcacttt aacgctggtg aagtcggtca tgcagtagtg     35160
     gatattcata gcgatgtact ctgtggttgc ggtagacgtg gttgtgtgga acgacttgct     35220
     tccggtcttg ggattaaaga agaggcgctg agacatttga atagctatcc gacatccata     35280
     cttgctgaaa ctcaaacaga actaactgga aaaatggttc ttcatgcagc ggagcaaaaa     35340
     gatgagcttg cagagaaaat tattgataat gcaacgtttc agctagcaaa tttgattatg     35400
     aatttagttc gtacaaccga tcctgaatgc gtaattcttg gcggaggcgt gacgagaaat     35460
     gagcattttt tccaaaagat acaagataat cttcaaagca atacaattcg ttttgttaca     35520
     aaaggcgttg tccgctctaa gcttgagaag gataaagttg gtttaattgg cgcagccgtt     35580
     attggaatga gactaggaaa tgaaggagga aaagaatgaa gccaagtatg aaacgacaaa     35640
     ttgcgcaaac tggtattatt catcgaccac tccctattga aaccgagcac gcattagaaa     35700
     ctttagcgaa aaagaaacaa gttttatcaa gtagaacatt atttagctct aaacagcatg     35760
     tttctttaga gtttacacat caaggagcag gagattttac tatttctggc caagatgaaa     35820
     ttaagctttc ttcgcctgtg gttatgccac attggcccgc tggtgctccg gatgacggtg     35880
     attatactaa ttttggtaac gttaccatat cggcgtcgat tggaaatgag gactggagcg     35940
     gctttaatcg tgtgcgaatc caagttttcc ctgattttcc tggagtgaca aacccctatt     36000
     taatgattag ttttaaaaac gacggaaccg tgaaagtgcc tgatatatat gggcgagaag     36060
     gtgttcatgg tgtgaattta atcaaccatg aatggaatga tgtcattttt gaaattgaag     36120
     gtttaccgcg cgaccgaatg actgaaatga gttttagcta ttacttgaat ggcccagagc     36180
     gactgactgc tggaacgatg gaattattta ttaatgaaat taaattagaa caaatcagtg     36240
     agccggagat ttccaagggc tggcttccgc aaaataacac gctaatctat tctcataacg     36300
     gttactccaa agacatgcca aaagtggcgt tttgtgcgaa caagcatgct gcgactacat     36360
     ttacaattca cgacaaagaa acagacaaag ttgttttcac tggaaaaagt taccaaaatg     36420
     caacagaaac tggcaatttc gttattcttg atttttctga tttacaaact gtgggtgaat     36480
     actatttaaa atttgcggat atgcaaacgg aaattttcca aattgggact tccgaagtga     36540
     tctgggaatc ttctatctgg aaatcgctta actttatttt ctgcgaacgt tgcggttgcc     36600
     cggtttttgg gaaacatacg acttgtcacg cagatattat cgctgaacat gatgggaaac     36660
     agttgtcatt taatggtgga tggcatgatg cgggcgatgt ttcgcagcag cttattcaaa     36720
     cagcagaagt aacgatggct ttatatgaaa tggctgcgag tttacctgaa aaagaggaaa     36780
     cgttgcggat gcgcctttta gaagaaggcg agtggggcct agatttcatt ttgaaaacgc     36840
     gcttcggaga tggttttagg gcgactagcg caggtatgac gagatggacg gatgggcttg     36900
     ttggtgggat ggatgatgca attgcgcgcg ttcataacca agcttatgag aacttttatt     36960
     gtgccgggat tgaagcgtat attggcagcc aaattgcgga taatgctact atgcagaatc     37020
     atttgctgag aatcgcggaa gaggatttgc tttttgcgat aaaggaactg gaaaaacacg     37080
     gaacaagtca aaagccgatt ttctgggagc atacgtatca aacctcagaa agtctatatt     37140
     atgcgactgc ttcttgggcg gcttcgatgg tttatcaact aacaaacaaa gaaatatatg     37200
     cagaaaaagc ggccgaatgg ttagatttga tgctagaagc gcaagaaaaa gctggaatta     37260
     gagacagcga aactagcgaa ctttacaaag gatttttcta ccgcgataaa tcacacaagg     37320
     tcattcaaca ttttaatcat caagcacgcg aacatcttta tttactggcg ctagaggcgg     37380
     cgcttgaaac gcaaccgagt cacgctgaaa aacaaacttg gctacaagcg gtcgaaatgt     37440
     acggcgatta tttgaaaaaa gtaacacgtt tcactaaacc atacccgctc attccagcag     37500
     gactttacaa aaaagatgag tatttagacg aagcaagttt ccacttacaa catttactca     37560
     ttgatgaacg agcgatagaa gaataccaat tacaattcga gcaaggtatc aaaataaacg     37620
     acgaggtagc tttgcggaaa ttcccaattt ggttctcgtt tagaggaaat aacgctattt     37680
     tactttcggc aggaaaagcc gcatcaattg ctgggaaaat tttgaaagat aaggcgcttt     37740
     tagatattgc ggaaggtcaa ttgcagtggg taattggaat gaacccattt ggacaatcaa     37800
     tgatgcacgg tgaaggttat cgctacgcac agcaatacag tgtactaaat ggcgaaatca     37860
     caggagaaat accagtcgga atggaaacct ttagaaatga agatgaacca tactggccgg     37920
     agtttaataa tgcaacttat aaggaagttt gggtcggtaa tgccggcaaa tggatgtcaa     37980
     ttgtagcaga tttaaacaaa ataacaggaa agtcatagga ggacaaaaaa atgagttcag     38040
     agagaagttt atctagccga tttattgaag gattatcaat ttttgcccaa aaaatttcat     38100
     cgcaaaagca tatcatggca attcgtgatg gctttgcagc gatgattccg attacgatta     38160
     ttgcagcatt tttcttactt gtaaataatg tgttgcttca accagaaaac ggtctgctta     38220
     aatttattcc aaatgtagaa aattatttgg gtgtaggtat tcaagtctat aacgcgacac     38280
     ttggtattat ggcgatttta gcagcattct taattggtaa ctttttagct aaatcatatg     38340
     gaatggaagg tcgtacggaa ggggttatcg ctgtagctgc ttatgttgtt ttaataccgg     38400
     catcttctca tttaatgtct gttgatggaa aagcttttga agcgggcggc gttttaactc     38460
     aagaaatgac aagttcaaca ggtatgttcc ttgcgattat cgctgcttta gttagtatta     38520
     caatgcttgc aaaattctcg aaaagtaaaa aattaaagat ttctatgcca gaaagtgttc     38580
     ctccggcaat tgcaaaatca tttaacattt taattccatc attcttagtt ctaagtattt     38640
     tagcaattat tgaagtactt gtagtcagtt tcgtatcaat gagtatccca gaaattatcg     38700
     taaaagtact acaaattcca ttagttggtg ggttccaaac gttaccagga attctacttt     38760
     atgtattctt agcgggattc ttatgggtct tcggtattca tggcgcgttc gtattaggtg     38820
     cgatttccgg accagttctt ttaacttctt tacaacaaaa cattgatgca gtgaatgcag     38880
     ggactgcttt accaaacatc gttacacaac catttttaga tgcttttgta tacatgggtg     38940
     gcggtggaac aatcatctgt ttagttatcg caatctttat tgcttctaaa cgaccggatc     39000
     accgcatggt aacaaaattt ggtttgattc cgagtatttt caatgtcagc gaaccactaa     39060
     tgttcggtct gccagttgta tttaacccga tttatggtat cccattggtt attgcgccgc     39120
     tagcttcgac tgcaatggcg tacttcgcaa cttcgtgggg ctggattagc cagacttata     39180
     ttttgattcc ttgggtgact ccaccagtgc tttcaggtta ccttgcgaca ggcggagaca     39240
     ttcgcgcttc catccttcaa atcgcaatta ttatcgttgg aacgctgatt tacctaccat     39300
     ttgtacttgt agcaaaccgc gcgtacgtgt tagaacaaaa agctgctggg aaagtagaag     39360
     cagtaacgaa tggagaagtt taaaatgaaa ccaacaatga tgacttatat taatgaagaa     39420
     gaggaaatgt gtcgagcgat tttagccaat ttccaaacaa atgcagaaaa attagaatca     39480
     ctcgtaaaaa atggcgcaaa agaatggtta attttagcaa ctggatcaag cttaaatgca     39540
     gctcaaagcg ccaaatatta cattgaaaat atcgcagatg tccgtattac tgttgaagaa     39600
     cctttcaacc atctatatta cgaaaaacta tcaaaccacc tagatctagt catcggaatt     39660
     tcgcaaagcg gtcaaagcac atcgactatt tctgcgctag aacgagtgaa aaaagaagct     39720
     tccgttccag tagtcgccct aactagtgat gtaacgagtg aaattgctga atttgcggat     39780
     attacgcttg atatcggctc cggaaaagaa cgagttggct acgtaacaaa aggttttaca     39840
     gcaacagttc taacattaat gctgacagga cttcattttg catacaaaac agcacaaatt     39900
     gatgaaacca agttcaataa tgaaatcaat gcatttagcc gagcaaccaa cgcaatccca     39960
     gcaacaattg ccgaaacaga agcattttat gaaagatggc aagaggaatt cgctactgca     40020
     ccgaagttta cagcaattgg atatggtcct actgttggaa cgtgcaaaga atttgaaaca     40080
     aaattctcag aaactgtccg cgtgccatca caaggtcttg atttagaagc gtttatgcat     40140
     gggccatatt tagaagtaaa tccacagcat agaatcttct ttttagaaac agaaagcgcc     40200
     gttaccgaac gattagtagc gttgcgcaat tatgaatcta aatatacacc gtttacgtat     40260
     acagttaaat ttggtacagc tggaaatgac cgaacgctat tgataccagc agatttagac     40320
     gaataccaag cgccgttcct aatgattctt cctttccaaa ttttagcgca tcatattgcg     40380
     gagttgaagg gaaataaatt aacagaacgt atctacacgg actttggcgt agcgatgaag     40440
     agtaaaacaa aaccaggtga ctatgcataa gagaggctaa tagactggaa aaacccgtat     40500
     aaggagggtt tttccagtct tctttttgta tttgggtcac atgttacgca gaatgtaacg     40560
     agttacaggg tgattcggtc tgttcttaaa aaaagaaaac gtattcaaaa ataatctctt     40620
     ttgtactatg atgagcatgt ggcaaggaaa tactcgagta tgccccagaa aaggtttaga     40680
     aaataaatgg ttgaggtgat agaaatgaac aaaaaaagag attttatcga cacaaaagat     40740
     ttttctaaag aagaaatact atttatgata gaaatcggtc gcaaaatgaa agaatctatt     40800
     aaaaacggtc attacccaca acttttaaaa cataagacgc ttggtatgat ttttgaacaa     40860
     tcatcaacaa gaactcgtgt atcttttgaa acagcaatga cacagcttgg tggtcatgcg     40920
     caatatttag ctcctggaca aattcagctc ggtggacatg aatcagtagg cgatacagcc     40980
     aaagttcttt ctagattagt agatatattg atggcgcgtg ttgaacgtca tcaaacagta     41040
     gtagaacttg caaatacagc tgctattccg gttattaatg ggatgagtga ttacaaccat     41100
     ccaacacaag aattaggtga tgcaattact atgtttgaac accttccaaa aggaaaaaag     41160
     attgaagact gcaaaattgt ctttgtagga gatgctactc aagtatgtgc atctacaatg     41220
     tttatggcaa caaaacttgg aatggatttc gttcaatttg gaccaaaagg atttcaatta     41280
     cgtgaagaac atttgaaagt tgctgaagaa aattgcgaag tatctggcgg gagctattta     41340
     attacagaag atgtagacat tgcgttaaaa gacgcagatt tcatttatac agatgtttgg     41400
     tatggcctat acgaagcgga actttccgaa gaagagcgaa tgaaaacttt ctatcctaaa     41460
     tatcaagtga ataaagaatt gatcagtaaa gcggctccac acgtgaagtt tatgcactgt     41520
     ttacccgcaa ctcgtgggga agaggttact gacgaagtgc ttgatgctcc atactcagtt     41580
     gttattgatg aagctgaaaa tcgtttaaca gcgatgagag cactgcttgt atactttatg     41640
     aatccgtatg tgaaagaagc gggttttgca gttgcggaaa aatatgatgc tgaactagag     41700
     ttattactta gaaatggcgc tggcttataa gataccaaaa taaggaggag aagagagcgc     41760
     tggccgtttt cttcccccca cttaaaaaga ggagtgggca ttttggaaaa aaagaagaaa     41820
     ttcagattat ttgatgcggt tcttatggct gtatgtgtcg ttttggttgt ggaatctgcc     41880
     gcgccagcag cggcgatagg atcatctcaa tttttctggt ggattgcgtt acttatttta     41940
     tttttcttac catatggact tgtttcggca gaacttggga caacctatga tgatgaaggc     42000
     ggaatttatg attgggtaaa acgggcattt ggccgaaaat ggggtgcacg tgttgcttgg     42060
     ttatactgga ttaattatcc gatttggatg gcgagtttag cggtattgtt tgtagaagtt     42120
     attacgcaaa ttttcccggt ttcatttggg acgccagttt cgattttgat tcagctcatt     42180
     tttgtgtgga ttgttgttat tgttagttgt tatccagtga gcgatagtaa atggattctt     42240
     aatatcgcgg ctttctgtaa agtcgcaatt atgctttgcc ttggtgtact tgggatttat     42300
     tttgcgatta cgaagggatt ggcgaatgac ttttctggaa aagcattact tccaactttt     42360
     gatttagaga gtttatcatt tatttcagtc attttattca atttcttagg ttttgaagtg     42420
     gtaacaacgc ttgcgagtga catggaaaat cctaaaaaac aaattcctca agcaattatt     42480
     tatggtggga ttttgatcgc attcttctat ttactagcag ctttcggaat gggggcagca     42540
     attccgactt ctgaactttc aacgtcaggc ggccttattg atagctttat tatgctgatt     42600
     ggcggagtta acccatttgt tattattatt gggattatgt ttatgtatac attagtagca     42660
     aatttagtgt cttgggcact aggcgtgaat tatgtagcaa tgtatgcagc gaaaaacaaa     42720
     gatttaccag ctgtttttgg aaaaacaaat ccgaaaaatg atatgccaac gggtactagt     42780
     atattaaatg ggattgtagc ttctgtatta atcgttgcgg caccacttat tccaaatgaa     42840
     aatattttct gggcattctt tgcattaaat gtagttgctt tactaggttc atatatccta     42900
     atgtttccag catttttgaa attacgtaag ttggatccgg accgagaacg tccatttaaa     42960
     gtgccaggtg gcaaaatctt gctttactta atgactttcg taccaatgat tttactcatc     43020
     attactttga ttttctctgc agtaccatta aatggttcaa gtgcagaatt aaatgaaaaa     43080
     atcccaatct taattggaac cattgtagcg gtgattgttg gtgaaatatg tatttggctt     43140
     gctggcaaaa gaaaagacaa aggagagata aaaaatgaga acgattgata gttcttctaa     43200
     aaaagatgga tttagaatgc ctggggaatt tgaaaaacac gctggttgct atattatttg     43260
     gccagaacga ccagataatt ggcgcttagg ggccaaacct gcgcaaaaag cttttgttga     43320
     tgtggcaaca gcgatttctc attttgaacc agttactgtt gttgcaagtt ctagtcaata     43380
     tgtaaatgcg agatatatgt tgtctgatga aattcgcgta gtggaaatgg ataacgacga     43440
     tgcttgggtg cgcgattctg ggccaacttt tgttgttaat gattctggtg acgtacgtgg     43500
     agtggattgg tcatttaact cttggggggg attggtcgat ggtttgtact tcccgtggga     43560
     taaagatgat caagtcgctc aaaaaatatg cgaattagag cgaaaagatc gttatcgctt     43620
     agctgatttt gtgttagaag gaggttccat tcatgtcgac ggtgaaggca cgcttgtaac     43680
     gacagaagaa tgcttattat cagaaggtcg caatccacaa ctttcaaaac agcaaatcga     43740
     aatggtttta aaagagtatt taaatttaga aaaaattatt tggttaaaac gaggaattta     43800
     tttagatgaa acgaatggtc atgtagataa tattttcaat tatgtacgcc caggtgtagt     43860
     agcgcttgcg tggacagatg atgaaactga tccgcagtat gaaatttcca aagaatgctt     43920
     tgatatttta tcgaatgaaa ccgatgcaaa aggtcgcaaa ttagaagtgc ataaaataaa     43980
     tgtaccaaaa ccaattttaa ttaccgatga agaaagtaaa ggtgtagatg ctgtggaagg     44040
     aacgctacca agggaagaag gcgaccgact cgcagcaagt tatattaatt actacacagc     44100
     caatggtgga gtgatttttc cgctatttgg ggatccaaat gatgaacttg ctcgcgaaaa     44160
     attacaacaa ctttatccaa actgtgaagt ggttggtgta aaagcaagag aaattttact     44220
     tggcggcgga aatattcact gtattactca acaggtgcca agatgataag gagtgaacat     44280
     catgaatcaa aaaatagtcg tggcacttgg tggaaatgca attttatcga gtgatgccag     44340
     tgctgaagcg caacgaagtg ctcttgaaga aacagccgaa tatttggtgc aatttatcga     44400
     aaacggggat gatttaatta tttcgcatgg aaatggaccg caagtaggca acctgatgct     44460
     acaacaacat gcgggagctt ctgaaaagaa tccagcaatg ccgcttgata cgtgtgtcgc     44520
     gatgacgcaa gggagtattg gctactggat gcaaaatgcg ctagataaag catttttaaa     44580
     acacgggcta gataaagtag cggtttcatt aattacacaa gttgttgtgg ataaagatga     44640
     tcctgctttt gaaaaaccaa ccaaaccaat tgggcctttc cttaataaag aagaggctga     44700
     aaaggaaatg gcagaaactg gtgcaatctt tcttgaggat gctggccgag gttaccgtaa     44760
     agttgtccca tctcctcgcc cacttagtat taaagaacat cagattatta aacaattggt     44820
     tgatagtggc gttgtgacta tttctgctgg tggaggtggg gtttcggtcg ttgaaaatgg     44880
     ccttgattta tctggggtag aaaccgtaat cgataaagat tttgcttctg aaaaacttgc     44940
     agaactaatt gatgcagatt tgttggttat tttaacaggg gtggaaaatg tttatatcaa     45000
     ttataatcag ccaaatcaaa agaaacttga acaagtgacc gtttcagaat tggaaaaata     45060
     tattgatgag aaacagtttg cagcaggaag tatgttgccc aaaatcgaag cagcgacagc     45120
     ttttgtcaaa gaaagaccac atgccaaagc aataatcaca tcgcttgaaa atattggcgc     45180
     catgctagaa cgtggggcag gaacagtgat tgttgcaggc tagtaaaata ggacggaaat     45240
     ccgggtaatt gttactcggt ttttgtcttg taaaacagta tttcatgtat aatgtgttta     45300
     tgaagtaata ggaggagaat gaggatggga caactgaaag ggttgccggt agaggacgga     45360
     ttcagaatgc caggagaata cgaacctcat attggctgtt tcatgatttg gccggaaaga     45420
     cctgataact ggcggcttgg tgggaagcca gcgcaacaaa actataaaga agttgcagtc     45480
     gctatttcaa attttgagcc agtcactatg tttgtatcac caaatcaata taaaaatgct     45540
     cgtaaagaac ttccggatac cattcgtgtt atcgaaatga gtaatgatga tgcgtggata     45600
     cgcgattatg gacctagttt tttggtggac gataagggag atatgcgcgg cgttgactgg     45660
     gggtttaatg cttggggtgg tcttcttgat ggtctatatt ttccgtggga taaagataat     45720
     caaattgcaa aaaaagtttg tgagttagag cgaatcgact actattcaca gaaagatttt     45780
     attttagaag gttgttccat tcatgtagac ggtgaaggga cacttgttac gacagaagag     45840
     tgccttttat cagaaggaag gaacccgaat ttaaccaaaa tagaaatcga acaaacttta     45900
     aaaaaatatt tccatgcaca aaaagtaatc tggcttaagc atggcttcta tcttgacgaa     45960
     acaaacggac atgtagataa catttttaac tttgtggcac ctggagaagt tgttttatcg     46020
     tggacggata acaaaagtga tccgcagtat gaaatttcaa gagaatgtta tgatatttta     46080
     gctaacaaaa cagatgctaa gggaagaact tttataatac ataaactaca ttgtccagat     46140
     ccagtactta ttacgcaaac agagagcgaa ggtgtggaag cgattaatgg aactttccct     46200
     agacaggctg gagatcgatt agctgctagt tatgtaaatt actatacagc gaatggtgcc     46260
     attattttcc cattgtttga tgatccaaaa gataaagatg cgcaggaatt acttgaaaag     46320
     ttatatcctg atagaaaaat tgtggggatt aaagcacgtg agattttgct aggcggcgga     46380
     aatattcact gtatcacgca acatctccct gataaaagta cgatacgtga ataagaagga     46440
     gacttgaagt atggactttt acgaaatttc cagtaagact gtagcttccc taactcgaaa     46500
     tgagcgaatt ttatttgact atgtcgttaa gaatatgaat ttaattaaaa atcaaagcat     46560
     tcgagaagtt tctgcagaat gctttgtttc aacaacaaca tttttgcgct ttgtaagaaa     46620
     gcttggattt actggttata gcgagtttac aacggtctta aagttcactt tacttgggca     46680
     tacagagcta aaaccgtccc catttgtcgt agaacagtcg gattatcgtg aagaatattt     46740
     aaaaaacatt attgaatctg tccgagtttt agaaccaagt aaaatcaaga aaatcaccaa     46800
     aaaactagta aacaaaccgc gaatttattt ttttgctaaa ggactgagca aacatgctgc     46860
     gaaatacatc aaatatctct atacaatgag cggatttttg gtagagtttc ctgaagatta     46920
     tcaatatcgc caagctgtat tgccgcatat tggtaaagat gatttagttt ttatccttac     46980
     gtacggtgga catgatattg aattaatcca aactgcccaa aaactaaaaa gcagaaacga     47040
     aacgcctatg ttgatttcga ttaccggggc tgataataac attattcaaa atatgagtga     47100
     tattaattta tatattttta cagatgaaat tgaaatgaac aatttagaca tcacttctcg     47160
     catctctaca attgcaatta tggagctaat cttataccag tttatggaag atgaaactag     47220
     tagcttttaa ttgttaagaa ttgataaata agtcacaagt ctgatacaag gagacttgac     47280
     ttgtggtaaa atgaactttg acttttaaat aaaagaaaag gaagtgagtg cctggtggat     47340
     tttattacct atatcattga ttttattttg cacattgacc aacatttagt ggagattata     47400
     aataattttg gaatttggac ttacatcatt ttattcctga ttgtatttat agagactgga     47460
     ttggtagtat ttccattttt accaggagat tcattactat tcgcagccgg tgcattatct     47520
     gtattagatg gttcgatttt acatattgtt ccgctaatta ttactttatg gttagcagca     47580
     gttctaggtg atacagtgaa ttatcatatc ggtaaaaaga ttggaacatc cataccagaa     47640
     gatagctggt ttggaaaact aataaataaa gaaaaaatgg aaaaagcgga ggctttcttc     47700
     aataaacatg gtgggaaaac aatttttatt gctagattca tgccttttat tcgtacgttc     47760
     gcgccatttg tagctggagc aagccgtatg aattatcgct atttcttaaa ttataatatt     47820
     ttaggagcaa cagtctgggt attgctttgc acgcttgcag gatacttctt cggcaatttc     47880
     ccaattgtta aagacaactt ctcgttagta gtaatcggaa ttattgtagt ttccgttatc     47940
     ccaatggttg tttcatttat taaaagtaaa atggacaaga aaagcgcaga ataatctctg     48000
     tgcttttttt tatttcccgg gaaatctctc gcatacatga caaacttttg gggtaattag     48060
     ttaggaagag gtgatgaaaa tggaacaagc attgaatatt acatctgaaa ttggcaaact     48120
     ccaaacagtt cttgtaaaga ggccgggttc tgaactcgaa aatatcacac cagaatacct     48180
     agaatcttta ttatttgatg atataccgta tttaaaaatg atgcagaagg aacatgattt     48240
     ttttgctaaa acaatgagag attcaaacat cgaagtactc tacttagaaa aactagccgc     48300
     tgaagcattg cgagaagcta acaataaaga gtccttttta acgaaaatga ttaaagaatc     48360
     caatcaaatg gacgaaagtg cgctatatgt gcgagattat ttgatgtctt ttgacgagga     48420
     agaaatgatt agaaaactta tgtctggttt gaaaaaatcg gaaatccccg agcgtaaaaa     48480
     gaaacattta aatgaaatga tggacgaaca atatcctttt ttcctagatc cattaccaaa     48540
     tttgtatttc actcgagatc cagcagctgt tattggtaac ggggtgacga ttaatagaat     48600
     gttccagcca gctagaaggc gagagtcaat atttatcgag ttgattttaa aacatcatcc     48660
     tcgttttagc aatcaagata tcccggtatg gtcaggacgt ggggagccgt tttctttaga     48720
     aggtggagat gagctagttc tgaatgaaga gaccgttctt gtaggtgtat ctgaacgaac     48780
     tgatgcacgg gcagttgaac ggcttgcaga aagtttattt aaccgttctc caaaaattaa     48840
     acgagtttta gctgttgaaa ttcctgaaac aaggtcattt atgcatttgg acacggtttt     48900
     caccatggtt aattttgcgc agttcacgat tcatccagca attcaaaatc aacaaggtga     48960
     actcaatata tatatattgg aaaaaagtga gaatggattg gaaataactc cgcgaagaga     49020
     ttttcagcgc gtgattgcgg aggttttgga tgagccagaa attgatttta ttccttgtgg     49080
     cggagaagat gtaattgttt cggcgcgaga gcagtggaat gatggggcaa atacgttagc     49140
     gattgctcct ggagaagtaa ttacatatga tcgaaatcaa gtatcaaacg atctgttaag     49200
     aagtgcgggt attaaggttc atgaagtgat tagttcagag ctttctagag gccgcggggg     49260
     accaaggtgt atgacgatgc cgcttgttag agaaaatcta aaataggctt tgaaaaatga     49320
     gaatcccctt tcaaaatgcg actttcgcta aaagtattgt tggcgatttt aagatgtgct     49380
     atagtgtttt caaaccagaa ttttcgagaa atatcttgct ggttagtttg cgctatgata     49440
     taatatttta ttgtgagtaa ttataaatta ttccttgctc gctcttgatt ttaaggcttg     49500
     ctaaaggcag tctggatttc agggatatgg tatggtttca tgctatatca gagccgctta     49560
     agaccacaag gaggtgtaga gtagatggct agaaagtacg aaattatgta catcattcgc     49620
     ccaaacattg aagaagatga gaaaaaagct gttgtagaac gctttgacgg aatcttaact     49680
     gaaaatggtg cggagatcat cgaatcaaaa gaatggggta aacgtcgctt agcatacgaa     49740
     atcaatgact atcgtgatgg tttttaccac atcgtgaaat taaacgctga taaagcagat     49800
     tctatcaacg aatttgaccg tttagctaaa atttctgatg atatcattcg tcatatggta     49860
     attaaagaag aagcataaga atttattcaa ggctaggacc ttgatttact aaacgagagg     49920
     aggttggttt tgcatgatga atcgtgtagt acttgtagga cgcttaacaa aagatcctga     49980
     attacgttac actccagctg gtgtggctgt tgcgactttt acattagctg taaatcgcac     50040
     tttcactaac caacaaggag aacgagaagc tgactttatt aattgtgttg tttggcgtaa     50100
     accggcagaa aacgttgcta atttcctgaa gaagggaagc atggcgggcg ttgatggccg     50160
     tgttcaaact cgtaattacg agggaaacga cggtaaacgt gtttatgtga ctgaaattgt     50220
     agcagagagt gttcaattcc ttgaaccgcg taattctaat ggcggtggcg gaaataacta     50280
     tcaaagtggc aataacaaca ataattacaa tagcggtgga aataacttcg gacaagcacc     50340
     tacaaataac ggtggattcg gacaggacca gcaacaatct caaaatcaaa attatcaatc     50400
     cactaataat gatccttttg caagtgatgg taagccaatc gacatttctg atgacgattt     50460
     gccattctaa attcatttta gcggtttgaa ctttaagata ggaggaactt tcaatggctg     50520
     gaggacgcag aggcggacgc cgtcggaaaa aagtatgtta ctttacttcc aatggtatta     50580
     cgcatatcga ctataaagat gtagaacttc ttaaaaaatt cgtttccgaa cgtggtaaaa     50640
     ttttacctcg tcgtgtaact ggaacaagcg ctaaatatca acgtaaactt actgttgcta     50700
     tcaaacgctc acgccaaatg gcattactac catttgttgc tgaagaaaaa taaattaatt     50760
     ttaacagtct agaattcatt tctagactgt tttttcataa aattagacct tagatcatgt     50820
     aaacctagga cctaagaagg aagttaatgc tatttattca tgttattctt atatagaagt     50880
     aaaaaaatgc acagggggaa acaatcatgt ataaaaaatt agcaacagta gggatgacgg     50940
     tattattagt aggagcttta tcagcatgta gttttaatga tgataaggat acatcatcaa     51000
     ataatagcaa caatgaaact actagtagca aaagcagtaa taatgaaagt tcatcagata     51060
     gcttgcaaaa taaaagctta gatatgagct atgaagacgc gattaacgca ttcaaagaca     51120
     aacatagtga tgcagaaata tctagcgttg aattagagaa aagcttggga aaatatgtct     51180
     acaaagttga tgggatttca aatgataatg aatacgaaat gaaattcaat gctgaaacaa     51240
     aagaacaact aagtgatgaa acagatcgac ttgaccgaga agatgcaggt ggagttgaaa     51300
     aagaaaacga aaaacttagc ttagatggaa ttaaatcacc aaaagaagcc atggataagg     51360
     ctgtttctga acaagctggt gacgtaacaa gttggaaaat agaaagagaa ttagatacaa     51420
     cttattatga agtgacagta aaacaagata ataacaaata cgaaatcaaa ctaaatgcaa     51480
     aaactttaga aattcttcaa acagaacaag acgattaata aaatggaaaa gccaactgtg     51540
     aacattcttt tgcagttggt tttttttatg aataaactca cttaaataaa atattaatat     51600
     gggtttttaa gcctattata cagtcctttt tacacgttcg aatattctga aatgtatcca     51660
     aaaaatcggc aattctgctc ttttttggtc gttcatgaca agaatcggac atttcattac     51720
     atttttggtt attatgggta aattcgttgt aaaatattag tggaggtgaa ttagttgagt     51780
     aattttactg caaaagtccc tttgtcagaa agaatggcgg atgtgttgat ttcgaaagac     51840
     cgctggaaag atgatgaaga aggttattta aaagtaaaat atggactgga aataattcta     51900
     attaatgtca tgaagtttgc tctcgtatac ggtatcgcct tagtaacagg gcttttactg     51960
     caaacagtga cagtgcatct gtcatattta tggctcagac ggtattcttt tggattacat     52020
     gcaaccaaaa cattgaattg cacgttaatt agcttattga tgtttgtgct tgcgccattt     52080
     gtttttcaaa atatcccctc taataattgg attgttttag gtacatttgg atttatactg     52140
     ctcaacatgt ttttattcgc tccggcagac acagaaagtt tgcctttaat cggtgaagaa     52200
     caccggaaaa cactaaaaag aaaagcgatg atagggacgc taattttaac gggaattgcg     52260
     ttgctaatac cattcgcaga gatgaaaaca ttaatcatgg taggatcttt gtttcaggtg     52320
     ataagtatta atccacttac ttacaaacta ttgaaaagga ggtatcggaa ctatgaaaaa     52380
     tatgaataaa tcagttggta aattcctttc tagaaaacta gaagaacaat ccatgaaagt     52440
     tgcggattct tctatgagta aagcttgctt catgtttgta tacgaaccaa aaagtccatt     52500
     tgtgaaaatg caagaaaaaa acgaaaataa ataaatttaa aactgtataa catcaaaatt     52560
     catgctaaaa taaaaagaag gcaaacttac atatttaaac atagatattt tagacagtgg     52620
     aggattaata tgtttagtat tttgatggca attatacaga taacgggtat ttttattgca     52680
     atccagattt taacaaacaa agttttttca attaaagagg gattggttac tatagcaatt     52740
     gctatgctag ccttcccttt atttacttta gttcaatact ggtcgatgat ttttgtattg     52800
     attgtttttg taagtgcctt atattggaaa aataaaaatg tagtagtttc agcttctatt     52860
     acgcttgtgg ttattatttt acttactatt agtgactcta tagtaggttt tattttagta     52920
     ccgggcttga actttaaata tgatgagata tttaatgaac tgttaccaac gttaatttac     52980
     tgcgcgggaa tgttggcgaa tttgttggta ttttcgtttc ttcttagaaa attgattgaa     53040
     aaagttaata tttctagatt tgttgaacat agaaaatatg cgtatattat tttttctatc     53100
     gttgctctta ctgtcttagc gttctatatg aacatatacg cggggtcaat cgcaggtttt     53160
     gatggatcag ttttgaaaat taatacgctt atttttacag gatataccat tttgttaata     53220
     gttatagtga cggttgttat taatacggca accaacgaac ttaaagtaca gaatcagaag     53280
     gaacagctag aacagttaca ggattatgtt actacattag agtccctgca tagagaaatg     53340
     cgcgtttttc gtcatgatta tgtgaatatc ctgtcaacac ttgttggata tattgataat     53400
     aatgatatgc cgggtttgaa gtattacttt gaaaataata ttgtacctat aaataaaaca     53460
     attgaatcga acaactataa gatttcattg cttcaaaata ttcatgttat tgaactaaag     53520
     ggcttgctag ctgttaaatt aatacgagct caagagttga aaattgatgc aattttggaa     53580
     gtagttgaac cgattgacaa gatttcgatg gatagtatag atttatgcaa agttgtcggt     53640
     attttgctag ataatgcggt tgaagcggcg ttaacttgtg aaaatccagt tattcgaatc     53700
     gcgtttgtga aaaaaggtga tagcataatt attgtatttg cgaatagttt accagtaaat     53760
     atgccaccga tttataagat atttgaagaa ggtttctcta caaaaggaga aggtcgtgga     53820
     ttaggccttg ctagtttgcg ggaaattatg aagaaatatt cgcacgttgc cttagatacg     53880
     aaagtgaccg atagagaagt tattcaagaa ttagaaatta tgtagaagaa tggggatgaa     53940
     tttatgctac cggtttttat ttgtgaagat aacagaatgc agcgagaaag gttaacgaaa     54000
     tatattgaag actatattat ggttgaacat tttgatatga agttagaact ttcaacagga     54060
     gatccgtttg agttagtatc acgaatgcct acacatcaag gtatggggct ttatttttta     54120
     gacattgatt tggggcagcc ggacatgaat ggttttgaat tagctcagga aattcggaag     54180
     tttgatccgc gtggtttcat tatttttatt acaacacatg cggagttaag ttatatgact     54240
     ttcacgtata aggtggaagc gcttgattac attattaaag acgatattga tttgctgcat     54300
     gaccgggtac ttgcctgtat gaagcaagca gaagaacgga tttccaatga tcaagatatg     54360
     cagaagtatt ttacgtttaa agtgtcggat aagaagatta ttcatgaact gttagacgat     54420
     atcttgtttt ttgagacagc gccaactatt cataaagtaa ttttacatgg caaaaatcgc     54480
     caagtggaat tttatggtaa gttgaagaat atcgagaaaa tgttggacga atcattttat     54540
     cggtgccaca ggtcgtatat tgtgaataag aaaaatattc atgagctaga tacgacaaaa     54600
     ggtgtggtga agatgtctaa cggtgaaaat tgttatgcat catcgaaatt aattaaaagc     54660
     ttgagtttat aaaagtggcc ttaaaggtcg ctttttttgt acaatggcaa gtttggattt     54720
     gatgaaatgg gtaaatatag gtaaaataat agtgatgaat tgttagttaa gtttatgtta     54780
     tgatatagat actcaaattc aggcaaaagg tatgtaaaaa aatggggagc tggatgaaat     54840
     gtcaggctat tttcaaaaac gaatgcttaa atatccatta tacggtctga ttgcagcgac     54900
     aattattttg agcgtaatca cgttcttttt ttcgtggtgg ttatcggcgt tagttgttgt     54960
     tggcggaatt attcttacgg ttgcgatgtt ttattttgaa tatcgcttga atgaagatgt     55020
     gcaactatat gtttctaatt taacgtatcg gattaagcgt agtgaagaag aagcgcttgt     55080
     tgaaatgccg atgggaatac tgctgtatga tgaacattac aaaatcgaat gggttaaccc     55140
     gtttatgtca aaatactttg ataaggcaga gttaatcggg gaatctttgg aagaagtagg     55200
     accggaattt ttggacgtta ttactgggaa tgatgaaaag gggattatgt cgattgcttg     55260
     gcgtgatcac cgttttgata cgatagtaaa gcgtaaggaa cgaattttat atttatatga     55320
     tcgcacagaa tattatgatt taaacaagaa atttcaagcg aataaatctg tatttgcggt     55380
     tattttctta gataattatg atgaatgggc gcagggcatg gatgatagac gtcgcagtgc     55440
     tttaaataat ttggtgacgt cgatgttgac caactgggcc agggaacatc gtatttattt     55500
     gaaacggatt tcgacagacc gatttatggc ctttttgacg gaggaaatgt tgaagcggtt     55560
     ggaggaagag aagtttcaaa tattggaccg gattcgcgaa cggacgtcga agcaaaatat     55620
     tccattaacg cttagtattg ggattggtta taaggaagat gatctgattc agttggcgga     55680
     tttggcgcag tcgagtttgg accttgcttt agggcgcggc ggagatcagg tcgtaattaa     55740
     gcaacctgaa ggaaaagtgc gtttttacgg cggcaaaaca aacccgatgg aaaaacggac     55800
     tcgggttcgc gcgcgtgtga tctcgcaagc cttgcaagag ttgattacgc aaagtgacca     55860
     agtttttgtt atggggcacc gctatccgga tatggacgta attggttcga gtcttggagt     55920
     gatgcggatt gctgagatga atgatcggaa tgcttatgtg gttgtggaac ctggcaaaat     55980
     gagtccagat gtgaagcgac taatgaatga aattgaagaa tatccgaatg taattaaaaa     56040
     tattgttaca ccgcaagtcg cactggaaaa tatcacggag aagagtttgc tcgttgttgt     56100
     tgatacacac aaaccttcga tggttattaa taaggaattg ctggactcag ctacgaatgt     56160
     ggttgttgtc gatcatcacc gtcgttcaga ggaatttgtt gggagtccgg ttcttgttta     56220
     tatcgagcca tatgcgtcat ctactgccga attgattacg gagctatttg agtatcaacc     56280
     ggatttagag caggttggga aaatcgaggc aacggcgctt ctttccggga ttgtggttga     56340
     tacgaagaac tttacgctgc ggactgggtc gcgaacgttt gatgcggcaa gttatttacg     56400
     gtcgcttggt gcggacacga ttttggtgca gcaatttttg aaagaagata ttactacttt     56460
     tacacagcgg agtcgtttag tggagtcgct tgaaatttat catgatggta tggcgattgc     56520
     gactggacat gaggacgagg aatttggcac agttatagct gcgcaggcgg cagatacgat     56580
     gctttcgatg gaaggcgtgc aggcatcctt tgttattacg ctacgtccgg ataaattaat     56640
     cgggattagc gcgagatcgc ttggccaaat caatgtgcaa gtcattatgg aaaaactagg     56700
     cggtggcgga catttatcga atgcagccac acagcttaaa gatgttacaa ttgcagaagc     56760
     agaaaaacaa ttaattagcg ccattgatgc gtattggaag ggagaaacat aattatgaaa     56820
     gttattttct tgaaagacgt aaaaggtaaa ggtaaaaaag gtgaaactaa aaatgttgct     56880
     gatggttatg caaacaattt tttaattaaa aatggttacg cagttgaggc taacaatgcg     56940
     gctttaagca ctctttcagc gcaaaagaaa aaagaagata aattagctgc tgaagaacta     57000
     gctgaagcaa aagctttgaa agaaaaaatg gaaaatttaa cagtggaatt aaaagcgaag     57060
     tctggtgaag gcggcagatt gtttggttct attacatcta aacaaattgc tcaaacgctt     57120
     gaaaaaacac atggtattaa aatagacaaa cgtaaaatgg acttaccaga agcgattcga     57180
     gctttaggac atacgaaggt gccggtgaag ttgcaccatg aagtaacggc aacacttgat     57240
     gtacatgtta gtgaagaata atttttctta agggagcgta agacagtgga taataatttc     57300
     caggacagaa caccaccaca aaatattgaa gccgaacaag ctgtactggg cgcgatattt     57360
     cttgagccga atgcgctgat taccgcttct gaaattttaa tgccggatga tttttatcgt     57420
     actggtcacc aaatcatttt tgaaacgatg cttgatttga atgaccacgg gaaagctgtc     57480
     gatgtattaa cggtttatga ggcgcttgct gccaaaggta atttggaaga tgcgggtggt     57540
     ttgccatatt tgacggaatt atccggggct gtgccaactg ctgctaactt agaatactat     57600
     gcgcatatta tcgaggataa ggcgcttctg agacgtttaa ttagaacggc tacccaaatt     57660
     gcgacagatg gttattcgcg cgaggacgag ctcgacatgc ttatggacga ggcggaaaag     57720
     agtatcttgg aagtttcgca acgcaaaaat gttggggcgt tcaagaatat taaagatgtc     57780
     cttgttaaaa cttatgacga tattgaaatt ttgcataatc gcaaaggtga tattactggg     57840
     attccaactg gatttaacga acttgataaa atgacagctg gatttcagcg gaatgattta     57900
     attattgttg ctgcgcgtcc ttctgttggt aaaacagcct tcgctttaaa tattgcgcaa     57960
     aatgttgcga cgaaaactga cgagaatgtg gccattttta gtttggaaat gggtgcggaa     58020
     cagcttgtta tgcgtatgct ttgtgcagaa ggtaatatta atgcgcagaa tttacggacg     58080
     ggtgctttaa cgagcgatga ttggcaaaag ctgacaatcg cgatgggtac actttctaat     58140
     tctgggattt atattgatga tacgccgggt gttcgtgtga atgagattcg ttccaaatgt     58200
     cgtcgtttaa aacaagaaac tggtcttggc atgatcgtga tcgattactt gcaacttatt     58260
     gcggggagcg gtcgtggtgg cgaaaataga caacaagagg tttctgaaat ttctcggtcg     58320
     ttaaaagctt tggcgcggga acttgaagta ccggttattg ccctttcaca gttatctcgt     58380
     agtgtggagc aacgccaaga taaacgccca atgatgtcag atattcgtga atcgggttcg     58440
     attgagcaag atgcggatat cgtcgccttt ttataccggg aagattacta tgaccgagaa     58500
     ggtgagaatg acggcacgat tgagattatt attgcgaaac aacgtaatgg tccagttggt     58560
     gacgtgaaac tagcctttgt aaaagaatac aataagtttg tgaatttaga agtgcgttac     58620
     gacgacgcaa tggcttaata aggaaacctt gtgaatttct aattgaattt ggagtttgca     58680
     aggtttttat tttatgcaaa aaggtaacgc attactatta atagactttg aaattccctt     58740
     aaaaggatta aaaaagcgaa cgataaaatt accttacaaa tcaatgttcg taaatccatt     58800
     gactattttg gtggcaaacg gtacaatgta tagtggaaaa tgaagaggct atgaaaaacg     58860
     catagctatc aaagaccaat taaatgaggt gtttaaatgt cttcagttgt tgtagtagga     58920
     acacagtggg gcgatgaagg aaaagggaag attacggatt ttctttccga gaatgcagaa     58980
     gcgattgcta gatatcaagg tgggaacaat gcaggtcata caattaagtt tgatggcgta     59040
     acgtacaaat tacacttaat tccatcaggt atcttttaca aagaaaaaat tagtgttatt     59100
     ggtaacggta tggttgttga tccaaaggct ttagtggagg aattaaaata tcttcatgat     59160
     aaaggtgtgg atacttctaa tttgcgtatt tctaaccgtg cgcacattat tttaccatat     59220
     cacattcgta ttgatgaagc tgacgaagaa cgtaagggcg caaacaaaat cggtacaacg     59280
     aaaaaaggta tcggcccagc ttacatggat aaagcagcgc gtgtaggcat tcgtattatt     59340
     gatttattag ataaagaaac atttaaagag aaattagagc ataatcttgg cgagaaaaac     59400
     cgtttattag aacgttttta cgaacttgaa ggctttaaac tagaagatat tttagacgag     59460
     tactatgaat atggtcaaca atttaaagaa tatgtttgcg atacatcggt tgttttaaat     59520
     gacgctttag atgatggtaa acgtgtgtta tttgaaggtg cgcaaggggt tatgcttgat     59580
     attgatcaag gaacatatcc atttgtaact tcaagtaacc cgattgctgg tggcgtaact     59640
     atcggtagtg gtgttggtcc ttcaaaaatc aatcatgttg ttggtgtggc gaaagcttat     59700
     acaacacgtg ttggtgatgg tcctttccca acagaattat ttgattctat tggtgacact     59760
     attcgtgaag tcggtcatga atatggtaca acgactggtc gtccgcgtcg tgtaggttgg     59820
     tttgatagcg tagtggttcg tcatgcgcgt cgtgttagtg gattaacaga tttatcgtta     59880
     acactacttg atgttttgac aggaattgag acacttaaaa tctgtgtagc ttacaaatta     59940
     gacggaaaaa caattacaga gttcccagca agtttgaaag atttagctcg ttgcgaacct     60000
     gtttatgaag aacttccagg ctggacggaa gatattactg gagttacatc actagatgat     60060
     cttccagtga actgccgcca ttacatggag cgtatcgccc aacttacggg tgtgcaagtt     60120
     tctatgttct ctgtaggccc tgaccgcgct caaacacatg ttattaaaag cgtttggcgt     60180
     ttagcttaat aaaataatta tcaagcccat ctaaggtgta ttcttggatg ggcttttttt     60240
     atatggcatt ctcgctatat aaaaataaaa gtgattttgg aatggtatac aattttttgt     60300
     ttcaaaagtt gaaaaagtta acaaaagaaa atgaagtttg tgaaaaacac atctttttat     60360
     atagaaatgt tgttatggaa agaccaatta tcaaggcttt gtagatattt tattcgtatt     60420
     tttgtcacat ttcgatttgt gaattcgtgt tataatttat gagtgatatc ttattcacaa     60480
     tagataataa gaggagatga agtgaatgtc aggtcaaatt cgtatgagtc caagcgaact     60540
     acgtgatcgc gcgaaaactt acggtcaaag tggtcgagat attgaggata ttctaagtcg     60600
     tttaagtcaa ctacaagaac aactacgtag cgaatgggaa ggtcaagctt ttatgcgttt     60660
     tgatgatcaa tttgaacaat taaaaccaaa agtaactgaa ttcgcaaact taatggatca     60720
     aattaacgat caacttgaga agacagcaaa cgcagtagaa gagcacgatc aacaactttc     60780
     tcaaaacttc ggattctaaa atcaacaaaa agtggggcat acatacaaat atcgttggat     60840
     gctttacgaa aagccatgca gttttttgca tggctttttc taaacataga aagcttatgc     60900
     ctaaaaaggt atttatataa aaaagacaca gcgggagtgg gacatgaatg aagaaagtaa     60960
     aatggagtat tttactcttt ttagtcttgg cgatttttct ttcggcagga attacttatt     61020
     tggctttgaa tcaaagttcg aataaagagt ctaaaaataa tagtgaaaaa acacacaaga     61080
     tgaccatcgc actcgttaat gaggaccaag gagacaactt ccaaggaaaa caagtagagt     61140
     ttggtaatca atttgttaaa agtattgaaa aagatgatac gcatgaatgg tacgttgtta     61200
     gccgcggagt tgcagaaagt ggcttaaaac gagatgtata caatatgatg atcgttatcc     61260
     cgagtgactt ttctgaaaaa gcaatgtcaa tgacttcgag cgccccagaa aaagtgacaa     61320
     ttagctacaa agttaacgat gtaggaaata gcgatctaaa agcggaagcc gaaaaaacag     61380
     cagcttctgt attggaagat ttcaattcac ggattattga tgtttatttt gcaagcattt     61440
     taacaacttt acaagaagcg caggataata ttggaaccct agttaaagaa gagaaaaagt     61500
     atgacgctat ctacaataaa gacgtaaata atccgttatc cagctacaca aaacagttta     61560
     aaacggtgca agactacaca ggaacttcta aagagagctt ccaaggtttc caagatatta     61620
     tgaaagaatt tgaggaaagc ctaaatctct ctcaaaaaga aaacgaagaa catatgaaaa     61680
     acatggatgc ttatacaaaa acacaagagg aaaatgctcc ttttggggca gaattcacag     61740
     aaaacttgtc aaaatttgat ggcactttat cggcagaaga tattcgaatg caaactgccg     61800
     ctttagaaca agtcaatgcg aaaatgactt cagaatttca aattttagaa aatagtaatt     61860
     cattgttatc acaaacacag gctttacaga gctatatagc tgaaaccaat gcacggattg     61920
     atgcggtgga tgccgaaatt atgggaacgc tcgaaaatga ttttcggacg gctgtttata     61980
     atgacttgtt gcgtatttta caagaaaacg agtactcgga taagttgaat gaaattggtc     62040
     ttaaagattt gaccggagaa gatattaatg ctggctttaa caaaatgatt gttaaggaaa     62100
     tacaatcatt accaacatat aatgcggacc aattagcatc gattgggctt gatgaagaga     62160
     tgtacaaaaa tgttgtaacg ctttctaagg aatattatag taaccatcgc ggtgctttta     62220
     gcgaaggttt tagctttacg actgatccta aaactctacc aactgacacg ctgaaaagcg     62280
     atacgattaa tcgattgaaa tccgaagggg tcgcgctaga aagcagttcc tatacggttg     62340
     aaggtagcga ttatccaaca gaaataattc taactttaga tgaaaatttc actttttcag     62400
     atgttgattg tttggttaat ggaagcagta atccagagtt agttcaacaa aacgcatacg     62460
     gagaaaatgg cataaagctt agcatacagg cgcttggaag tacaccggca gagattaaaa     62520
     tcaccggaaa agcgaagttg cgagaaggtg tgaatgttcc attaattggt gctgtaaatt     62580
     ggaatgctac attgcaacaa tatgagaaaa aagaatatag tgaaatgcca acaattccat     62640
     cagagcttga tcctactacc ccggatactt cattaatagt tagaaaagaa cctgtaccga     62700
     ttaaggtcac tgcaccaaca tatttgaatg agacgaagag ttctgtaaaa gcaattacta     62760
     atacagtaaa agattactat aaactacaag cattatttga tttatattac ggaattgatg     62820
     cgagtgattc tggacaaata ccggatttta gtaattatca agtgacgcta gaaaattctg     62880
     cgaaagcatc ctcgtattat tatattttta ataaagaaga tgtgattggt agctttgtaa     62940
     atcttactac agatcggttt gtggcagatt atacgaaaaa aattaaagct tttgagaagc     63000
     gaattgatga ctacaaaaat acaatggctg aggccaattc cagatcagaa gacgtaacaa     63060
     atagattaaa cgaaacgacg caagaagcca ttaatttaaa tacaaatcta gcgttaacgt     63120
     tgcaaaacct agaatcttgg cgagaggaaa gtaaaggttt aatagaagaa aatggcgttg     63180
     ttttagaaaa atctggcgaa gaagccacga tggcactgca attaagctct gaatttgccg     63240
     ggcttttagc ggaaagtgaa tcgttagctg gtacttctga aggtaatttg aagtcagcgg     63300
     aagtcgtgta caaaactttt gatgcgatcg ataaggaagc caagaatatt caacaaagcg     63360
     gagaaacttt agtaaaagaa gcctccacac tatccgatga tttaagcgaa aaattggaag     63420
     acgacgaaac gttccagaaa aatttcgcta aggttatgga aaatagccgt gttggtgatc     63480
     gacaaaatga aaatttatat agtttcttaa gtagtccggt cgataagatg aatgccggga     63540
     ctattgttgc gggtgacaaa tcaatgccat acttcatgat tttgatttgt acgattctgg     63600
     caattttcac tagctacgtt atttcacacc aagagaaaaa acgtgaacaa ttaaatgaat     63660
     ttgagaaaga aatgtcgctt gtctttaaaa atattccaat tactttccta gcgatctgtg     63720
     ttgggattat tgaggggctc ataataggcg ccatttcagg atttattttt gaagttggag     63780
     aaattgggat gttcctatgg ataggtgtct gcgttctaat tatgatgacg ttagttactg     63840
     ctttttcata tttattacgt cagttcaaca tgattgggat gtcgattatt ttactcgttt     63900
     taagtttgta tctattctta acggatgcag ttggacttaa cattgataat gaatctattt     63960
     tcgcgacgtt cagaacgttc tcgccacttc aatacatgga atacttattg aatgggattt     64020
     tgagtgcaca gaaggattat attattgtcg tatacagctt gattggcgcg acagtagtat     64080
     ttactggtct caacctattt gtctggcacc gttctaaaga aaaagtagag gaggacgatt     64140
     cagatgaaat ataaaatagt agcactactt atgttacttt gttttgcttt tgctccggga     64200
     gttctcgctg cggattcaga tagctattta gaaaacaatg ggaaaatgga catcaaaaca     64260
     gatagacttc aaaaaacaga agaagaaaaa acaaaagaac tagaacagat ggaggaaaca     64320
     gagctcgata agaacggaat tccacttttt actgacgaaa tggatgaaaa aattgccaaa     64380
     gaaaaagcgg cagagaaagc ggaatatgac cggattaaag actcactttt tgaagaagaa     64440
     tctacatctg gcgaaacagt aaaaaaaacg aaagagaagt tgtttacagg cgagtacgag     64500
     acaacagctg taaacacgga aacacctact actacggaaa caacagtaga agacgaaacg     64560
     aaaaaaacaa aacaaaaaac agttggtgga gcaattgcag ggacacttgt agctttagca     64620
     ggcgggattt atgtggctgc gcgcaatgtt tttgaataga aagcggggag ttttaattgg     64680
     ctaaaaacac acatatgaat gtgacagttg atttcactaa ttggggagca agtaagtatg     64740
     atttgcgaat tccggtgcat caaccaatca aagcattaat tatcaatttg gcagaaacgc     64800
     tcaaaatcga ttacaaagat ttgtccaaat gtacgataaa aacaacgaat aaagcgatat     64860
     tactaagcga tgatgacaaa ttgactaatt ttcaaattgc ggacggagac attttagaaa     64920
     ttttatagaa aaaaaggaga ataaaaacga tgaataagac aatagaaatg gacggaacaa     64980
     cttacgattt tacttatgag gatctagttt ggagcattac gtttccaaaa tcaaaaacac     65040
     gcgctaaaga actcgcacaa ctagaactat tagaaaaacc tgcgacacat tttactcctg     65100
     cgaaaatttc gagtgatagc gattcatata cgatttctta tgagattgcg ccacgtactt     65160
     atggatttga acaagttcga aaaatgggac gtgaagataa actgcgcgca ctgcggaata     65220
     ttgcggattt aggcgaattg ttaaacacgc gctatacatt ctttttacac ccggataatc     65280
     tgattttcga tattaaccta gtgccaagta ttgttcatcg gggcattaaa aatatattac     65340
     cgccttatga actaacagaa gaaacttttt tcaaacaata tcaatgtttc gttattgcga     65400
     tgttttctaa gaaattctct tttgaaaact tgtacaatgg ctcgctatca ggggctagag     65460
     gaacgcaatt tgagaagagt atattagatg caaaaacggt gcaagatatt gctactattt     65520
     tagaagaagc atacatgaaa gaacatgcgg cggttcaaaa aaatatggca agcgtaccga     65580
     agaaaaaata cagtactttc cgtgggttag cggttggttt cattatcgtc gctattttac     65640
     ttgcaattcc agtaagttat tttgcattcg ttaaagtccc tttacaaaat gatttattaa     65700
     cagcaaacga gaatttcctg aagacagatt acgataaagt gattacaggt ctagaaaatg     65760
     tggatccaga aaaaatgccg cagtctgtcc aatatgaatt agcttattcc tatgttaaag     65820
     gcgaaaaaat gagcgataaa aagaaagaaa acattatgaa tacaatcagc ttaaaatctg     65880
     acgccaaaaa cttactttac tggatttaca atggtcgcgg agaatttagt aaatcacttg     65940
     atattgccaa acttttagac gacccaacgc ttgcgatgta cagtttaaca aaacaaattg     66000
     aacaggtaca aagtgataca acattaagcg gcgatgaaaa agtggaaaaa ctaaaaactt     66060
     tggaagaaag cttgaaagaa tacgatgaaa aagtaaatga gtcaactaca actgaagatg     66120
     aaacaacaaa tacagaagca aaataaggga gaatggacca tgaatagaga ggctttatta     66180
     attgttagta acgggcagca atgtcataaa aaccacttgt ctcctgaaaa agtcgtgaca     66240
     attgggaata caatcgaaca cgaaatcact tatcctgaac tggctgagtc gattgaagtt     66300
     aaatacgatg aaggctcttg gaatgctgga acaacagcgc tccaggcgaa tcaagctgta     66360
     aatgtagaga acttagcatt ctatctatgc caagatttac atacgcaagt ttatgatgtt     66420
     gtaacgaata tttctgtgac atttggcgtt ggaatagaaa atgatgtcac attagatgac     66480
     acaaaatcag attttatact tttacgtgat gcaaaggaaa aactgtttaa gttacaagtc     66540
     ttaaatggcg aagtttatca taacttttct ctagtgacgg aagactgcgt tctagaaccg     66600
     ggcgatcagc tctatacaga cggtgtgacg attacaatcg gaaaagaaga tattagtgtg     66660
     ctagctgtga aaaatcgcgt gacgagcaaa ttagcgcctt tatttgctgc ggacaattca     66720
     ttcggggaag attatccgga ttaccaccgt tcaccgcgga ttatttaccg tgcgccagaa     66780
     gaaaaaatca gcatggcgaa accgtcaagt aaaccctcta aaccaacaga tggtttaatt     66840
     aaaatcattc taccaccact aatcatggta gcaattacgg tcatgatttc gattttccaa     66900
     ccacgtggac tttatattat tatgacaatc gcaatgtcag cagtgacaat cacaatggcg     66960
     attcttaact acataaaatc acgtaaaaaa tacaaaatcg attccaaaca acgcgtggaa     67020
     agctacgatt tgtatttaaa acgaaaaacg aaagaattgc acgaaacaag cgaaaaacag     67080
     cgtcacgctt taacatatca ctatccagac gtaactgaac tagaaaaaat ggcgctacgt     67140
     gtggattcgc gtatttacga aaaaacaatg ttccatcatg atttcttgac tttccgagtt     67200
     ggtcgcggcg acgaaacaag tagcttttcc gtggaattcc aacaggaaga gttcagccaa     67260
     gaaaaagacg aacttgtaga agaagctgtg aaaattaaag ggcagtattt atcaatcaat     67320
     gaagtgccag ttgcaacaga tttaatgcac ggaccagtgg ggtatatcgg gccgcgccgt     67380
     ttagttctag aacaactgca aatgttagta atgcaaacat cccttttcca tagttattat     67440
     gatttgcaat ttattacgat tttcccagaa gaagaaaagg cggattggga ctggatgcgc     67500
     tggttaccgc atgcgaatat gcgtgatgtg aatgtgcgtg gttttgttta ccatgaacgt     67560
     tcgcgcgacc aagtattgaa ttctctttat caaattttaa aagaacgtaa acaagcgctc     67620
     actgaacaag cgagcaaaca ggaaaaatta tactttacgc cacattatgt ggttttaatt     67680
     accgacgaaa aattagtact cgatcacacg gttatggaat tcttcaatga agatccaagc     67740
     gaactaggtg tttctttagt gttcgtacag gacgtaatgg agagcttgcc agaacacgtg     67800
     aaaacggtcg tggatattcg tgatgcgaag agcgggaaca ttattttgga acaaggcgac     67860
     cttgtaaaca gagcattcgt gccggatcat ttgccagcag attttgacaa agaagtaatc     67920
     agccgggctc ttgcaccgct aaaccatctt caaaacttga agaactcgat cccagaatcc     67980
     gttactttcc ttgaaatgta cggtgtagaa cgcgtcgagg agctaaacat tgctggacgc     68040
     tgggcaaaaa atgaaacgta taagagcctt gctgtgccac ttggcttgcg cgggaaagac     68100
     gatatcgttc aactgaattt acatgaaaaa gcacacgggc cgcatggttt ggtagccgga     68160
     acaactggtt ctggtaaatc agaaatcatt cagtcttaca ttatttcact tggcgtcaat     68220
     ttccacccat atgaagtcgc gttcttgctg attgactata agggcggagg tatggcgaac     68280
     ttatttaaaa atatgccaca tttactggga acaattacaa acttggacgg cgcgcaatcc     68340
     atgcgtgcac tagcttccat caaagctgaa ttgcagaaaa ggcaacggtt atttggcgag     68400
     cacgatgtca accacatcaa ccaataccaa aaactataca aacaaggaaa agcgaccgaa     68460
     ccaatgccgc atttattcct tatttcagat gagttcgccg agttgaaatc agaacaacca     68520
     gaattcatga aagaactcgt ttcgacagca cgtatcggtc gttccctagg tatccattta     68580
     atcctagcaa cccaaaaacc aagcggcgtc gtggatgacc aaatctggtc caactccaaa     68640
     ttcaaactgg ccctaaaagt acaaaacgcc agcgattcaa acgaaatttt gaaaacacca     68700
     gacgcagcag aaatcacact accaggtcgt tcgtacttgc aagttggtaa taatgagatt     68760
     tacgaattgt tccaaagtgc ttggagtggc gcggattatg tgcctgataa ggaaagcacg     68820
     gattatattg atacgaccat ttatgcgatt aatgacttgg gtcagtatga tattttgacg     68880
     gaggatttga gtgggttaga taagaaggat gatttgacta agttgccgag tgaattggat     68940
     gcggttattg atcatattca cgaatataca gaggcttctg ggattgaggc gttgccgaga     69000
     ccttggttgc cacctctgga ggaacaaatt ttcttaccag aattgcacca agtaattact     69060
     gacgagctgt ggagcggtga gaaacaacct cttcaagcaa caattggctt tttagatata     69120
     ccacaaatgc aagcgcaaga gccattaaca attgatttgg caaaagatgg gcatttagct     69180
     gtgttttcta gtccgggtta cggtaaatcg actttcttac aaacaataac aatggactta     69240
     gcaagacagc ataaccctga aagattgcat atttatttac tagatttagg aacaaatggg     69300
     ctactgcctt tgaaaaaatt accgcatgtt gctgatacga ttatggtaga tgaggaaatt     69360
     aaaatcggaa aacttattcg tcgcttaaca ctagaattaa aagaacgtaa gcaaaaactg     69420
     agtaaatatg gtgttgcgag tatttcaatg tatgaaaaag caagtaagga agaagtccca     69480
     gcaattttac tcgttataga tgcatttgat tctgttggag aagccccgta taaagatgta     69540
     tttgaaaaac taattgctca aattgctcgt gaaggagcga gtgtagggat tcatttagtt     69600
     atgagtgcag ttagacaaaa tgctattcgc gtacaaatgt tagcaagtat aaaacatcaa     69660
     ataccgttat ttatgattga accaggtgaa tcaagaagta ttgtaggaaa aaccgattta     69720
     accattgaag aacttccggg ccgtggatta gttaaattag aagagccgac tgttttccaa     69780
     acagcactgc cagtttgcgc ggatggaaca cttgaaatta ttgaaaaaat ccaagcggaa     69840
     agtgaagcga tgtctagcga gtggaacgga tcacgacctg cgccaattcc aatggtacct     69900
     gaagtaatca atatgcttga atatctagaa aataaacaag tccaaaaatc actttcagaa     69960
     ggaaaaacgc caatagcagt agattttgaa gatgtattac cagtcaattt agatgtgcaa     70020
     acagatggca acacacttgt tttaacagat aatgcagatg ttttggaaag aaccatggtt     70080
     tcgctaactg aactaattgg tcagaatatg gaagtggata ttgctctata tgacaattcg     70140
     tctaacagat tccaacagta cagaaacaac gtaaatatat acgcaggtga ggaaactgcc     70200
     atgaatagta cttcagagca aattgttagc gtactcgaag ctcgagaaga tggttggaag     70260
     gagattcaac gggcatcgaa tggagaaatc acactcaaaa tgtatgttga agaattacga     70320
     ccaatgtatg tactactaac ggatagtatc tatgctgcgg aacagatgtc tctggaagct     70380
     aggaaaaata tggtccgact aattgaaaat ggacctaaat taggtatcta ctttgttacc     70440
     ggaagccaaa caggaattct atatagagct cgagatgaaa tttctggtga attacgaaaa     70500
     caaaaaaccg gtatcttact tggacggatt tcagatcaaa atattctcag tctcataaac     70560
     aacatctata aagaagctct gctagcgccg tatgaagcgt attacattaa acaaggtcaa     70620
     tacgaaaaaa ttaaacttat tgcaccaaat caataattga aaggagctgt taatgatggg     70680
     tctaacagat ttctggaaaa cacctactga gaaaaaacga gatgaatacg ataagctgca     70740
     tgactatcta aaagatgctc tcaaaaaaca tgatgaaaaa atggcagaag taaaaagtga     70800
     tttgagtgcg tataaaaaag ggatgcctga tatgccgagc aaaggtattc ctgcaaatcc     70860
     atttgtagaa aaaaatgaga aagtcttaga gcagcttgaa aaatatatag ataaagaaaa     70920
     agataaacgt gccagtttga aaagtgccat tgatacagct tatagaaaat atttagagta     70980
     taaagcattg gccataaaag aagaaaaagc agagcaagca aagaaagaga aggagaaaaa     71040
     agaacgagag gagaggctaa agaatgggta atgtgaaaat tgatgccgca aaagttgctg     71100
     aagctaaaaa atcggctgcc atagtggaaa aaagcttaga atcaacacat aaaaaatgca     71160
     aatcagtcat ttcttatgta gaaggcgcat cttggagtgg taaatcgcgg gacgctttcc     71220
     ttaccttcat ggaattaatt gaaaagtatc atgccgatgt gaagaaaaac tataaaaagc     71280
     aaaagaaagc attaactgcc ttagaagatt atgtagagga ttttgagaat acttcatact     71340
     ccaaggatgt gaaaagacta tgacagtgga aacgatagac gtattttcac ctgttgagtt     71400
     atacctttta ctttctccaa tcgaggcgca acacttattt ggtgttcctg acaagcttac     71460
     ttttttatta aagggagaag atgtttttgc tgaaggattt gaccggctta agagtaaagg     71520
     gattttaaat gaagcggggg agctaacgga tggcggcggc tttttgattg attccttaat     71580
     tgaatattat caaagtaaaa agtatgtgcg tatgaaccag ctgatgtttg cttttctaga     71640
     aaaaacaccc aatgaactac ttgtaatgat tgagataacc cctcaaaaag aatatcgatt     71700
     tgaacgaatg aataaaattt atgcgctaga aatgataaaa gatttctttc cgctcattcg     71760
     tagagaacct ggtgaaagag agactgagtt tctaaaagaa gaattgacta atgaagagcg     71820
     taaacgagca actgcttttg atccggagaa aaattttatt agtatggaat tctttcatgt     71880
     ggatgaggaa ccaaaagaaa aaaacaatgc taaatactac aaacagtact tggcatttga     71940
     gatggaagac aaattaatga tggtagatgt tgtaaacgat acctattacc gtggaagcca     72000
     gtatgcttta ttaaaattat tgtttgatga acttgaattt ccttatgagg aggctaaata     72060
     gatggcacaa caaacgatgg gcggtgcagg agccgcttct acaatagata ttaatccgga     72120
     tgaaatgact catattgcca aggaattact agcaattgct aatgagtttg aaggagtaat     72180
     aaagccagca gtaaatcagt taaaagcaaa taagtattta acaaaaggca aagcaaaaaa     72240
     agcaatggat aaagtaccta aagcgaatga acgtgtaatg gaacttcaag accaatacaa     72300
     tatggcgtcc tctgttgtgt ttgatatact ccaaaccatg gttgatgcag acagagatat     72360
     tgctgaaaaa attatcgcag ctttagaggt ataaggaggc cagatgaatg aaagaagtca     72420
     actaccgaga agacgactgg cgtgaagcca aaagtgccct cgctccattt gccgcagcga     72480
     attgggtagg cggtttattc aataatttag aaaaagtatc gaaaaatatg gaagaagcgg     72540
     aagaagatgt ccaagagttg gactcagacc acgcgatttc gtttcaacac accaactatc     72600
     gcgggaagta cagcgctatc gaagacgatt tgatggtatt gtataagttt agttgtcatg     72660
     caggggaaaa gatggaaacc ctggtagacc aaccgttcta tgagaagtta gacgcgtttg     72720
     tggatggcat gcaagatttg agtatttcga cgtattctac caccaaccgg attggtgcga     72780
     agtcgaaaca aacctataca actacatctg gcggttcgca agtcatcgag tccatcaaag     72840
     aaggtgcgac gatcgaagat ttgatgaatg gcgataactt ctacgcaaac caaatgcaac     72900
     tacaatacag ggactggcaa cgagcgaatc cagatcaaga tgtgagtaag aaagactttc     72960
     aaatgggaat gttacatagt cgggcatttg aatataaatc aattaaagat gaacaacaag     73020
     agaaagaatt ttgggtcaac attgtggcaa ccgtggtgat tgtgggagtc agtattttct     73080
     gcccacccgc cggccttgcc ttagccgtag gatacgggag tttagaagct ggttcggcaa     73140
     tcagtgggaa ggactgggta tctggccgtg aactaagtac agaagaacga gcgcttcgtg     73200
     gcggtttagc actgctagat atcgttccag gtgtgaaagc attgagcaca ggagcgaaag     73260
     ctgccagtgc cggctcgaaa cttgtccgcg taggcgataa tgttttagca ggtagcaaga     73320
     acgtcggcaa aggaaccatc gacaatggca ttcaagcagg aaaacaagcg atggatctcc     73380
     ggttagccaa tgcgaaaaaa gtcagcgaag ctgtccaaaa gaaactcacc aaagaccttg     73440
     acgatatcgg cacgatggcc aaaaccatcc aaaacaaaac caaagaaacc ttcacacttc     73500
     caccgagaga gcaactcgcc tttgcgagag gaggcagtat tccggaacaa agcgccaccg     73560
     gagccgccgc gatagccgcg aagaaaaagc tgaaagatat tatgcagaac atggataatt     73620
     tgaatgtgaa gggcggcggg aaagatgata taattgaaca aaataaaagc cttaagttta     73680
     cttcattaga ggaatccgag aaatggggaa ttgatggttt ttcagtatgg agaaactctt     73740
     tatcttctcg tgaaatccaa gctattaggg actatacaga catttggcat tatggaaata     73800
     tgaatggtta tttaagagga agtgtcgaaa aacttgcccc agataatgca gaaagaatta     73860
     agaatctaag cagtgctttg gaaaaagcag agttacctga taatataatt ttatatagag     73920
     gaactagttc tgaaatattg gataactttc ttgatttaaa gaatttaaat taccaaaatt     73980
     tagttgggaa aacaattgaa gaaaaaggat ttatgagtac aactaccata agtaatcaaa     74040
     cgttctcagg aaacgttaca atgaaaatca acgctcctaa aggtagcaaa ggtgcatatc     74100
     tagctcattt tagtgaaaca cctgaagaag cagaggtatt gtttaatata gggcaaaaaa     74160
     tgttaataaa agaagttacg gaacttaacg gcaagataga aattatagtt gacttattat     74220
     aacgaaggag tgaagaggat gcgaggacaa gaagaaatag ataaagaaca ataccaagtt     74280
     ctctttatta aagaaagact aattccttgt gttttaggcg cagtaattgg agattgctta     74340
     ggtgtcccag tggaatttaa agacagagaa tacttaaaac aaaatccgat tgttgaaatg     74400
     ataggatatg gaacatacaa tcaacctaag ggaacgtggt cagatgatag ttccttaacg     74460
     tttgcattaa tggaaagtct aatttctggg tatgatatta accgcattgt aaataacatg     74520
     gttagtttta tggatgatgg tttttggacg ccgtatggag aagtttttga tattggaagt     74580
     gtaacgcgag aatctttaaa tagatataaa aatggtgtat ctgtgtttga gtgcggggga     74640
     aaagacaatt ttgataatgg aaatggcgct attatgcgta ttatgccatt ggttttttat     74700
     ctgggtaaag atttttcgtt cggtaaaaaa aataaaatta ctgaggaagt aactagaatt     74760
     acccatgcac acccaagatc tatactgggc agttatgtat atattgaatt gcttcaaaat     74820
     ttgtttgcta acatggataa gaagttggca tatgaagaaa tgcaaaatta tatcaggaaa     74880
     aattatagtg attatccttt taaagacgaa ttacaatact ataacaatat tttagaaggg     74940
     aatttatatg aattgaaaga atccaatatt aaatctagtg gatatgtagt ggatacttta     75000
     gaagcatcta tttgggcatt tttaaccacg aattcatata aggaagctgt tttaaaagca     75060
     gtgaacctag gcggagatac agatacaata gcttttatta cagggagcct agcaggtatc     75120
     tactataaaa tggaacaaat tcctgttaat tggattgacc aaatcgctaa aaaagaagat     75180
     atcttaaact tatgcaatcg ttttattgaa tccttgataa agcaatgatt gatcaccgta     75240
     ttcttttgtt tttgatgtaa atttggttgt ggcttgagcg ggctgaatta actagggaaa     75300
     ccattgaata aaaaacaaat cttttgaagg acgtaaaata aatgatagat gagttaaaaa     75360
     aatataaaaa gataattgaa gacgcagtgg atttgttagg atatactcca ttaagatatg     75420
     ccatttttga aggggaaaag aataatagga ttgagtatca agtaaggatt gaatatatag     75480
     aaaaccacta tgaagtctat acaacgggag agcgcgcttc catttctggg aaaaaacaat     75540
     ttgaaaactt ttttgaagcg tatcataatt ttttgtttaa attacaactt agtattttgc     75600
     agaatcgacg aagagtgaga gatggcgaac caccagaata tttttgtgca ttatgggaga     75660
     aatgaaatca aggaacaaat agcatagcaa ttgctacacc aacaagtgat attggcaata     75720
     actatgggac taacaacttt aaaggtagta ttttagcgta taaccagtga aatattagta     75780
     aaacaaagag aataaaagag gtgaaattag ctagatttaa ttggtatagc aatgacagtt     75840
     acatctaata taaatagtga attagcagat ggttttcaag gatatacaga tgtaaggaag     75900
     attacagtga attcaacagt tgatgtgggt gtttcaggaa gtttaacagc agtacttgga     75960
     caagtaggta gttcttttgg gcttccaggt gcaataggtg gactaggagt tggactagtg     76020
     ttggatacga ttctgagctt aaacggtaca aaagatactt ggaaaaatag tattaacgaa     76080
     aaaatgcaag atttggaaga ttggtttagg gtggaagcga aatagagcaa gcggattagt     76140
     tctgtgaagt attgaggatt ttctgtttta aaaaccaaaa aaacttgata aaaataatac     76200
     ttttcactaa aaaagttaga ctataatagc aaaaaataaa aaaatttaag gagagtataa     76260
     tgtgaaaaag aatttagaac agatatatgc tatagaattt acaatgggtt taagatatag     76320
     gccaatgcaa attaggcata atataaagtt gattttctta ttgcttttat ttgtgacttg     76380
     gctacaaggt gactttatga ataggcttcc gggaaatcta gatataacta aagtagatat     76440
     gcctttagtc ctactggctt tgctttgtta tattattttg tatccccaaa aaatgactat     76500
     aagatttcaa aaccttcaat acctattata tatttgttgt tttcagtttt tagtatttat     76560
     ggttataaga tacttttatt ctaacttgat ttatggtatt caaaacatgg ttagtttaac     76620
     agcccagact ctggttgcct catatgtatt tttattagta ttatggatct tagctttaat     76680
     ttttttctat tttcatttta gaaaaaaatt aagaaatgga gactatagaa aagattctga     76740
     acttcaaaaa aaacgtagta acttaggatt gaagttaagt aaaggatctt acatattaat     76800
     aggagcattt tttgttttta tattgtcctc acaaattgtt ggaggaataa tggtagatat     76860
     aatgattatt tctatagaaa ttgtaggtat cgcattgtgt tctatgggaa ttgtcatatt     76920
     tccagaacaa ctttttactg catattgtaa atttaaattt aaggagtttc atatagaaga     76980
     atagaaatat catcaaaata gttaatgtat gaaggaatga tataaatatg tgcagattgt     77040
     agtattagta aaatcggcct atggcaaatt tgtagttagt aactttgaac agtgttttta     77100
     tttaagattt tcagtaatta aatttatatt tattatgaaa taaaaatttt ggcagaagta     77160
     gataaatcga ctattggcga ggtagaagga gtcacgtttc aatcatactt tttaatcaaa     77220
     aatatgttgc atactagagt tgttggtgat ttggagaagc ggctgccggt tactcttgag     77280
     aaaatggtag aatatgtgga aagtaatagg aaagaaatta ttacgcctat tttcatagta     77340
     ttgaattatg tgggaaatgt gccttatgtg gatgtgtatg ttggaattga tccttatgat     77400
     gagtgaggat atttaattga attcccaaaa atgataatca aaaattgagg gttttcagcg     77460
     ggatgataat aggcatgaca aatataaatg attgctgaaa tcatgaacga tatgaacggt     77520
     aaactagcgt ccatggtttt ttagcaacac aaattattat agaaatatgg gactggtaaa     77580
     aagaacgagt ataaagataa aaactcggtt gacgattgga gatataaggc ttttcataaa     77640
     aaatatagaa aaagagatgg agtttaatcc aaaaattaat cgaaacggat taaaatcgct     77700
     ccaccagact ttgaactctg attgtgtaga gatataaagt aaattgggca gtctaagatg     77760
     aaatatttat acatatataa ttataagttc aaatgtgaat aagtagagta gtagattttc     77820
     tcaagtaatg aagggaagcc gcagcatgaa caacttataa cagtgaagtt accgccagaa     77880
     gcagattatt taaatgatga aaccttagaa gtgtatgaga acgataaaaa gaagtatgac     77940
     cagacaaatc aactaattac taacaattca gttacaattc tattaggtga tttttgctat     78000
     tatgagtcgg catggagcag taggtggagg gataataggt tttggattgg gagtaaagta     78060
     agttaattat aaaaaaagga ggaattgtta tgaaaataga tttagaacaa atatacatat     78120
     tagatttcac aatgggctta agatttcatc cactaattat cagaaaaaat ttaccgcttc     78180
     tttatgtagc gtttattttt ctgatttgga tacaaggagt cgttatggct ggattgcctg     78240
     gagattttga cacaacggaa ttagatgttt tattagcagc aattccagcc ctgcctttac     78300
     ttatattata tcctaaaaaa atggcaatga aattccaaaa tgttcaatat ttattgtatg     78360
     tatgtttcaa ttgatgatat ttatgataat aagggtattt tattttgcta tattttacct     78420
     tcttgaaaat gaaatcttag taactgctca atttattacc aatgcttata ttacattatg     78480
     cattatatgg gtaatttcgt ttgctatttt ttcttttcgt tttaagaaaa aattagataa     78540
     aggcggttat agaaaagatt cgaaattgca acagaaacgg agtaatttag gtttaaattt     78600
     aagtaaagga acctattttc taattttagg atcttttggt ttgtttattc taataagaat     78660
     gttaattggt ggagaacttg aagaaattat aataagtcta tttcttattg tatgtattct     78720
     tattggtata gctggagtat ccttattccc agaacacctt ttcactgcat actgcaagtt     78780
     taattttaag gaatttcata tcgaagaata gggagcttaa tgtaaatagc tattttgtga     78840
     agttcctaat ggttttctat ccaaggattg cagtaattaa gaactacttt gaatatggca     78900
     ataacaagca gaaaaaaaag gcaacactta cataaaaatt agactcaatc caaaaaataa     78960
     aaaaacatcc atgttaattt tcctggcacc cctccccccc cacacctgct atactaactc     79020
     catcctaaca aatggagttg aaaccaatga caaaaaactt taaaaaacta aaatccctac     79080
     acgaactacc caccccacta atcctctaca actgctggga cgtcgcttcc gccagagcaa     79140
     tccaacaagg cggagcacca gtaatagcga caagcagtta tgcaatcgca gagtcactcg     79200
     gcgctgtgga tggggagcat ttaacttttg atgaaatgtt ttcagttatt tcgcgcattg     79260
     ccgagaatgt gagtttgccg ctaacggtgg atatagagac tgggtatgcc agaaatttgg     79320
     aggaactggc tcagaatgtg gagcggttgc tggcgatcgg tgtttgtggt gtgaacttgg     79380
     aagatcagct tattggcgtt acaaatccgg ggttatgcag tactgaggag caatgtgata     79440
     aaatcaagac aatcaaagaa acggcggcga aaatgagcac ggaaattttt atcaatgcgc     79500
     gtacagatgt ctttttccaa gggcgggatg aggcggtgga cttggtggaa gaagcgatta     79560
     gccgagcgaa tgcctataaa gaagccggcg cggatgctat tttcattcca gggctgttat     79620
     cgccgaattt aattcgcgca tttgttgaga aatcaccact tccggtcaat gtcatgagga     79680
     tggatgggat gctctcaaac gaggacttac aaaaaatcgg tgtgaaaaga atcagttatg     79740
     gaccgtttag tttttttcag gctaatttag cgattcagca ggaagttgag cggattttcg     79800
     aaggagggaa agccttgtga taacgaatca gcgggatatt gataaatatt acgacatgtt     79860
     agtggagaaa aattcgaatt atgaaggcgt attttttgtt ggagtgaaaa cgacgggaat     79920
     actttgtcgc ccaacgtgtc cagcgaagaa acccttaaaa gaaaattgtg agtttttcag     79980
     tacagccaag gaggcgctac ttgcatctta ccggccttgc aagcgttgtg aaccgctctc     80040
     caatccgacg aaattgtcgc cagctgtgaa gttacttgtt gatgcaattg agaaaaatcc     80100
     ggagaaaaaa tggacggata aagattttga tgatttatcc attagcgcaa atacagcgcg     80160
     gcgccagttt aagaagcaat ttggaatgac ttttattgag tatgcacggt cgcggcgtct     80220
     cggtcttgct tttaagcata ttcggggtgg aaattcaatc attaatgcgc aacttgatag     80280
     tggttatgag tctggaaatg ggttccgaga tgctttttca aaaacgatgg gggaggttcc     80340
     tcataaatca aaagatatca ccattttata ctccgcttgg cttgaaacta aacttggatc     80400
     aatgctcgca atttctgatg atgatagtct attgcttctg gaatttgttg atcgaaaagg     80460
     actggaaaca gagattaaaa aattacgaat gcgcttaaac gcggctatta cacctgaaaa     80520
     aacaataata attcaacaaa tagaagccga attagcgcaa tattttaatg gagagttgat     80580
     tgattttaaa acaccgattc gctatatcgg gtcagatttt caggaaaatg tctgggaaga     80640
     gctacgacga attccgattg gggaaacaat ttcgtacaaa ggtctagcag aaaaattagg     80700
     gcgatcaaca gcgagtcgcg ccgtggcaag agcaaatggg gccaaccaat tatccctcat     80760
     cgtcccgtgc catcgtgtaa tcaatactaa cggagcatta ggaggttacg gcggcggtct     80820
     tgctcgaaaa gaatggttaa ttaaacatga aaagatggtt ccaaagtaac gcggaaccat     80880
     ctttttttca tttatttaac ccgtatccca aacaacggca tcaaggcagg agcatgagaa     80940
     aaatcaatgc tcatgccctt caaatcttgc ggcattgcag tgatagactc aaaaatgcaa     81000
     gagctaagat caatcccatt tagcgcgcaa tttaaaaact gcgctttatt caaatcaagt     81060
     cgttccaaat acgtatcgac aagttgagct ccactgaaat cactgttcgt atacgcgccc     81120
     gcctcaaacg ccacccattt caagttagca taacgaaagg caacataatc cgcataacaa     81180
     tcaacaaaaa cgcaatttct aagcgtagca tcactgaaat tcataccaat taatttacaa     81240
     ttttcaaaac gaactcggtg aataattgcg cccattaaat ctaaattcga caaatcacaa     81300
     tttttaaata caacatcagt caaattcgcg cttacaagag aaacagaatc gaacacacac     81360
     ccatcaaaaa taatcgtttc taaatgaaaa tgctcgaaaa tttccccggt tagcgtcgtt     81420
     tttctaaaga tttgctcact aacttctcca atatcttcaa taaaatatgt atcattcgga     81480
     taaaccgtca aatccccatc aggaatccgc ggcgcagtaa tttttttcat tatatcgacc     81540
     tcacttccgc tttcattata ccgtattttg ctaggaaaag gagcggaaaa tcgtttacct     81600
     ttcataaaaa acggattaca atgaatgtag aataaaaatg gcagttgagg agtgaacgtg     81660
     atgacagcga gcgtatttgt agcaggaaaa ttactaccag aaacgatgga agctcttagc     81720
     aaatgggacg ttaaagcttt ttcgggtgag gaaaatatta cagaagcaga gttaataaac     81780
     aatgtaacgg aagtggatgc gattatttgc ccgctttctt ccccaatttc ggcaaaagta     81840
     ttggaatcgg caaaaaatct taaaatcgtg gcgaatattg gtgccggttt tgacaatatc     81900
     gatgtaaaaa aagcgcaaga attgggcatt gcagtgacca atacgccaga tgtgtcaacg     81960
     gaagcaacgg cggaactaac gcttggatta attttagacg tagcgcggag aatttcagaa     82020
     ggcgaccgat tatgccgcga aacccccgag caattcaaag gctgggcacc aacgttcttt     82080
     ttaggtactg aattaagtgg caaaacgctt ggaattattg gattaggaag aatcggtcaa     82140
     gctgtcgcaa aacgtgcggc tgcttttgga atgaacatta tttattctgg acaccagccg     82200
     aaagaagcag cgaaagagtg gaatgcagag tttgtgagcc agaaagaatt attgaagcgc     82260
     agcgatgttg taacaatcca tgcagcatac agtcccagct tgaaacatct gctgaacgaa     82320
     acaacactga aaacgatgaa atcaagtgct tttttgatca atgctgctcg cggtcctgtt     82380
     gtggaggaag ctgcactgat taaggcatta gaaacaggcg ttatcgccgg cgctgcgctg     82440
     gatgtgtttg agttcgagcc taagattggc gaggattttg ctaaactgga taatgtcgtt     82500
     ttaacacccc atatcggaaa cgcaaccgtg gaaacacgcg cagcaatggg caaaatcgct     82560
     attgcaaatg tcgaggctgt attagcagga aaagcaccac tacattctgt ttattaatac     82620
     cgaaaaatat agccgcagcg agtggctgtg gctgtgtttt atcgctgaat tatggtataa     82680
     tattttttgt cggaatacga caacgggttg ttagctcagt tggtagagca gctgactctt     82740
     aatcagcggg tcgtgggttc gaaaccctca caacccataa aaaacaaacg ccagtgactg     82800
     ttaaagtcgt tggtgttttg tcgtttttac gggcaaaatg ttaataattt caataataag     82860
     ctgatttctt tttgattatt tatcgattac atagaaaata agtggaattt caaagtatct     82920
     aataatttac tacatgatat acaaaaggag ttgtttcagt gagtagaatt gacatcggag     82980
     aaatacaagc ttttttatac cagctacgtg caaccaatga accaggaagg aaaactatcc     83040
     aatctatcaa agcggccgtg acaaagtatg tgggagataa tagtttaaaa ggaaaagcag     83100
     ttgatgcatc gaaaaattat tatcaaatga cttatttccc tctctgtgat gcaataatcg     83160
     aagctatgga cgaaagtgaa gaaagattgg ggcagtacat ccaagatttt catgccgaag     83220
     ttgatagctc accagatgcc aaaatcgatg cggacggttt atatgaactg ggtaaaatga     83280
     ttgaccgaat agaaagcaaa aaagaagctt tagcacagcg aatgaacagt ggaacagaag     83340
     gacaaatgca gaattaccgt tcccagttag ctattgcgta taaacaggaa aatattctcg     83400
     aaaaatattt gtcatttgaa caaagccatg ctaacttttt tgaccatttg attgacttgg     83460
     ttcaagcggt tcagcagacc atccgcgaac ttcagtctaa tatccagttc aatagccaaa     83520
     caggcactta cgatttaagt aaactgaata gtgctacagt gagtcgaatg caacaagcat     83580
     tgaataaatc acgaggtatc aaagaagaca ttataaaaga actacgggac tacacagtgc     83640
     ttgcagtggt atatttagat agtaatggaa aagaacaagt catgtggtta ttagaacgag     83700
     acggcgtagg ggtagagaat gcggaactca aagcctattt aacagaaaat ggaaaatact     83760
     taaacccaga agactacacg attattacga atgaagaatt aaacaagaaa atcaaccaat     83820
     cttggcgaga tggtgtttat tatctaaatg gtaataagta tgatggacta actggcggcg     83880
     tcttatctac ctcggcatat gttgaagctg gaaaaggata tatagataaa agcgggtttg     83940
     cggatgttgt actggggctt gggttgagta cggctgcgat tagaggtagc ctagtatata     84000
     agaaagttaa tgggccatat aagcaaaaca taaaaaacag atatcctaat gaggttcaac     84060
     aagggaaaat tttcgattat actttagaaa atggacaagt gaaaattcgt gatggcatta     84120
     aagaagttga ttttataata gatctacaag gtaatttaaa agttggtaga ggacatgctc     84180
     acttgtctaa tggaggggat gtgcaagcag caggtaaatt aaaagtggac tcgaatggta     84240
     atgttagaag aataactaat gaatccggac actatactcc tacacttgga caggcgaaga     84300
     actatcaaca aatttttgag aataccggaa taaacactaa aaatgcttgg ttggaaacat     84360
     atcaactaga tgtaactaaa tctggttatg tagacttagc aaaattgaag agaatagatt     84420
     ccgtaaaatt aaagtaaagg agtgctcatt atgagtaaaa caactcaaat gaatagcgaa     84480
     attttccaaa taaatttaga gaaaacttta aaagagataa tggtggcaaa agggcttcaa     84540
     agtgatgaaa tcagatttgt gatagtcccc gtagaagaaa aagggaagat gttagatggt     84600
     agtgatgaaa tgatgaagcg attagttttg actaaagaaa atataggtaa taaacaatta     84660
     gtactaaaag atgttgtaga tgttttaggt ggattattcc ctaaagctcc tatttggata     84720
     aatgtttctt ttttagaaat gaacggagaa aaagctatat ttaagctgga aacgagtttg     84780
     cgttttagaa agccgacact attaaggaac gctgaaacag ggcacgcacc atttaaagcg     84840
     ataacttaat ttgaatactt ctttagataa agtgagacac ttgaaaggac aatcttagtg     84900
     ttttaaatat tagtaactat gaaataattg ttaattcagg tttaataaca cgctaaaacc     84960
     ataatagtag ggaagatttt tttaataatg ttatggaata tcttaagtag gaggcattat     85020
     agcaatgttt aaaacaatag tagatacact aattgctcaa agaagggaca gaaaaattaa     85080
     agaatcagaa cggagacaag aaaattaccg agcgaaaaga gaaaatttaa ctgaagtata     85140
     tagatcttta atcttaatag ttaatctatt tccaaatgaa tcaccaactg atattattaa     85200
     aaatattaaa tacggtccct attatagctt agagaactac aacgggattt ttcgcaccct     85260
     agattataaa attgaagatt atgagaagcg aaaaagtttt tcgaatcttg attatgaaga     85320
     aaagaatgat attgatattg aaatatcaaa catagaatat gctaaagata aacttgctag     85380
     gaatcgtaaa tcatatcaaa aggctgtaaa atgttttaat cagtttaaag actcagataa     85440
     agcgattttt gatctttatg cgggtacaca tgttcagaat tgtcttgtta attttgaaat     85500
     taccataaac aatgttttta tttctgggat gagtgtgggt attccagata gtccttatga     85560
     gaatagtatc aaaatagcta gtcgaaaatt aattagtgct atgaaaaaag atattggaat     85620
     tacttgaaat aaatatatat ttttcatgct actataaaaa gactttgtta tagtaataat     85680
     agctttattg aacatagagc atagagactt tcaataagta taaaggtatt ttccgcttaa     85740
     acagcggatt gtgagtttga aacctcaaca agccatattg gaaaacctca taaacaatgc     85800
     gtttaagcga tttttgtgaa atttcaatcc acaagaatgg tatttttatc cagtaattta     85860
     ctaattcgat aaaaaccaac cttcacccaa caggagctaa catgaaaaaa ctaaaacagc     85920
     taactaatca attatttaca tcaactatct tcctagtcac catgttattt atcatacccc     85980
     caacatttgc gatagctgat ggaagtaaag tgagttttta tgaatatata tatggagcac     86040
     ctttaagatg gctaactgta attagtacaa ctgagaagaa aggtgcattt ttggagatgt     86100
     ttttctcgga gaacgaagga ataaatatcc aatggctcaa cctaataata aacttcctcc     86160
     tagttttcct tgtaataaca attatcttct cactagcaaa aaagttttac aataaaaaga     86220
     acgcctaaaa aagacaaccc ataacaggtt gtctttttct ataggaagtt tcaagttatc     86280
     ttatactgta aacgagaaaa attcactttt taatgttgtc agctaaacat ccagcttcgc     86340
     aaccttctcc tcataaatcc caatcttcct aaccactgta tccaaatctt tctgcaagtt     86400
     ttcaatctct tgctccaaaa caatcttctt ctctttcaac atattcaatc gttcggaaat     86460
     ggtgctgtcg cctgctgtgc gccaaatggt gtattgtttt aattcttcta ttgataatcc     86520
     ggcgcctttt aaatgtagca aaaatttcaa ccaattggcg tcttcttcac tgtatgtgcg     86580
     caaattattc ttgtcgcggt caggggttat taagccttct ttttcgtaga atctaagggt     86640
     gctgctaggg atgcctacta gttcggaaaa ttcaccgata gaaaaggaca tctaatcacc     86700
     tcatctgtgt atttttcata aggatatcat ttttaataag aaataattat tttccgatac     86760
     gtttattttc ggcggctgag tatctatcac caacaatttc aatctgcgat aaagcatcag     86820
     ctattttttg tcgtgctcca tcatcaaaat gaatttcagt ggaggcgata ttttcttcta     86880
     ttctgcttgg tcttgttgtt ccgggaattg gcacgatcca aggtttttgg tcaagtatcc     86940
     aagcgagggc aagttgggct gttgtgacgt tttgctcgtc ggcgatttct ttcatgaaat     87000
     ctagtagtac ttggttggct tccatggctt ctttttggaa tcttggtaag ccaccacggt     87060
     tgtcgtttgc attgaagtca gcatttatat ctaattttcc agttaaataa ccacgaccta     87120
     gtgggctgta tgcgacaagc ccgatgccaa gttcttctaa aaccgggaat acttcttttt     87180
     cagcttctcg ccaccagata gaatactcac tttcaaccgc agctagtggc tctactttat     87240
     gagcacggcg tattgtcttt gcgctggctt cggagagtcc ccagtgtaga attttccctt     87300
     cttgttttaa attctgaatg gtgccggcaa cctcttcaat tgggatagag gggtcaattc     87360
     tatgaatgta atataaatca atgtaatctg tttttagccg tttgagagag ccttcaaccg     87420
     cggccttgat gctttctgga cggctatcga cttcgttatt taaaccatta attttaaaac     87480
     caccttttgt tgcgatttga acatggtttc ttttgccaac caaagcttct ccgacaagtt     87540
     cttcgttagt ataaggtcca tacacttcag ctgtatcgaa catcgtaatc cctgcatcca     87600
     ttgcagtgcg tacgacttca atcatttcat ttcgatcttt cgcaggtcca cgatgataat     87660
     ttagccccat acagccgaat ccaagctctg aagtaactaa gccagcattt cctaattgtc     87720
     tctttttcat aaaaacatgc tccttttaaa ccaaattttt aaattagaaa tatcaggatg     87780
     ttgtatttag tttatcagtt gaagtgaact ttaagtcaag cgtaactaat ttatttttaa     87840
     gagcatcaga cagtttaata aaagcgatga ttaattttat tttattgatt gaggcttatt     87900
     ctttgctctt agtaggaaca attgcatgaa agcggtctta aataagcgct aggaatgatt     87960
     ttagtagttt cgatagtact aatatatcga gaaatgttac gaaaaaatgt cagcaaatac     88020
     tcaaaatcac gtaaatcagt tgtaaatgag tatacgaatt aaacgccttt tctaagataa     88080
     taagatttgt gatggaattt cagaaagggt gataacaagg atgaagtata tcgattacca     88140
     tgattatatg cataaagacg cgataatata tgcttatctc caaaataatt tcccctatat     88200
     tcgcaaacga ataaaggcat gggaaagttt tacactagat agagaagata ttttattggt     88260
     gaaaagtggg gcaatatttg aagaagttaa tgggaagaaa aaagggatag cacgatgctt     88320
     tttttcgaaa agtttaattt ttcctactag agatccaata gtattgaaag ctttcgaaac     88380
     ttcagaaatt tgttttatca atgctgaaag agccttcgga aaattagaag aagatcagat     88440
     tttatccaat tttttcctgc agattgcgga gaaaaatgaa gaagacatgc gcagacaagc     88500
     atttcttggg acggaaaact caaaaaataa aattatttct acgcttaact tcttgttgga     88560
     aaataataaa tctaatagca aaacaccaat ttttcctata tggcttcaaa taaatgtttt     88620
     ggcaaagcta gcaaattgtt ctatatctac tatttcttct actgtaaatg aactacacgc     88680
     agaagggata ttagatataa aatcttcgcc ttggaaactt aaaggcaagg aaaaaaagat     88740
     agaaattctt gaaaatgaga atcagaaaat gaagcttaat gaaagaaagc ataagagtaa     88800
     tgttttctaa cagtactgaa attgaaaaaa tgttatgagt acttttccga gcacaaaaaa     88860
     tcatactaaa agaggtggaa gtagaacttg aagaaaaata ttttagtcgt aattattgtt     88920
     tcggtacttg caattagtgc aattgtatca gcttttttct taatgagaga cgatgcttat     88980
     gctattgaaa cggaaggctt tacttatagc ccgaaaggaa aagtagtaga tttttcatca     89040
     gaagcaaagt ataacgatac atggattaac aacgagaaaa caataacaga taaaaaagaa     89100
     atgaagccaa ttaacctagc aagaacatta tttttaaaag atggacgaat tcaattttta     89160
     ggaaaaagtg tagctgttaa aagtgcatcg gatttgattg aattaccatc caaaacttct     89220
     ataacagaga gtaaaggtag ttacaaagca aaaagtgata gtaataaaac attagcacaa     89280
     cttccaaaag gcacggttgt aaagcttgca gaaggaagat atatcatttt ggataatgcc     89340
     tacctaaaaa acaaacaagg tcttaataaa aaactaccta aaaacgtact tgtttccata     89400
     gatgaaaata aaaaagtgat gttaatgggc gataaaacca tagaagaatt aggcggggac     89460
     gatgcttata ttgaaatgga gaacaatcac tatcactttg acttgaaaaa agaaatgttg     89520
     gtcagtcaaa cagcaaaaga aacagatatt gatatccgct ccattaaagt ggaaatagat     89580
     gataatgccg aaaaaagaag cctaaaaaca gcaaaagaaa cggaaaaaga aacaacaaaa     89640
     gattcaactg aaaaagaatc agaaaaacag tcgaatgatg cttctggaca aaaatcagca     89700
     caaaataatg agcggtctga aagtaaagat gatcaaacac aagacgcgtc cggcaacaac     89760
     acaaatggaa gtgcaaataa caatacagcg agaagcaatg gaacaggcgg aagtaattct     89820
     gatacaaatg gttctcagcc cgggggtacg cagaataaac caaatgaagg ggatgttaat     89880
     aaagcgaatg aaattattaa aaagctaaac gaagctgaaa acacaaacac gtttcaagta     89940
     ccaattgtgg atgttaattt gacggttaaa ggtcaagtgg ctgcggctaa actaaaactg     90000
     acagactcat ccaaaaggct aaattcctta gaagcaattc tttacgatag taagaacaat     90060
     attgtaaaaa aagaaaaatt gaactcaaca aaagcgaatc aaaacttcac ctttaacaat     90120
     ttaaaatatg gcgaaacata tcaagtagtt gttcagggaa gctacaagtc agcaagcaat     90180
     aaaaatcaag atactatttt cttccgccaa acggttgagg caaaaccggt tgttttaact     90240
     ccaaaagtga cggagcgcgg cgaagattat atgaaagcgg aactgactgc aaccgaactt     90300
     tacggtcata ttgataagct ggttttaaaa atcaaagaaa acaacagcaa tgtaatcact     90360
     tctcaaaaag ttactgttga tgcgagtcaa ttaacaaaag acggacaagt agaagttaag     90420
     tttaattcat taagtagtga taaagaatac attatcgaaa tggaagaatt aattgttgat     90480
     ggaaaaaatg taacagatga tggttggtac tttatttcct ctacattaaa agcaaaacca     90540
     acaattgaag gcttaaatct ttcttatagc acagataaag gtgagtttgt tgcgtcacca     90600
     gttaatctag ttgatagaga tgagtcaatt acaagcattc gatatgtagc gtatttagaa     90660
     gatgactata aagtaaatgg ttctaatgcc aaggaatacg cttattctgt agtagacgct     90720
     aaccaaaaga aaacagctgt taaagttggt cgaacagttg atatgaacga tggtaattat     90780
     atttttgtgg gttatatttc tggcaataat ggtcagtcag attacacctt tgcaactcca     90840
     gcttcgaaca gtgtagtcgt tggtaaaaaa acgaagccaa ctgtagagtt ttcactgaaa     90900
     gaggcagagc aagataaact gacaatcaat tatgaagttt ttgatgcaga taacacactt     90960
     ctttttgata acctaacaca tccaacctta aaactatata aatcagatgc tcaaggcatg     91020
     tatagtggaa atcctgttgc tacagttgat ttaacaaaga aaagtgatat tacgaattta     91080
     ctagaattcg atggtttaga aagtgaagct tattatgttg tcgtaatgac aggttcctat     91140
     aatttggacg acggagcagg gattatggtt gatgagctta ttggtcagtc aagtgtcttc     91200
     cggacaaccg aaattacaaa ggtcaacgca tcattttcac ttgattctgt agatacaaca     91260
     aaagtagcaa ttaatgtcaa attgtccgat gcggctgtta atttaaacga cgctaattta     91320
     aaaatttatg aaaagaaaac aaacacacta gtcaaaactg ttccgctcca tggggacttt     91380
     gagaagttaa tgagcgattc gggaaatagt tatctctttg aaaatttaag tattaataaa     91440
     gaatatcttg tgaaagtaga agatggctat gatagtggaa tgaatcatgt tccggttgaa     91500
     gggcaattta ttttcaaaac caagaaagaa tcacctgaaa cagacaaagt attgctagat     91560
     tacaaagctt ctgaaatgaa attaggaggc ctagcgggaa tcgcggcaac agaaaagcca     91620
     ctaattgatg attataatgc tgttagttct attacctaca gtatctataa agcagatgat     91680
     ttaaacacac cgcttgtgga acaagaagtt tcaacagcgg cagactttga gaagaacgtg     91740
     tactttgatt taactaataa gctcttagga cgaggttatt cttatgtcat aaaagcggat     91800
     gttgtttgga atgataacta tgaagatcat catattgaaa ttagttctga tacaatccaa     91860
     atcaaaaaag aaaaaccaac cgttgaatac gaaattttaa gccgcacagc gagcgaaatt     91920
     aaattaaatg tatatgtaga agatgaggaa gaatctatcg taccgggaac gcttgaaatt     91980
     actagtacga caggtggtaa tgagcaactt caaagtggaa aaaataatgt aaccttacca     92040
     ctttcaagcg agggaactac aacaattaaa acaacaggtg attacattat taccagcgga     92100
     agttcagcta tttcagatat ttttatgacg aaacagttgg cagcattaaa tactactaca     92160
     ccacaagttg gagccaaaat tgccatggat gcttcgggca aatcaatgac tatcgcccca     92220
     gaacctaatg cagttgcaaa aacttctgtg atgagaacta aatatgattt gaaagatgct     92280
     gcaagctcca aaccagatta ttcaattaca aaatctggtc ctaatcaatt taatactcaa     92340
     aaccttaatt tgcctctagg taatatttgg tttgataatt cctatcagct aactcttgat     92400
     atgaaaatga attatacaga aaacaaaatc gataaccaaa acctagccaa taattactat     92460
     ctatctattg gaaatggagc atcatttgtt agctctttaa gcggagcggt ttcgacaacg     92520
     aataacgtaa atagtgcgga tgttttcaaa gtaacgaaag caagcaccga tttagaaggt     92580
     aatatttccg gtgttacatt taaaaatatt tggactgata agtatatagc ttatcgaaat     92640
     ggtattttga ttagtaatag cgagactcct gattcattca aattaatccg tcaagctgat     92700
     ggaagttatg taccagaatt gagtggtcgc tatgttaatt tctctgttgg actagtaaca     92760
     gatgaagcag ctggatcaaa aatcgattta tattcaactc aggaaaaatt agaacaagtt     92820
     tcggaagcta tttctgtaaa agcacttgaa gagccagcta tttcagcaga gaatattggt     92880
     gtttatgata aacgcgtcaa attagacgtt attggtgaag ataaagataa tacaacagtt     92940
     aagaaagcca acaagaatga gttatttgta aatgtttata aagcagatgg aacaacactt     93000
     gttaactcaa ttcgagttga tggattaccg acgcgtgatg tttcagttac agagctttca     93060
     ccagacaccg attatgttgt taaagtagaa ggaaaatatg atttgttaga tggtaatggc     93120
     gaaaaagaca aagtgtatta ttcagagaca attaagacag aaaaaagctt accaagcatg     93180
     acttcaactg attattcttg gagccctgca tatggccagc gagcgattaa aggaaaaatc     93240
     gattttgctg atgaaagtag cgttttaaca aatattgaat atcgtttgta tgatgctgcg     93300
     acaatttctt ccagcttatc taatttagta gctttagaac aagagttagg taataaaact     93360
     cccgtatcta catttgataa tatgacaaat aatccagaat tttctatata taacggttct     93420
     ggaactcaaa attttgtttc tgggaaaacg tatgtaattg ctgcatatat gaaaactagt     93480
     ctaacaagag cgcctatctt cctaagtgat gccaaagcgg tctatatttc accaccaagt     93540
     aatgtttctg ctccgattac gctagaaaat gtttcaacaa gagaagcgac tctgaaattc     93600
     tcttataacg atccgcaaag ttattttgtt ggcggaacaa ataaagattt ccaatacgta     93660
     ttaaaaaata cgacaaccgg tacagaagtt aaaaaagggt catttcaagg tgggaataca     93720
     gctagttgga taaatacttt tgaggattta gaacctgcaa ctggatacac gctaacaatt     93780
     agcacccaat acgataatct aaatggtgga ttagtaaggg catggaatac tagcttcaat     93840
     ttcaccacag atgatgaata tgtaacttcg aactcactta ccattcagct agatgctgga     93900
     gcaaaagcag ttaagttaca ggctaaagaa gtcagaccgg gatctacaac gattgaaaat     93960
     attaaaatgg agttctatga gctaatcgac tacggaggta ataatgaacg tacccaatta     94020
     gttgaaacta aaaatatcac tttaccaagt tcctatccag caactattgc agcagatttt     94080
     aatgtggcag gtaagaagaa aaatcaaagt ttcttgggta aaatgattgt cacttatcga     94140
     acaccaacaa atgaagttaa aacgtatgaa aagacatcta atttcattac tttgcaagaa     94200
     gatattgccg ctgggctcaa atcatttaag agcgtgcgag caacaaatga cgctttagaa     94260
     gtaaaactag atattccgca agataattca accgacaagg ggagttacac gtatgagttg     94320
     aagaacgaaa atggtgatgt tattgataca gaaaaagttg cagcagaaga tatttctaaa     94380
     actgtatcgt tatcaatgga accaacgagt aattatacgt tgactgtcat taatccagat     94440
     aaccagcccg tcgcacttta tcaaggcaat aacgaagaaa ataatctgaa agctgaaatc     94500
     aaaaaagata gttttacact gatgagcaat aacacagccg atgctaaaac tacaatgaca     94560
     gtaactgtag aacctaaaga attaacagcg tggcaaacag ttcaatcctg gtttggtaaa     94620
     gactttacag aaacttataa tatccaaaaa gatgagctag atacaggtgt gaaaattgat     94680
     acaaattatc aagacactaa agttactgtc gaagaaacaa aatcagggaa gaattttgga     94740
     attattgaat tggaggagag caaatgaaac ctacatggaa aatagggata atcgttgcag     94800
     ctgttccgtt aataattatc gctgtcgtct tatggggatc ttttaaggag gcaaggtata     94860
     atcttgtctc tctccctgat gacggggtag tcctaaataa tgagcaagag acattgcaat     94920
     ttcagaaggg caatacgctt tatcgtagtt ggaatagtga tcaattaatt gcgaaaaacg     94980
     ataaagaaga tactcgaaat gaaattatgg agagtaccat actttatcta aataaagaag     95040
     ccttaatgtt tactaagagt gttcctgtca ttgatacaaa tggggttagt agcaaactaa     95100
     aaggaagaca agtctatcaa cagaccaact cttcctataa atataaaaac tccgaaattg     95160
     tggaaaatag tattgtaaaa ctagcaaacc gtcaatacta tctaaatgca gatgcaacac     95220
     tttatctcgg tggtaaagaa attaaaaaag tgactaaacc gctacttttg attgataaaa     95280
     caggtagtgt cactatttat gaaaataaaa agaaaagccg ttttctgggt catatgacgt     95340
     tgaaagtcaa tgataaaaca gttttagatg ctagtaatga aacgtatacc gttggcgaac     95400
     ggaagattga tttagctagc tttggtggga cagacaatga aaagattgtc gtaaaagaag     95460
     atgaaaagaa agaagataag aaaaagaccg cagaatctgc gaagaaaaca gcaagtaata     95520
     cctctcaatc agaaaatgaa agtaaccaaa caacaaaagg tacaggcaat caactcaatg     95580
     ctaccaaaaa atacggaaat aatttaaatg ttggaaatgg aacttctgat tcagaaccaa     95640
     acgatggtaa ggatactaaa aataacggtt caggaagtaa tgcgaatggt ggaaccaatc     95700
     aatcaggtct gaatgaaata gatgactatg aagctgtttt acgtaaaata gaggacttaa     95760
     ataaaaaatt agagcgaaat attccagtgc taagaatcgg ctatatcgca cctggagtga     95820
     ccagcgtgaa agtcagctat aactatgcag atccgaataa cactttaatt ggcgtcacta     95880
     aaattagcgc cgtagatgaa aaaactggaa aaacagttaa tacgcaatat gtttcagcag     95940
     tagatacgga agctacacta aaaggacttt cgccaaatgg caagtatcat cttgaattta     96000
     cctatcaata tgatttagga acaaataaag gcattcaaga agttaaaatg caaagtgact     96060
     catttacaac gcaaactgtt gccgcaattt atcaaatgca aagcgttaca agcacaacaa     96120
     tgaaagtaaa tatagcgctt gatgcacaaa ttgatgatgt taaacgagca agaattaaag     96180
     taaccaagtc agatggagat tttttctata tgaatgttag tgcgaatttt ttaaatggaa     96240
     acggagaaat tcttaatgca acagggctta agcctagtac tgcttaccag tttcaaacag     96300
     tgattgaaat gaaaaacgga gaaacaattg aactaaacag ctccgagaaa tattacacta     96360
     tgcaagcaac tgtattaaaa aatctaaaag ctagtcagtc tgtgaataaa gttttacaag     96420
     tgcaatatga ttggagttcg gctgattaca ccctaaatca agcaatcatc gaactggaag     96480
     acgaggaaga taatacagaa gtagattacc aaattgttaa ccaagaaaaa ggtaatattc     96540
     atcttgttcc agacacaaaa agtgagttaa tcaacttaaa agccaaacta gtgctcaaaa     96600
     cgacaaataa taacacaaaa gaaagcaaaa catttgagta tcctgttaag caagaaattg     96660
     aatacgacaa acaagctaaa ttaacaatgg acttaacgcc atttcaaact gaagaaaata     96720
     gtgaggctca gaccgaaaaa caagatgtag tagcagagaa agaaacgaat ggaaatgatt     96780
     taacagctaa gatggaagat gttttagccc ctcaaaacgc aacttatgat atgtcctttt     96840
     cgatgcaacg caaagctctc gaaacctatc agttggcatt tgaaaggaag atagctggga     96900
     tagacgatga taattggacc atgtggaaga gtcaacaagt tacaacggat gaagcagggc     96960
     aagtgaaggt tacagaaacc atttcaaaac tagctaaaga tagcttcgat tatcgtgtag     97020
     ctgtatacga tgcgcaaggt gcattacaac tgtacgttta tcaaaagtag taaaaaatga     97080
     tatgcatttt aatacaacaa actcaaacag aaagtaggaa ataacaatgg atttagtagt     97140
     tgcatgtagc gtaattggcg cggcactggc aattgggctt gcgactttag gagcggcaat     97200
     tggacaagga attgcagtta gtagagcaac agaaattatc ggaaaaaacc cgaacgcaaa     97260
     gaaagaagtt atgggaggtc tttttttggg gcttctcatg atagttgcat taatgctatt     97320
     tgcactggca attgcagtca tcttgctttg ggttaatccg tttatatgat gggtgagagt     97380
     atggagaaaa tgattcaaac aataattcta tatagtgttt tcgcagtagg attcttatat     97440
     ttactgcatt tcaccttaag aaaactagaa aatatcttga ctagcttttt ttacgaagtg     97500
     agtcaagatc agtcgcttga aaaggaaagt cttttgcgcc gtttaaaacg acaaaaagtg     97560
     gcaacaacac aagaagaaca aaaaaatcgt caattggcta ttgaatcgga acaaaaagaa     97620
     gtgctttttt tagaagaaat cgatcaatta atagctcaaa ataaaagcta tgaacaacaa     97680
     ttgcaggcat gggaaaatga gcagccaaag caaatcattg aggtgcctac gtttgaaacg     97740
     acaccacacg caccgtacaa atcgctaagt agttacatta atgaaatttt tcaacaggtt     97800
     tttattgagt cggaagaaga tgaagcgcgt ctgtttacgg aagcaattcg ggaatttgat     97860
     gcattagtta gaacagaaaa aatacgttgt gcgctcccat acaaagtgat tttgcattta     97920
     tttgaaatgt attcgccaga gcagttacat ttatttgctc agtcatttca gagatatagt     97980
     gagcgttcga gtaaacttcc tgtgaaacaa atttaccaaa gtagttattt atcgccagag     98040
     caaaaattaa aagtgatgca agaagaaggt actttagatg agttagatgc tgaatttatc     98100
     caatttcttt tttacatgat gacgcattac tcttaccgcc aaactcggaa cctgtatcgt     98160
     aactttttgg aggtatacaa tattcatttt tatagaggtc ttatttgcat ccatgtagct     98220
     agtaaaggct cagctaatca ctttgaaaaa ctttggcagc cggcgcatag gagctataaa     98280
     atcgagtatc aagtacaaaa agagttaatt ggtggagtga ttattcaata tggttctaaa     98340
     tcaattgata tgagctacca ggaattaatt aaacgatcaa cagaaaaaat ggaagcggaa     98400
     gtgaaacttt gaaaacaatt cattttgata tgaacaaata cgaaacccat gtggacttgg     98460
     aatatttgaa agaacatggc cgagtggaaa aaatttctga tggagttatt ttctgctcag     98520
     gcctagaaaa tgcagcgcta catcaggctg ttttaattga tgaaagacac cgaggcgtca     98580
     ttctggagct caatgaggaa tttgttggaa tcggtttgat tgataagacg aatgacattt     98640
     tagaaggtat gcatgttggg gtctccggca aatttatcga agtagaccta tttgaagaaa     98700
     tggcagggcg tattattgat actacaggaa aaatgcttta tgaagaaagt gaagaaaagc     98760
     cgacagcaac ctctccactt ttctgtgtaa ctccagctat tatgacgatt gatagtgtaa     98820
     cacgcccact taatacgggg cttgcggtga ttgattctat tacgccaatt ggtcgaggtc     98880
     agcgtcaatt aatccttggc aatcgtcagt ctggaaaaac acaaattgct gtagatacga     98940
     taattaacca acatgatcaa aatgtgcatt gcatttatgt tgccattggc ttaaaagcag     99000
     cttatatcgc agaagttatt gaaactctac gaaatcatgg agcaatggaa tattctacgg     99060
     ttgttgcaac tgcagccagc gattccctta ccgcgcaata tttaacaccg tatgcgggta     99120
     tggcattagc agaagctttg cgagatcaag gtaaagatgt acttatcatt ttagatgatt     99180
     taaccaaaca tgcagacgct tatcgagcaa ttactttact ttttaaccgc ccgccaggaa     99240
     gagaagcata tccaggagat agtttttata ttcactctag ccttttggaa agggccgttc     99300
     aaatgaatga agagcatggt ggtggttcta ttacagcaat cccgatgatc gaaactttat     99360
     cagatgatgt aacagcttat atccctacta acgttatctc tattacagat gggcaattat     99420
     ttttaaaatc ggatttattc aatcgcggtc aaaagccagc tgtagatgtc ggcgtgtctg     99480
     tttcaaggat tggcggcgac gcacaacacc caattatccg caaattaagt aaaaatttaa     99540
     cgttgattct ttcgcagttt gaggaattaa aagaattact cgattttggg aatgcacttg     99600
     atgacggcag tatgaaaatg gtatcggatg gccgattatt aacagaatta ttcaagcaaa     99660
     aaattctaag cccgttatca gtaacggaat taatcgtcat tttatatgct ttccaaaatg     99720
     gctttctaac aaaaatcccg cctgccaata ttcagacttt caaaggactt ttgctagaaa     99780
     aagcgcatat gcataaagat tttgagtcgt tttcagctca gatagaagct attaatgaac     99840
     tgaatgaatc gcacgtcgaa atgctagaag agatcattcg ggaaactggg aggcttttta     99900
     gttgagtagc atagaccaag cccgaaaaac cattaaagca ctaaattcaa cctataaaat     99960
     tgtccatgta acagaactag caacacttgg aaaactttcc gctttacgag aaaaagcgga    100020
     agcggctgtt agttattacg aaactatttt aaaaagtttg cgctgggtga ggaaaactat    100080
     gtacaccagt aataaccaaa taaaagaaga aaaaaatgtt actgctattg cgataacttc    100140
     tgagcgtggt ctttgcggtg cctataacag tgaggttttt gctgaaatcg atcaattgat    100200
     tgaatcactc ggcgatcaag taacgattaa ttgggtagtt gtaggtgaac agggccaccg    100260
     ttatttaacg aaactaggtc agaatatcac ctcttattta cagttttctc ttgaaaatat    100320
     tgatttagaa accactacgg ctgttactgc tgattttatt gacctgattc attcggaaca    100380
     aatggatgca ctatatgtga ttttcacgaa atatttgaat gcggttcaat cagaagccat    100440
     gtgtgaaaag atttatcctg aaattccaga agactcggat acagagctaa ttgaagtaga    100500
     ttatgtactc gatttcgaga cggatgacga acaagtggag cagttattat tagaaaacta    100560
     tttgtgtggc ttgctttata gcatgtttcg ttactcggtt gccagtgaat attgcatgcg    100620
     ccgaatcgcg atgaaacaag ccaaagacaa tatccagaaa caattggaag aagctatttt    100680
     tgatgccagg aagcaagcat tgcaacaaaa aactggcgaa ttactcgaca tcattagtgg    100740
     agcacagacg attaggaagg acgaagaata aatgaaaaaa cacacaggaa ccattattag    100800
     tattagtggt tttgttttaa gaatcgaatt taatgagagc gaactgcctg aaattggctt    100860
     tgcgcttgag tatcatacac atcaaggaac ttatctagct gaagttgttc agcatactgg    100920
     aattaataca gtgtctgcca tcgctattgg tgaggtaagt ggcctggcta gaggtacgga    100980
     agtcgttaat ttaggacatc caattgaagt gcctgttggg gaaactgttc agggaagaat    101040
     gcttaatgta tatggaaagg cgattgacgg taaaccagag ccagctgctg aagtgaagtg    101100
     gccaatattc cgtgcccagc ctttacttcg agagctagat acgaataaag aaattcttta    101160
     caccggtatt aaagttatag atcttatttg tcctatttta aaaggtggga aaacaggttt    101220
     atttggtgga gcaggtgtag ggaaatctgt cttaatgcaa gaattgatta ataacatcag    101280
     tatgcttggt gggaactctg tatttacagg agttggagaa agagttagag agggaatcgg    101340
     cttgtataaa gaattagaag caagtggtgt gcttcctcaa acaaccgttg tacttggtca    101400
     aatgaatgaa tctccaggtg tacggatgcg cgtggcatta acaggactaa ccattgcgga    101460
     atatctacga gatgaagaga aaaaagatgt tttattattt atagataatg tcttccgctt    101520
     tattcaagcg ggttctgaag tttcttcttt acaagggaaa attcctatta ctggaggtta    101580
     tcaatccaca ctttccaaag aggtcggcga ttttcaagac cgcatcgcgt ctactaaaaa    101640
     tggttctatt acctcgattc agtgtgtgtt tttaccagca gatgatattg atgatccatc    101700
     tgcagttgcg acgtttagtc atctagactc aacaattgta ttagaacgtt cgattgcggc    101760
     gcttgggatt ttcccagcag ttaatccact tcaatcattc tccagagcac tcaatccaac    101820
     ctttgttggt gaacggcact atcaattagc ggtgcaagtg aaatttatct tgcagcgtta    101880
     tatggaactg caggaaatca tcaatgtgct tggaatggcg gagttaagcg atgaagatag    101940
     aaagctggtt catcgcgcaa ggaaaatccg gaattttctt tcacaacctt tctatgtttc    102000
     ggaaaaattc actggaacag aaggtacatt tgtagaaatt gaagatttac tagggagtat    102060
     cgaacgcatt ttgaacggtg attatgatga acgctcagaa cgtgatttcc tatttatcgg    102120
     atcctataaa gacttgaaat aggaggagaa taaaatgaaa cttaaaatcg tctcgcctat    102180
     ggggcagttt tttgaaggag aagtagaagg ttttgttatt aatacaaaag aaggacaaca    102240
     aaccgtgtta gaagagcata ttgattgttt aagttttttt gactatagtg aaatcagtat    102300
     tttagatgca gttgcttcgg acccaatctt tgtggcgctt ggctatttac atttagtaca    102360
     aaatgaagca aatattatgg cacagttcgc ttctgcggat gccgagcaag cggagcggat    102420
     ttttgaaaga ctcaataagc gaaaacaaac agagagtagg cggtccaatg acaagtgaat    102480
     tttttagtac acttctgttg attattggtt tattgattgg cttttttctg gcgatattat    102540
     tgattttagc ggggattcgg cgctttttct gtagtgccga ggaaccttta aaacgaatcc    102600
     ggcgctatca agtatggcat aatcgttatc aatttaatga ggaggttact tcttttttta    102660
     ctgttattgg ggcaacactt ttagtaagcc ttattacagt acaaattacc gcaattcctt    102720
     ttcagtatac ggtgttaata ttttggagta gttggctatt ccacttactt tctttttgga    102780
     agaagatacg agtacctaaa aaaatgaaga atgaaatgat acaattagca ggatttcttt    102840
     taatcacagc gctttatttt gttggttatt ttgcgatgaa gtcgttgcat ttttctatta    102900
     tacatgtagc agatttccct ggagttattc agttcggaat aagaacctat ctaactattt    102960
     gtagtttgtt tgtggcgagt ggggcattaa ttgtttggca gcgcatctat gtgaaactat    103020
     tgaaatgact aagaatgcga ataacacata accaagaaaa acgaggatgt ctacgtggca    103080
     tccttttttt ataaatgaat atataaaaag aatttttcta acatatttct aacatacttg    103140
     tactatactt taaataagct gttaattagc cataagaaaa tgaacgaaag gaagtaaatt    103200
     caaatgactt ttttagaatt ccatcaattg gtcaaagaag atttgttgat ttattcatgg    103260
     attataaaaa attttcatct tacgcgtcaa aaattaatgg cgggtgggga aataacgatg    103320
     aatcgtgaac aagtgatagt tatggagaaa ggtttactag tacaagtaaa tgaagaaggc    103380
     aaaaatgatc tgtatcgtgt ttttatcgat caacgaataa tttttacgac aaaaggggat    103440
     attactttaa cggcactaga agatacctct tatagcatca ttcgaacaga tgagttaatt    103500
     gggaaattag aagatcaaca tttattacca acttttttct tacaaatagc ggaagacttt    103560
     gagaagggtt tagactggca aagaacacta atttctgttg atcctgcaga acgtgcggaa    103620
     atgattttgg tgaaaattat cgagcgttat gaaataaatt cagagaacaa accagagttt    103680
     ccaagatggt taagaataaa tgtactcgca agattcgcca aatgctcggt gtctacgatg    103740
     tcgtcagttg taaacgaact agtcaatgaa ggtgacttaa atataaaagg aacaccttgg    103800
     ttactgactc gaccttatca ggcatcttgt gcttaaaata gacccgtaaa aaaccacgct    103860
     taaatgacat ttgcgtggtt tttttacgtg agttatgaaa aaacataaat ttattacgtt    103920
     tttttgatat agatacaaca attttcagat acactaaata atcaaaacgg attttctgta    103980
     tcaatagacg atacactaac agtcatagta ttaatataga tattaaaatc attggtacat    104040
     aaggctttta agagtaatac tataaattgg cacagaactt gcaataaata tagcgggtag    104100
     caaaataaat gaattatatt aggagggaaa aagatggtag gaattatcct cgcaactcac    104160
     ggtgaatttg ctgaaggtat tttgcagtcc ggaacaatga ttttcggcga gcaagaaaac    104220
     gttaaagcaa tcactttgat gccaagcgaa ggtccggaag acatcaaagc taaaatggaa    104280
     gctgcaattg catcctttga tagccaagat gaagttttat tcttagtgga tctttgggga    104340
     ggcacaccat tcaatcaagc aaacggtctt tatgaactac ataaagataa gtgggcaatc    104400
     gtagcaggac ttaatttgcc aatgttgatt gaagctttct catcacgttt tacaatggaa    104460
     agcgcacacg aaatcgcagc aaatattctt gcaccagctc aagaaggtgt tcgcgttaaa    104520
     ccagaagaac tacagccgca agtaacagct actgaacagc cacaagcaga aatcgctgca    104580
     gttggtgatg gcaaaatcga attcgttcta actcgtgttg attcacgtct cttgcatggt    104640
     caagtagcca ctgcatggac aaaagcaaca cacccaacaa gaattatcgt cgtttcagat    104700
     gcagttgcaa aagacgatct tcgtaaaaaa ttaatcgaac aagctgcacc accaggagta    104760
     aaagctaatg ttatcccagt ccaaaaaatg attgagattt caaaagatcc acgtttcggc    104820
     aataccaaag cacttttatt attcgaaaat cctcaagatg ttttacgcgc aattgaaggt    104880
     ggcgtagaaa tcgaacaagt aaacgttggt tccatggctc actctgtagg taaagttgtt    104940
     gttagtaaag tactttccat ggggaaagat gatgttgaaa cctttgagaa attaaaagaa    105000
     aaaggcgtta aattcgatgt gcgtaaagtc cctaatgact caagcgctaa catggaagat    105060
     atcatcaaaa aagcaaaaca cgaattaaag acacaataaa aaattaaaat aggaggttta    105120
     ttatgtctgt catatcaata attttagtag tacttattgc atttttagca ggtattgaag    105180
     gaattctaga tgaatttcag ttccatcagc cattaatcgc atgtacatta attggtctcg    105240
     taacaggtaa cttaacagca tgtatcatcc ttggcggaac tctacaaatg atcgcacttg    105300
     gatgggcaaa catcggagca gccgtagcac cagatgccgc gcttgcctca gtagcttcag    105360
     caattatatt agtattaggt ggacaagggg tagcaggtat tccgtccgca atcgccattg    105420
     caattccact tgcagtagca ggtcttttct taacaatgat cgttcgtaca ttggcagttc    105480
     caattgttca cttgatggac agagccgctg aaaaagggaa tatacgcagc gtagagtggt    105540
     tacatatttc agcaatttgt atgcaaggtg ttcgtatcgc gattccagct gcagcacttt    105600
     tattcattcc agcagacagc gttcaatctt tcttagaagc aatgccagct tggttaacag    105660
     atggtatggc tatcggtgga ggaatggtag ttgccgttgg ttatgcacta gttatcaaca    105720
     tgatggctac taaagaagta tggccgttct tcgttatcgg tttcgtagta gcagcaattt    105780
     ctcaattaac acttatcgca atcggtgctc taggtgttgc acttgctctt atttacctta    105840
     acctatctaa aatgggtggc ggtaattcaa acggcggtgg aggcggaaac tctcgcgatc    105900
     cactgggcga tatattaaac gactattaat aaaaaaagga ggagaataga atggcagaaa    105960
     aaatcgaatt atcaaagaga gaccgtctac gcgtagcatg gcgctctacg ttcattcaag    106020
     gttcatggaa ctacgaacgt atgcaaaatg gtggctgggc attctctatg attcccgcta    106080
     ttaaaaaatt atataaaact aaagaagatc gttcgcaagc tctaaaacgt cacttagaat    106140
     tctttaatac acatccatat attgcatctc caattcttgg ggtaacactt gcacttgaag    106200
     aagaacgtgc aaatggtgca gaagttgatg atgtagcaat tcaaggggtt aaagttggta    106260
     tgatgggacc tctagctggt gttggtgatc cagtattctg gtttacaatt cgtccaatgt    106320
     taggagcatt aggtgcttct cttgccttga gtggaaacat tcttggacct atcttattct    106380
     tcgttgcttg gaacgtaatc cgttggggct tcatgtggta tacacaagaa ttcggctaca    106440
     aagctggttc gaaaattact gatgaccttt ctggtggatt actacaagac attacaaaag    106500
     gtgcttcgat actcgggatg ttcgtcctcg ccgccttggt gcagagatgg gtaaatatcc    106560
     agtttgcgcc aattatctcg aaagttaaac ttgatgaagg tgcgtacatt gattggagtc    106620
     atcttccaca aggcgctcaa ggaatcaaaa ctgctttaga acaacaacaa gcaggcttag    106680
     ctctttctga aattaaagta acaaccttgc aaaataactt ggataactta atcccaggac    106740
     ttgcagcagt agctcttaca ttcttatgta tgtggttact taagaaaaaa atcagcccaa    106800
     ttatcatcat tctaggtcta ttcgtagttg gtatagttgg tcacttaatc gggcttctgt    106860
     aaaaataagc tgatcgaaaa gaggctggtg caatattcac cgagcctctt ttgtttagat    106920
     atatgacaca gataaacgaa tacggtataa taaacaaaac aagcgaaaag aaatggagcg    106980
     aatacagttg gttcaatcga ttaatacaaa ggtagactta acaatagatg ccaccgcgta    107040
     tactggactt acagattacg ggaaaattat gattggcgac aaaggttttg aattttttaa    107100
     ctcacgtgat gtgcgtaaat tcgtccaaat cccttgggaa gaagtagatc aagttatcgt    107160
     atccgttatg ctaaaaggta agtggatccc tcgctacgcc attaaaacaa agcgcaacgg    107220
     cacatacaca tttgcttcta aacgacctaa agaagtttta cgtaaaatac gagtttatgt    107280
     cgacccggcc aatatggtga gctcgctaag tttctttgat gttatgaagc gctcgtttcg    107340
     gtcgatattt agcaagaaga aaaacaaaaa taaataagcc gatttatacc gaaaagcttc    107400
     aatggactta tgtctgttga tgcttttttt cgtacataat aattgaatag acagcgtaat    107460
     ttgttataat caaaagtaaa caaaggaggc acaccaatat gaaaaaacca agaatctaca    107520
     cgatgtcatt tgctagtgtt taccctcttt acatacaaaa agcggagaaa aaagaccgca    107580
     caaaagaaga agtggatgaa attatttttt ggctaaccgg ttatgatcaa gattctttgc    107640
     aacaagcaat cgaccaagca attgatttcg agaccttctt tgctgaagca cccaaaatga    107700
     atcccaatgc atctttaatc accggagtta tttgtggtta ccgagtagaa gaaattgaag    107760
     ataaactaat gcagcaaatt cgttatttgg ataaattggt ggatgaactc gcaaaaggga    107820
     agaaaatgga gaagatttta agaaaataag aaaaaagaca gcctcctttg aagggctgtc    107880
     tttttatatt gtagtgtatt gcctagtgta ttaattactc gtctttttcc ccgcactcct    107940
     caaaaaagtg actaataaga ctgaccagct cttgattcac tgaataaata tgcgttgttc    108000
     cttcctttct taaattaatc agttttgctt ctttaagcag tttaatatgg tgtgacatgg    108060
     tggatttgga gatattgtaa gttgtgccag agaagcgttt ttctttgctt ttcagtaaac    108120
     ataggaaaat atcaagacga attggatcgc ttaatgcttg gaaaattaat aataaatctg    108180
     attttgagag ctcatttaac tttttcatat aaatatcata tcataactta cattttaatt    108240
     gcgcggaact tgctgctatg ttatattatg atagttcgaa aataatcgaa ctataaaatc    108300
     cgaaagaagt tgttggaaaa tgttgcatat tgaagcgcaa attacggtaa agaaagaaca    108360
     aaccgaagct tttttgcagg cggcgaagga agttattgct gcgtcaagag cagaagcagg    108420
     aaaccatggt tatgaattag tgcaatcgac ggaaaacgaa acagtttttt atatgttaga    108480
     aaaatgggcg gatatggatg ccattcaaca acacaacgac agcgagcatt tcaaaaaatt    108540
     tcagaaagct gctgccgatt ttgttgctaa agaacttgaa atttcagtgt taacgccact    108600
     tgcgagataa ggaggagaaa aatatgactt atttaaataa tgattttgaa gacttaatga    108660
     aaaaccgccg ctcgattcga gaatacgatg aaacggtgaa aattagccaa gaggaaatga    108720
     aagctatttt agaggatgcg gtaactgctc cttcttctgt aaacatgcaa ccatggcgtt    108780
     ttgttgtcgt agaaagtgac gcggggaaag aaaaattaag ctcgttagtt cgctttaata    108840
     cacgtcaaaa tgaatcttct tccgcgatga ttttagtttt tggagactta cagaattttg    108900
     aaaacggtga aaaaatttac ggagaatcag ttgaacgggg cttgatgccg gcagaagtga    108960
     aagaacaaca aatggctaaa ttaagccagt actttgcttc cattccacgc tcagaagctg    109020
     aacgtgttgt ccttattgat ggtgggattg tggcgatgca attaatgtta gttgctcggg    109080
     cgcatggtta tgatacaaat ccaattggtg gttttgaacg tacggaagtt gctgaggcct    109140
     tcaatatgga tccagagcgt tatgtaccgg ttatgattgt ttctatcggt aaagctaaaa    109200
     attctggcta ccagtcttat cgattaccga ttacggatgt tacgactttt gcttaaaaga    109260
     gggcaaggaa atagctgata tttccttgtt ctttttttct ttcttggtta taattaaaat    109320
     aacatacagc caaggaggag aagcaactgt gactatcaaa ataactcgta aaacaggcat    109380
     tggcagcggt attactccgg tgaaaattag aatcgaaaat gaagaaattg taaaactcga    109440
     caatcatcag tctcattttt ttatgcctaa gatggagaaa acaaaggttt gcgtgactga    109500
     ttggttttat gggagtcagg aagcggtttt ggaaaatagt aatgatgttg ttgtgcgtat    109560
     taatcggaaa gcccttctat taaattattc tatgttcccg tttctttttt acggttttgt    109620
     tatgactagt ttgttcgcta ctttgattgc acttggtctt tgcttggtct ccttttttta    109680
     ttcgcgaaag cattggtttg aatttgtgaa aattaaataa taattaatcg atagtatgag    109740
     cgaagtgctt gtgctatttt tttatctgtg taagttttta tttcatctgt gtatcttaag    109800
     aaggagcctt aaaccgccga atgacagcgc tttcttttgg catgataatt gcatgatata    109860
     cagatgctcg gaatgaatct ttaattggag ggaggaaatt agagagaaga acattcgggc    109920
     aaccacacaa aaaggggtac agagagacaa acttagaact accgaaatga ggtttataaa    109980
     tcaaaaatcg gggtgaagag atgaataaga agatgaaaaa gctttttagt attacttctg    110040
     ttgtgttgtt agttttatcg ttagtggttg tatcaattgg tgcagagcca aaacgggcga    110100
     aagcggctga aaatgtacca cagtatcgaa atgttatgta ttacggtgat tggtcgattt    110160
     ggggaggaga agggaacttt tatccgaaag atattccggc tgatcaatta acacatttga    110220
     attttgcttt tctggatttt aatagtaatg gggatttagt ttttactgat aaagatgctg    110280
     ctgttggggc gcctgttggg caagagggag ttcaatgggg cggagcaaat gcgggcgttt    110340
     tgaatgcgat tcaagatttg cgagctcaaa atccgaattt gaaaataggg gtttcagttg    110400
     gaggctggtc taagtcggga gatttctcga cagttgcagc ggatccaaca aaacgggcta    110460
     actttgtgaa aaatgtgatg aagtttgtga aatataccaa tatggatttt gttgatttgg    110520
     actgggaata tcctgcttcg gtacgggatg ctgaccttgt tgataataaa aacgatgaag    110580
     gcacgccaaa tgcaaaacct gcggacaaac aaaactttat tacactttta caagatttga    110640
     gaacagcttt ggataaacaa ggcgtggata ttaacaagaa atacgaatta tcggttgctt    110700
     tgccagctgc aaaatccact ttagaaaatg ggattgatgt agcgaattta tttaaagtag    110760
     tcgattttgc gaatgtaatg acgtatgact taaatggtgc ttggacaccg aatagtgctc    110820
     atcatacagc gctttatggc aatccgaaag atccgaatta tgatagtggt ttttctgtcg    110880
     accaaaccgt taaatactta aaagaaaagg gagcagtttc gaataaaatt gttgttgggg    110940
     cagcatttta tactcggggc tggaataaag tagctgctgg aacggatacg gcattgccag    111000
     ggcttttcca agctgctgaa aaaacgaata aagatgcgga tggctcgctt acttatgggg    111060
     caaacaacga aaacccaatt aaaactggtg atgggggccg tgctggcgga gtttgggcgt    111120
     atagaagtat tgatgcgcta aaagctaaaa cgccaacatt gaaagaatat tgggatgata    111180
     ctgccaaggc gccgtatctt tatagtaagg aaactgggga gttttacaca tatgacaata    111240
     cgcgttcaat tggctataag gcacagtatg taaaagataa taatcttggt gggatgattt    111300
     cttggatgca gtcgcaggat aaaacaacga cttcgactaa gcgcgatgaa cttacgaagg    111360
     ctattaaaac tggattgttc ggtacaagtg caatcccgca aaacgcaatc acatatgcga    111420
     atttaaatgt ggtagcaact gtcaaacctt atagtgaaaa tggcgttgga tacgaaatta    111480
     caattaccaa taatgaaaaa gcggatgaaa caaatgaagt cttgaaatca actgagctat    111540
     cgtttgaaac agtgaaatta cctaagtttt atattccagt aaaagcgggc gaaacgttaa    111600
     ctgctggaga ttataaagca ggtactgtta ctacttcagg tggcaataca gtagttgatt    111660
     tagcttctgt atatgatgca cagcaaattc cgcaaggcgc atcttatact ttccgcttaa    111720
     aatcaagtgc atctagtgtg gatgtagcta acatttctaa aattgattta acacaacgga    111780
     tggtaaaatc gagtgtcgaa tttggtaaac aaactatttt tggcggagga actgttgtac    111840
     ctgatccaag cgatacagaa gctccaacag taccaaaagc actcgcatct tctaatgtaa    111900
     ccgataaatc tgctactcta acgtggacag cttcaacgga caataaagcg gtggctggat    111960
     ataaagtgta ccgaaatggg accgaagttg gctcagtttc aggaactact tttacagata    112020
     gtggcttaac tgcaaaaaca gcgtacactt acacagtaaa agcgtatgat gcggctggaa    112080
     atttctcggc agcaagctcg gccttaactg tgacaacgct tgacgcggca acaccaccag    112140
     caactccagc atgggacgct gccaaaacgt acaataaggg agacagggtt tcttataaag    112200
     ggaaaacata tgaagcacag tggtggactc aaggaaatga gccaggagct gaacagtggg    112260
     ggccttggtt gttaataaat taatagacaa aaacagagat tctttccgga gaatctctgt    112320
     ttttatttga aaaactagcc aaacgtatta caatgaataa aagcgacaag agagggtgca    112380
     gaggaatgta ttttgtatac gatattggtg gaacttttgt gaaatttgcg ttgatggaaa    112440
     ataacggtac ggtgaaaatg aaagataaat tccctacaac tgccaaaagt gcagaagaac    112500
     ttgtagctca aatggtcgaa aagtggcgcc cctataggac agaagtgaag ggcatagctg    112560
     tgagttgtcc gggagtggta gatacggaaa aaggcgtgat ttaccaaggt ggctcgctat    112620
     tatttatgca tgagaaaaat ttggctgaaa tgttagcgcg tgaatgtcat gttcccgttg    112680
     tcttgcaaaa tgatgcgaag agtgcagctt tagcggaact ttggttaggt gtggcaaaaa    112740
     atgtacatag cgcggcgatt ttaacgcttg gaagtggcgt tggtggcgga attattatgg    112800
     atggtaaatt acaatctggt tatcatttga tggcgggaga agttagtttt atggagactt    112860
     cttttgatac gaagaaattg cgaggtacat tctttggaag aactggatca gcggtggagt    112920
     taattaagcg cattgcatca aagaagaatt tacccaataa aaaagacggt gagcacgttt    112980
     tcgaattaat taaccaaggt gatgaagaag cgaatgctat ttttgatgcg tatatttatg    113040
     aattagcatc tcaaatttta aatatccagt atttgattga tccggaaatt attgcaattg    113100
     gtggtggcat tagcgcccaa ccggttgttg ttgaaaggct aaacgatgct gtcgcagaaa    113160
     taaaagcagc taatccttat catgccgcac aaccgaaaat cgtcacttgt catttccaaa    113220
     atgatgcgaa tttgtacgga gcattgtata atttcttttt acaaatggat gcgcaaaata    113280
     aaaggtaact agaatctcta gttacctttt ttctataaag cttgcaacat atcaaactgt    113340
     gattgatata aattatagta atagccgtgc tgtgccatca gttcttcgtg actgccagct    113400
     tcttgaatgc ggccattatc aatgtagaag atgcgcgaac tgtttttgat tgtcgaaagc    113460
     ctgtgcgcga taatgaagga agttcggcct tccagtagtc gctcaagccc ttcttggagt    113520
     aagatttctg tttgtgtatc aatacttgaa gttgcttcat caaggataag gattttcggg    113580
     tcggctaaaa gagcacgggc aaaggaaatc agttgtcgct gaccagctga aagggtgctg    113640
     ccccgctctt tgacttcggt ataataacca tcttttaatc cggaaatgaa atcatgagcg    113700
     cgaacgactt tggctgctgc aataatttct tcttccgtgg catctagctt cccgtagcga    113760
     atattttcga taatcgttcc tgagaaaata aaggtatctt ggagcatgac gcccatttgg    113820
     gacctgagtg atctaagtgt gacttcttcg acattctccc catcaactaa aatttctccg    113880
     gaatttatat tataaaaacg gctgagcaag ttgatgatgg tcgtttttcc tgcaccagtc    113940
     ggaccaacga gcgcaatcga ctcacccgca tccacatgaa agttaattcc ttttaaaatg    114000
     tccacgcctt cctcgtaacg gaaataaaca tctttaaagt caacatttcc aacgattggc    114060
     ggcatcttct tcgcgtttgg tatgtcttta atgtctggct caacatccat cgtttcgaaa    114120
     atccgctcca aataagtcgt tgcggtaata agcgaattgt agaagttacc aatattaata    114180
     acgggattcc aaaaattccc aacataaccg atgaaagcaa tcagtgtccc ggtagaaacg    114240
     tccacaccgt aacctttgat tccaacgaag taaattaaac aagttgtcat tacggcgata    114300
     ttttgaaccc ctggccaaag caagaattga attttcaccg ctttcatcca agagcgacgg    114360
     tactcattac ttacctcggt gaaaatctca aaattctctt cttcccgtga aaaactttgt    114420
     gtcactttaa ttccagcgat gctctcgtgg atataggcgt tcatgttgga ttgtttattg    114480
     cttagaactt gataggcttt tcgttgcgcg gttttaatga ccatgacgat cacgaaaaga    114540
     accgggataa gcgctaaact atacagcgtt aaaactggat caatcatcag cataaagcca    114600
     agcgtaacaa ttacacttaa aatgtcggaa atcagattaa tgagcccatt ggacaacaaa    114660
     tcactgagca tattgatgta attaacgaca cgaatcaaga ttttaccgtg cgggcgactg    114720
     tcgaaataag agaaaggaag cttttgcaaa tgaccgaaaa tcgctgtccg catatctttt    114780
     aaaatgtctt gcccaattaa cgtaattgat ctaatgcggt atcgcataca aagtccagtt    114840
     acaatgacgg aaacaatgaa aataaccgca atccagaata gttgtgtcat gtttttattt    114900
     ggaatcgtat catcaatgac tattttggtt aaatacgggc caatcattgt cgctacattt    114960
     gctaataaga tgacaaagag cgtgatataa atagattttt gatatggttt tacgtaaacg    115020
     agaatacgtt ttaaatgtgc ggcgctgaag gctgtttcca gttcttcgtc aatatcaaat    115080
     ttatttctag ccattcacat tcgcctccgt tccaagttgt ttattgtaaa tatcaaaata    115140
     ataacctttt tctgctagca aactggtgtg tgtacctcgt tcgatgattt cgccatggtt    115200
     taaaattaaa atttcatcgg cttcttttac agaagaaatt cggtgcgcga taataaaggt    115260
     tgtcgtattt tccgtgattt tttttaattc accttggatt ttcacttcgg tttccatatc    115320
     gacagcggaa gtggtatcat ccaaaatcaa aatggatgga ttttttaaaa gagcacgcgc    115380
     taaagatatg cgctgctttt gccctccaga aagtccaaca ccgcgttcgc cgacaatcgt    115440
     gtcataactt tcaggcattg tttcaataaa gtggtccgcg tccgcaattc gtgccatgcg    115500
     ccggacatct tccattgttg catccggagc gccaaatgca atatttcctt caatcgtatc    115560
     agaaaacagg aaaatatctt gcattactgt ggcaatatgg tttctaagtt cccgcacatg    115620
     ccattttcgc gcatcgacac catcaattaa aatttcacca gaagtcggat cgtaaaaccg    115680
     gcaaattaag ttgacgagtg ttgattttcc tgcaccagtt tcacccagaa tagcaatcgt    115740
     ttgtcctgga gatgctttta gtgaaatatt tttgagtacg tccgtgtttg ggtcgtcctc    115800
     gaaatgaaaa ctgacatttt tgaactcgac gtgaccttga agtgatggcg caggtttttc    115860
     agcgtggatg gggattttag cgtcagtcac catcatgtct tgaattttaa acgaagaagc    115920
     gataaagcgt tgaacgtcgt taattagcca gccactcatc cgcatcgggc cgttcagcat    115980
     ccataggaat ccattgaagg caactaaatc tccaagcgtc atttgtcctt taatgactaa    116040
     atagcccccg aaaataagcg tgatgacaac gagcataccc gcgagcgaat cgagcactgg    116100
     caaataggtt ctggaaacat cggcagaatc taaattacgt tttttgaaat cctcattatg    116160
     ttcatggaat ttcttcattt caaaatcttc tcgtgcgaaa gcttttacga cgcgatttcc    116220
     gctaatattt tcttccacca tcgaattaag tcgcgaaaaa ctttcccgaa tttcataaaa    116280
     aactggttgg gctttgctag acattttcat cgttaaaacg gcaataagtg gcgttacgat    116340
     aacaagtgca agcgttaatt tccagtcaat cgtggccata ataataatcg caaaactaaa    116400
     caaaaataca ttttccaaaa tattgtaaga tacccacgaa acaaaatgac gaatcgcatc    116460
     cgtatcacca gtcatccgcg ccataatatc cccaacgcgc gtattattga aaaagtcaaa    116520
     atcgagtgat tgcaactttt tatacaagtc ttcccgaatt cggaacaggg aattttgccc    116580
     gattcgctcg cacataatct gataggtata acggcaaata gttcgaataa ttgtcgagat    116640
     aatcatgatt aatagtaacg ggataagcaa attcgtttta ttttgataga caacatcatc    116700
     aatcactttc ccgccaagta acggataaat aatactaata ccagaagcaa taaaaattaa    116760
     aataaataca ccaatcataa gcaatcgata ttttcggacg tattgccaaa tccatttcat    116820
     actctccatt ttttcacatc ctttaatatt catatatcca tttagtttac actcctaatt    116880
     ttgaaaaaga atggtttata ttcgctgtaa gcatggacaa tgttatataa ttaaaagatg    116940
     aatgtaagcg ttataattag gaggtgaagt gatgctgaaa ataaatacga ccacatttaa    117000
     tccgcaaatt ttgtatatcg ctaattgtta tacgaatgag gtgcgcgtag gtgaaaatca    117060
     ccatcatgat tttttggaaa tctcgattat ttgtgaggga aacgttattt atgatattga    117120
     aggtgagcga gtcaagctag gaaaaggtga tatgctgatt tttaatcctg gcgtgagtca    117180
     ttatgatata accgaaccag gtatgaccaa tgcgcaactc catattggtt ttcggaactt    117240
     tgcactggaa gggtacactc gaaatacgtt cccgtttaaa aaggcctttt tacgaaaaaa    117300
     agaagaagaa tctgccattt tatctatttc caaacaaatt atagaagaaa aagacgcagg    117360
     aaaaccagga tatgacttga ttttaaaggc tttcgtcatg caattaatta tccatgtttt    117420
     acgcgaagcc accccagaac aacttgaaaa taacggcgtc aaattatcta ccgacgaaca    117480
     gcaaaaacag atacttgtaa acgaaattat tcattatatg gaaaaacacc atacagaaga    117540
     cgtctcgctc tcaacgcttt cgcaaacgat gtacattagc cccgcctata tctccaaagt    117600
     atttaaagaa gaaaccgggg aatcgccaat taactatcta atcaaaatcc gccttactcg    117660
     tgcagaagaa ttactgaaga ataaagacgt tagcgtaaaa caggctgcga atatggtcgg    117720
     atacaatgat gcttattatt ttagcaagct tttcaaaaaa tattacggat tcccgccatc    117780
     cgaaaactgg cgcaaatcga gttagaattg caaaaaaaag acagagagaa ggaagactag    117840
     atggattatg aaaaagcctt agcgtttata aaatcaaata gcacattaga acaagaagaa    117900
     ggaaccgaag ttatttttaa acaggcacaa gaaacagctc gagggaattt ggatcctttt    117960
     ttattaaaag acctgaaaca acatcttggc ggtacgaatg atgcgataaa agaagcgccg    118020
     caagaaatcc aaatgccaga tttttctaat ttggaaatag caacggcagc tgcactacaa    118080
     atgcgagcaa caatgggaag tccgaatatt gatttatcaa acggcgtaac tacggagtat    118140
     cgggttgttg aaggtgatta tggcgatatt ccggtacgaa tttatcgtca cgaggaagca    118200
     accaaaccag ttcccgcatt cattttttat catggtggtg gctttgttgg tggaacgcca    118260
     gctgtagtgg agaatttttg taaaggtatc gcggaaaagt taccggcagt tgttattaat    118320
     gtggactatc atttagctcc agaattcccg gcgccagcag ctccaaaaga ttgttaccgg    118380
     gtgcttgaat gggtagtgga acaaagcaac gaacttggca tcgacgcttc gaaaataggt    118440
     gtttccggag atagcgcggg cggaacttta gcagcggcgg taagttatat ggattatgaa    118500
     gcagagacaa attatgtagg atttcaagct ttactttacc cagcgctaac tttagtagat    118560
     gaagataatg ataagtatca gtgggatatt tccaagtttg gggcatccga agatacactt    118620
     ccgctcgttg cgccaggtat cattggaatg aacagctctg gcgaattact gcggaaagcc    118680
     tatgttagag atgaaaatcc cgcagcgcca atttattccc cactatcggc tgtagataaa    118740
     agtatttatc cgcctacact tatagccagt gcggagtttg acgcgttacg agcttttgca    118800
     gatgtttttg ctaaagaact gcgagcaagt ggtgtacaaa caaaagcaat cgtttaccaa    118860
     ggaatgtgcc atgcttttat tgataaatac gggattttcc ctcaagcgga agacgtggca    118920
     gatgaaattg ttcaaatgat gaaagaaata ttttaaagaa taatttgcag gcatttttcg    118980
     aaatgcctgt ttatttttgg actaaatttt gcgattagta ctaaaaatgt attagaatag    119040
     agaggagaaa tgagaaggga tgatgggact catgaaattt cagcttttta ttcaaccaaa    119100
     attagatgtt cttcagggaa atattgtcga atatgaaata cttttacgtg atgatagtgc    119160
     agttcctaga tttcctctat cagaattaga agctgtgctc gcggacgaag aactgtactt    119220
     agctttttcc gagtggttta gcgaggcttt cttagacgtt ttaaagaaat atccaaatga    119280
     tcgatttgcc ataaatattg cgccacaaca gcttttttac atagaaacac tccactggct    119340
     agacaaatta aaaagcgaga gccatcgtat aactgtagaa atgaccgaag atattttcga    119400
     tgtacccggt cataaacgcc accttaatgc gaacgataaa aacgcattta ttctaaataa    119460
     aattaaagtg attcacggtc tcggctacca tatcgccata gacgatgtta gttgcggatt    119520
     gaacagccta gagcgagtga tgagctacct accttacata atagagatta aattctccct    119580
     cattcatttc aaaaatatac cattagaaga tttactatta tttattaagg cttgggcaaa    119640
     ttttgctcag aagaataagc tcgattttgt tgttgaggga attgaaacga aagaaaccat    119700
     gactctacta gaaagtcatg gcgtctcgat ttttcaaggt tatctggtta ataagccgtt    119760
     tccggtttga aaactatcta cttgatcgag tagattctcg tgcgagctaa tggtgatggg    119820
     ctttttggaa agcagtagtc cgctttcccg taattcttct aacacttcag ttactctagc    119880
     tcgactcgaa cgacaataat cagctaagaa cgtttgcgtg acatagactg gaagctcaat    119940
     tgagccttct gtttgatgca aatgaagtag ctcaataatt tccaccaaaa tacgcgttac    120000
     tttgactatg ggtgcttgat taatattctt gtaatttttt gatgtaaata aatatctaac    120060
     aataacttca tcaagtataa gatggaaaaa ttgtggattt gcatataaat aattgagaag    120120
     aaactcgcgg tcaataaata gaacggtacc gttttctaat gcgcgaacac ggtattcagt    120180
     aagttcaggc gctgtttttg tttcgagtaa actttccatt ccaaaaagcg cgtgttgacc    120240
     aatcaacgca tttatcatcc agcggccttc atttgtagga ccttctaaaa cagccgttcc    120300
     ctctaaaata gcacctattt gcggcgcctt ttcttcgtaa tctctatatg aatgaataat    120360
     ttctcctttt ttaaaagaaa ttttacttga ataatcacta gaaaaaatat ctgaaaaatc    120420
     tatcgtgtga agcattatca aaactcctat actaaggtaa aattggtatt taccatatta    120480
     ctgtactgct atttgtgtca aaaagatacc gaataaaaat cgtgttcaca atttagacat    120540
     gaaaaagtca ctttttagca acaattttag tgattttatc aataaaaact tactttttct    120600
     tccctggaga gatatccaac caaaaaaaga ccctccatag ataggagagt ctttcaaaac    120660
     ttcttgtaaa catcaatgga attgccaaaa ttaatgaaat atccaccata atcatacatt    120720
     ggaccatatt tttccgcgta atgagaaact gtatggcgca aaaattcttc tgttacctct    120780
     aaaaactccg ctacttcaaa atattctcgt aagcctagat aaaaacaagc aatgatgtca    120840
     tcaagcggta ttagttcctc ataacctttg cgacgagcga aaatttcttg ttttttatcc    120900
     atgattgttt cctgtttggt gatattacct acagtgtatt tgtaatgcat caattcttct    120960
     actaaaacac agcctttttc aatggaagat tgatccttac taataaaaat catcccattt    121020
     aaataaagtc ccggaagttt gtaaggcatt ttctcttctc tgattgttac ctcatcttgg    121080
     tatttattta ccaatttttc gtacaataaa atcacatccc gcgatggagt tttttcttca    121140
     tctctatata agctaaaata tcccgcattt cttcctcggt tacgtcatca tcaatatggg    121200
     ctgcaattgt taccaagcgt tcatcaacag ggggtaaatt tctttcagga aaaaagtcat    121260
     ctaatcgttt gttgaagatt tttgcaagtt caaataaaac atcttgattt gcttttcgat    121320
     cgccattttc ataacggcta atagtttggc gagttgtatg aagcttttct gctaatgctt    121380
     cttgatttaa gcctcgttcc tcgcgatatt gttttatttt atttcctaca aatttattta    121440
     gctccataat aattgtcctc catatgttta tggcttcagt atagcacttt tagcaccaaa    121500
     acggaacttt ttcgaacata tttgtcggat aaagtttacc agtaaccaaa atggtgctat    121560
     aatatttgta gagctagaaa ataaatgtgg ctgattttgt accgatagca ccaaattggt    121620
     gacaaaacta ctatattaat ttatgagatg gaagtgggaa tggatggata gaaaactttt    121680
     aaaagaaaag caaatccaac taatttttca actagaacaa gaagaaaatc gatttattcg    121740
     aaagcgtttg atagaagagt tggagttttt tgaagcactt ggggataggg aaaaaggact    121800
     tctaacggcg gagcaaaagt tgcttatttt aacacctagt gagtaccgag aatacaaaag    121860
     aaccaaatca gatgtgcaaa ttagtaggat aattggagta tcgagatcgt cacttgcaga    121920
     atggaaacga aaaaaaggtt taaatagaaa aaagtcgcaa ccggttcagc aggaaatgat    121980
     tgatgtatta gcttttcatt tagataaaac aaaagaagaa attggcgctt tacctgcttc    122040
     ggcgattgaa tgtcagtatg aggcttttgt gattaatgaa gccaataatt aaggagtgat    122100
     aaaatgcagg ttttagtttt accagaaaat aaggatatca attatataaa aacggtccaa    122160
     gaagtaaaac gattttttgc ggattttgag cggtttcgga tgattacggg gttatcaaaa    122220
     aagccacatt tacttagaaa tggttttctg gaagagccgc agtttgagcc ggtagcattt    122280
     tctgctagac ataataaaga agtcattttg gaagcgcgat ggttggtaga gaaatatact    122340
     gaaatgttga atcagatgga tgatttatat cgaactattt tgatggaatg ttacgtggaa    122400
     cgaaaacaag atgtggcggt aatgatggat ttaccgtatg aaattgccca gtttaaacgg    122460
     ataaaaaaac gggcagtgct agaacttgca acgctaatgg ggattttagt aaggaaatga    122520
     tgatactttc gtgatatttt gaaacatcat tttcctatta atatagaagt aagctaattg    122580
     tccagtaagc ggatgacaat aaaagctgca tcagaatgaa ggtgcaccga ttttctgata    122640
     atacatgatg ttttacaagg aatttgtttt tatgattgga tttaaatccg ttgagataaa    122700
     caaatattct attttggaaa gtaaagttcg gaggaataaa ttattaaatg tggtcttgac    122760
     cgaactttgc tttctgtttt aaaggagtga acgtttggtg aagagtttga gcttcatgag    122820
     agttttggaa gcagtgagaa caatgctcca ggaaaaaggc ggactagata tttctattgt    122880
     aatgcgtgac caagtggaaa tgcctacaac gatgatcgag atgattgatc aagaggaaga    122940
     agaaagccaa actgcctgga aagaaaaata ccgttttgca atccatcatt atacaaatga    123000
     aacggactta gcgggagtcg aaaagataga tacgcttatc caaacaggat tcactttgcc    123060
     tgaaggatac aaattaatcg ctgttcgaca ttacggaaaa caaaatttag tcaaagaaaa    123120
     tacgttaatt cacgcaaaaa ccagttttga agtaagtatt tgtcgtgaat taaaagtaaa    123180
     aatttagggg gaaatattaa tggcatttga agagaattta tattgtgatt atacaccggg    123240
     agctgctaaa gcggtcgcgg ggaaagatgt aattttagca gtttttaacg cagcggggga    123300
     caaactatta gcggttgcgg gccaacaagg tctaactgta aaccgttcta aagatagcat    123360
     tgaaattaca tctaaagata cagttggcgg atggaaatcc aaaattggcg gtatgaaaga    123420
     atggtcaatt gaaaatgacg gattatatgt cgctgatgca gagtctcaca aagaattggc    123480
     gaaatatttc gaaagtgata gcccggtttg tgtgaaaatc attaatcaag catctaaaaa    123540
     aggtcttttc ggtggtttgg caattgtagc tgactatagt tttgaagcac cttttgacga    123600
     agcgatgact tactctgtaa aactagacgg aatgggcgcg cttgttgatt taacgattac    123660
     tgagggcggc gaccaaatgc ccggcgaaac acctgtagca ccagcagaat aaaatagaaa    123720
     gccactgaaa taagtggctt tcccttagga ggaaaataaa tgtttgaagt gaatgataca    123780
     acttatattt tacgatttaa taaacaaaaa gttaaaacgg tggaattaac atcagggatt    123840
     agtttagttg cagctttgac tgcgaataaa gggattttga gctatcaagt gattgaaacg    123900
     ctatttgttt caggacttgt ggaagaaaaa ggcttagtac ctgtaaaaca aaaagaagct    123960
     ttggagattt tcgacaaatt agtagaagaa caaggcttaa tttcgcttaa tgtagctgtt    124020
     attgagaaat tgcaagagga tatgggtttt ttgttccgtt aaaacagatt gaatttgagt    124080
     attttggtgc tgaggacgaa gaagtggata gtgaaatgaa ccatgatttt gatttggaaa    124140
     aacagttcgc tttttttgta gtcaattttc gaatgtccaa gcatgatttt gaagaactta    124200
     ctgaagtgga gaaaaatttc atcatgaaag aatgggaaaa caaggtgatt tttgaatcta    124260
     ctatgcttcg aaatgcagtt ttaaatgcgg aacaaaatct caatcgaaaa cgaaattccc    124320
     gttttatcga cttgcataaa aaacgtcaga agaaagccga tgttaattat acagtaaatg    124380
     cacttcaagc aatttccgag aatgaagcga aggaaggtaa agcgtggatt gatcggattt    124440
     atggtgcaaa tgggttgcga agacctaaga ataaagaaga aaggaggaac gtgaatggcg    124500
     gattctaaaa gttttacatt tgaactcaac gagagcgttt taacagcgca agttggcagg    124560
     ctagatgaaa tggcgatggt tgtagagcaa cgattttcag agctcaaaat gactattgaa    124620
     gatgttggaa atgctgatcc aggttcgaaa atttccgagt ctttaggtgg gctgcagtct    124680
     gggcttggca cgattagttc ggcgtttgga cagctgggtt ctagtagtga ggcgattaca    124740
     tctggattcg gtactgcggt tggttctgtt ggtggaatca cggatgcgtt taaaaatcta    124800
     ggttcaagtg tgcaaaatgg tacgttattt tcaagcttgg cgactggaat tggtggcatg    124860
     agtacgatgc ttggtggagt atctggcggc gttcaaggaa ttacaaatct agctagtggt    124920
     tttatggagt tgaagaacca tttaggcgga ttaatgtctt ctattggcgg cgttggtgga    124980
     attatgggta aactgacctc tcctatgggg ttagttatta tcggtattgt agcgttagta    125040
     gctgcatttg cgtatttgat gacgacgaat gaatcattcc gaaatacggt gatgtcagtc    125100
     gtaacacagg ttgcgcaact gttcggtcaa cttgtcgcca gtttaatgcc gattatcatg    125160
     caaattgtta ctgcggttat gcaaattggt gccgcgttaa tgccaatggt tatgcaattt    125220
     attagctttt ttgcgcaatt gttagcccaa ttaatgccgt ttattaatat gctgatttcc    125280
     atgcttatgc ctgttattat gcagattgtt caagttgtta tgtcgcttgt ttcggcacta    125340
     ttaccgagca tcatgacagt gattcaaggc attatgagcg ttattcaatt tttaattcca    125400
     ataatcatgc aaattgcgac ggtggttgta caaattgttg taacgattat ttcttatata    125460
     agtaaaatta tgccgattgt aatgacgatt attggcgtta ttgtttcgat tatcacaacg    125520
     attattagtt acgtcgttat tattgcgacg acgattgcta gtgttattgg gaaaattatt    125580
     agctttattg cgagtgttat tacggcggtt atcgggattg tgcaaccaat tattgccttt    125640
     attaccaata tctttacgac tatcgtgaca attattggtg cagctttcca aatggtattt    125700
     actgttgcat ccaaaatttg gaattccatt atgtcgacta tttccggaat tattgacgga    125760
     atcaaagcag tcatcacagg tatttctact acagtttcat cagtgtttaa cggagtgaag    125820
     cgcattatta caggtgtttt tgacggaatc aaaagtgctt ggggtggttt aactgatttt    125880
     gtaggaaata ttttcgatgg tgtttcaagt gcaattcaaa cagtggtaga caatgtcaaa    125940
     ggttttgtaa acgtggtaat tcgagggatt aatggagcca ttggtttaat taataagatt    126000
     ccaggagttg aaatcggcaa aataccgcaa ttaatttccg gaacaacaaa tttccaaggt    126060
     ggctttgctc gaatgaatga aggcggccga ggcgaaatgg ttgttttacc gtcgggttcg    126120
     caagtaattc cgcacgatgc aacgatgaaa tacgcaagag aaagtgcgcg cggaaataaa    126180
     tcaatgcttt acacgagtca aggcgctgat ttggctagag ttgaaaatct tctcgagcgc    126240
     ttactacaaa aaaatcctgt aatcaaaatg gatgacaaag tggtagctga ggtagttagc    126300
     cgtaatcaag ctaactcatt tgatcagtac aactacacaa tgggaggtgc agcttattca    126360
     tgagtgactt gtttttagaa ttaaatggaa aagtgcattc gcttagtgag acatttccag    126420
     gtctttctgt acaagaagtt tcgagacaaa gtccccagtt aagcatggaa actgctgaaa    126480
     tagctgggac tgatggggtt atcccaggaa tgacccaatt taaaccgttt atcttttcag    126540
     caaaatgtaa tttgcaagca cttgatattc cagattatca tttggcagtc agagaaattt    126600
     atgaattttt attccagcgc gatagttatt atatttggag cgatcaaatg ccaggaattc    126660
     ggtatgaggt gcatcctaaa ccagttgatt ttagtcgaga atcggatcgt gttggtttac    126720
     tcactataga atttgatgta tttaaaggtt atgcggagtc acgtggcacg agccttgacc    126780
     ctatgacttt tgaagtggat ttatggcaaa tgggaatgaa tttatcgaac cgtgatgatt    126840
     tattttatat ttttaaagaa aatacatttc gggtctataa tgcggggagc gaccgtgtta    126900
     atccactgat gcggcatgaa ctagatattg cgatgacggc gaatgggaca ccaacgattc    126960
     ataatcttac aacgggagaa tccttcgagt atcagaaaga gctccgaaaa acagatgttt    127020
     tactgttgaa caatatttat ccacttgtta ataaccgccg tgttggaaaa gataccaatc    127080
     atgggattat cacccttgaa aaaggctgga acgattttga aatcaaaggt gtaacggatg    127140
     taacgattgc ttttaatttt ccgttcattt atcggtaggt gatagatatg gattatgtga    127200
     ttattcaaag tatggacaaa gaagtggaag agattcttac agacatagat tacggctcct    127260
     tttcctacga ttatgaaaaa aatacaagtc gtgctatttc gtttactgtg aacaaaacga    127320
     aacagaatgc agcaattttt gacttggtag gaaatgaagc aattttaaca tatcaagggc    127380
     agcaatttgt tattaaaaaa tgtacgccaa aatctattgg aggaacactt tcaaagcaga    127440
     ttacggccca gcatatttgt tatacagtgc aagatcatgt gcagtataac gtgaaatctg    127500
     gacgaaaaaa atattcgatt caaacggtat tggaatttgc gttacaagat aatgtactag    127560
     gattttctta tgaaattcaa gggagttttc ctttagttga attagaggac ttaggaaata    127620
     aaaatggctt agagctagtg aatttatgtt tggaagaatt cggagcaatt ttatttgcag    127680
     ataataaaaa gctttatttt tacgatgaaa aaagctggta tgtaaagaca gagaagcaat    127740
     ttcgttattt atataataca gaagaagttt cggtggatac gaacacagac aatttgaaga    127800
     cggagataaa atgttacggc aagcaaaaag agaatgccga taagctgact ggagataata    127860
     agtacatggc ggttgtcacg tatacttcgc cgaatgaggc tatttacggg aaacgaatgg    127920
     caaatgctaa aagtgatgat aaaatcacga acaatgatga cttattaatt tttgcaaaga    127980
     agcaaattct agatgttcca gaaacagcgc ttactatttc ttacaaagga aaagaacctg    128040
     tttcagagcg ggatgtttgg tatttcattc atgaaccgat ggggtttgaa acagaagtaa    128100
     aagtaacgaa aattaaatcg agtcatcctt ggagtaagaa gtttcaagaa attggcttca    128160
     gtaattcgcg acgggatatg gtccgaattc aaacacaaat tgctaatcaa gtgaaaaaag    128220
     cgagcgtgga tacaaataaa atcaattcgt tttcgagcat cgcaatgaat gcttatgatt    128280
     cacgaatttt aacggaagta gtaggtgtgg tagatggcga ctgaaattag agtgttaaaa    128340
     aatgtagatg atacagtttt ctatccgaag acacatgtaa cggctgtgga aggtttggac    128400
     tcggctacaa ctactacatc tggattaatg ccggccagcg acaaaacgaa attaaatgga    128460
     atcgaagcta atgcagaaaa aaacaatgtg actgcaatcg atattgccaa ttggaataaa    128520
     aaacaggacg caattttggt ttctgaaaat ggttctaatt tcaaaataac tgtcacaaat    128580
     gctggtgaac taaaggcaac aaaagtggaa taggaaggag gttgcgtatg aagttggatt    128640
     tatggaaatg ggaaatgctt cttcaaggtc gagaatttag aaataaaaca aatgacaact    128700
     ggcaaaaatt gatggattgg tccgatttta tttcaacagg tttaagcgcg atttatgtct    128760
     atgtaaataa agcggatgct accttaaata acaaaattga taccgtggat aaagcagtaa    128820
     atgcaagggt taatgagctg attagcggga cagagcagct aagtgaagtg gttgatgcga    128880
     gatcagatgc gtttggtgca cgatatcctg tgctaagaga acgtttaaac caagaacagc    128940
     ttaactttag caaaaagagc acgattcaat ttgatgcgag tactatcata agtatggaaa    129000
     aacaagatat tgggctgcta acaagtaaaa aaatctcaga agcgcaaacc gtatgttttt    129060
     taaatatatc aagcctcgat gaagaagcag atattgttct tgaaaaaaca ggtgagacaa    129120
     gcttctcaga caatttaacg agcctagtct ttgcgaaaat tggaacgaat gaacgctacc    129180
     aaatggagcc agttggtgca taaaggagga gtgagcgatg actgaaataa agcgaatgct    129240
     acagacaaaa gaagataatt caaaagaaca attttatcca gagacgcatg ttgcggggat    129300
     tgtcgggttg acagaatatg tgtcaggtca gcttccgaca ggtgtggtta gtgtgaatgg    129360
     taaggcaggt cgcgtgttac tggatgctga agacgttcac gctgcaaaaa aaagccacac    129420
     ccatgaagtc gcaacataca ctacggatgg ctttatgagt tcttttgata aacaaaagat    129480
     tgatcaatta gtttcaccgg aagctggcgt gacaagcata aatggtaaaa cagggattgt    129540
     tgatttattc gcatcggact tagatgcagc agagataaac cacacgcatg cagaagcaac    129600
     tactacagaa agcggttttt tatcaatcga cgacaaagaa aaattagatg cgatacaagt    129660
     aatcgcgctg gaaactatta aggaggttat agaatgacta aaattgtaaa aatgtcagag    129720
     aagaatgaac atggaactct agaacaattc tatccagaaa cacatgcaga ggctgttaaa    129780
     ggacttgtgt cggtttcaga ggaagagaaa acaatttggg atcaaaagga aagtacggcg    129840
     ggtgcagagc aaaaagcaaa cacagcctta aatagtgcta aagattatgt ggatacgata    129900
     ggtgaaggaa cggtgatttt taaaggcgct aaccttatgg gagctggcca atcatttaaa    129960
     tgggacgctt ctaaactgaa atttgggatg actttgttat ttagtcgcta tgatgcggca    130020
     aataatacac cgcaagatta ttattatcat tctgtattct tatctaaggc acaattagtt    130080
     gagcttgcag gaaaaggtat tttagttcaa atgccatcaa cgacttatgg agatcgaaaa    130140
     tatctgtatg tttcaacaac tgggttatct ggacattttg ataattcgaa ttatgcggct    130200
     tgggctcttc gccaagtaac aattatgtaa ctaaaaagga ggttttccat ggaagtcata    130260
     ctaaaattcg ggattttagg ttttggcgcg atatttggat acttgtttgg ggaagtggat    130320
     ttattggtaa aagtgctggt gtgctttatt gtagctgact atatttctgg gctactcgct    130380
     tcagggtatc ttggggaact tagcagcaaa atgggtttca aaggaatcgc gaaaaaaatc    130440
     gctatcttaa ttttagtggc tattgcgcat caaatagatt tgattctggg aacgcataat    130500
     acaacgcggg atgcggttat ctttttctat ttagcgaatg agctgatttc tatcttggaa    130560
     aatttcgttc gaatgggaat gaaggtcccg gaagtattga aaaatttaat tttgattttc    130620
     gatgcaaagt caggagagga tgaggaaaaa catgacaaag atatggattg acgctggaca    130680
     cggtggtaag gattcaggtg cgagtggtaa tggacttgtt gaaaaaaatt gggtactaac    130740
     tgtagcaaaa caacttcaaa cagagttagt taaagccggt tttgaagtgg gaatgacaag    130800
     aacaaatgat acattctatg aattaagtga tcgtgcgaag aaggcgaata gttttaaagc    130860
     tgatttattt atttcgcttc attttaatgc tggtggcggt aaaggatatg aagattatat    130920
     ttacacatcc gtcccggctg caacggtaga aatacagaaa ataattcata aaaatattat    130980
     tactaaagtt actaaacacg gaatgaatga tcgtggaatg aagaaagcta atttcgctgt    131040
     attaagagaa acagcaatgg atgctatctt acttgaagct ggattttgcg atagcactga    131100
     tgcattaatt cttgagaaga aagcttatca aactgattat tgtttaggaa ttgtatcagc    131160
     agtacaagag atttttgggg ctatggtaac aaaatatagg gcaggcaaat atttgacaag    131220
     tgacgatgct atatcaggca caaatattaa aggatattta gaagcaggaa caaaggtttt    131280
     tgtttataaa gaaacagaaa aaacgcttaa tttaactact acaaagggtg ttccaggaag    131340
     ctgggtttta aaaacagaag ttaatacagg aaaaagataa aaaaaggagc ggccaatttg    131400
     gctgctcctt tttctcaatt aacttctctt ccgcaaaaca taaagcgcag tagttgttaa    131460
     aataacacca aatacagttg ccaatccagc tgtatcacca gttgttggta aggaagtatt    131520
     ggaagaagtt cctgttgttg atgtgtttga tgtcgtagtt gtaggatctt cggtagtagt    131580
     agttccgccg tttgtgccgg atccgttacc gttgtttgtt ccaccattac catccgttcc    131640
     tccgttattt ccgtttccat taccattgtc cgtgccgccg tttccattat ctggaggagt    131700
     cgttgccgca gcttgaaccg ttgcttggaa agtggtgctg tatccgttcg ggtcagtgat    131760
     agttgttgtg atttggtcgc cttttttaag gtttaaagat gttacatcta cggaaaactt    131820
     gccatttgcg tcagctgttg cgttaggtcc ggcagcaagc gccattcttg cgttagcagt    131880
     tgccttttga acggaaactg tagctcctgg taaagtagtt ccagttagag ttttgtcttt    131940
     ttcggctagt ttgttgattt ttgttgcttc tttgatggct ttgatagctg catctttggt    132000
     ttctttgtcg atttcagctt gggatttgta gactttacgt ccttcttttt gagctgtaat    132060
     gacttttcca gcagcttttt ggtctttgat gtagttgatg aatgtttcag tatctgggtc    132120
     gattgcagtt actagatttg cttttttgaa ggctgagaat ccgtcgccgc cgccaaatag    132180
     gaagtcattg attacgactt tgtatttttg gtcagttttt aaaggagttc cgtcttctgt    132240
     tgtaacgctc gcaactttgt acgcgtgatc caagtcatct gtatctgtga aagtgtattt    132300
     tagtccagaa atttgtagga agtaagtttg gttgcttaaa tattgttggt ttagagcttc    132360
     caaaatatca gcaccagtca tttcgactac ttgaagaatg ttaccaaatg gttgaacagc    132420
     ttgagccgcg ccccatgtga tttcgttttg gccatttgca agacgagtag taaggtcaga    132480
     acgaattccg ccgttgttag tcatagcaaa gtcgacatcg gcgccggctt tatttgccat    132540
     gtaacgttgc gcatccgtaa tcatattacc aagctctgat tctttatcat caattgcttt    132600
     gttatctgga ttggtgtcac gagaaataac gtctttattc gctagtccga tagtttcgtt    132660
     gataacccct tcaatgcggc ttttcgcatc ttcagttact gctgtaatat cggcatttgg    132720
     tgtgacgctt ctcgtgttgt atgtaatttt agcgtcaggt ggtgaaacga aatcgccagt    132780
     tgttttatcg agttcgccag ttacatctga aaaagcttta ccattgttgt aactttggac    132840
     gatacgagtt tttccaacta atccatttgt gtattggtga ttgtgaccag caaggactaa    132900
     atcgaccgag ttatttgggt ctaattcgtt tgcttttgtc atcatattgg cagcttcgcc    132960
     agctacatct tgttttgttc cagtatttgg atttccagta gaaagtgcgg gaacgtgaga    133020
     taaaacaacg attgcgttaa cgccttggcc tctaagttca gcagagtatt tgacgattgt    133080
     ttctgcttcg tcaaggaaat cgtagtcttt aatatgattc gcaagaacta agttaggaat    133140
     ttctgttgta acgataccga tgaagccaac tttgacgcca tcaatttctt ttacatagta    133200
     tggtaaaaag ccttctgcga ctgtgtttgt tcctttgttg acaacgttag ctgcgacgat    133260
     tttcatgtca cttttaacgc gtggataagc ttctacgatt ggtccgaatt tgtttgtaga    133320
     aactccgtcc aaaattcgtt tgtattctgg taatccttca tcaaactcat ggttacctaa    133380
     tgtgccgact tcgaaattca ttttttggag aactttcatc gttggctcgt cttgaagtaa    133440
     acctgatact gctggacttg cgccgaccat gtcgcccgct tgaacacgga tagcattgtc    133500
     agttgtcgcc ccaggatttg cctgtaaaaa tgagttagtg gcattgtcca aattggtagc    133560
     taagtaatct gctccgccaa ttggtgagcc tgatgcatct ttagaggctg tttcaagcgc    133620
     tccgtggaaa tcatttattc ccaaaatctg aatgggaacg gtatccgctg ctgcttgtgc    133680
     tgttgtcccg gtgaatggtg ctgtaagtcc gattgtgagc cctgctacga gtaaaacatg    133740
     tgtagttttc ttgaaaaatt tgttcacttt cacactctcc cttttttcgc cagtggcaat    133800
     tttgtaagcg ctaactcata ggtgcctagc tataattgta gcaaagtgga atcaccctag    133860
     caataggaaa tatggatttt gtgtaaatgt aatgataaaa tttggctata ttttcatttc    133920
     gatggaaaaa agggtaaact agagaaaaag gagggataag atggatatct cgagcacgga    133980
     aatatgggat gcgattagga gaaatagtta cttactttat tatcaaccaa aagtagacgc    134040
     gaaaacaaat aaaatcatcg gttttgaagg tttagttcga ctaaaaactg cgacgactat    134100
     tctagctcca attgatttct ttgatgatat tgtcctttta aatgcaacga gggaaatgca    134160
     agattttgtt gctgaaacag cgataaagca aattaaccag ttaggtggac gtttttctat    134220
     ttctattaac attccggcgc attatgtagc aagcagcacg tatatgactt ttttacatga    134280
     ttatgtgaaa gaacatttaa agtatccaga atgcctagaa atagagatta tcgaacgggg    134340
     ggaaataacg gaacttgcta tcgcggataa aaacttacga aaaataaaag accttggtgt    134400
     caaagtgagt atggatgatt ttggaaaagg ttatagctcg cttgcgtatt tgcgtagctt    134460
     accgattgat attgtgaaaa cagatatgtc atttatcgcg cttttaaaaa cagatcgaaa    134520
     acaacaaatt attattcgcg caattgtcaa tttgtgtcat gatttaggcg ggaaagtagt    134580
     tacagaaggt gtagaagaca tggagcaagt ggaaaaatta cgggaaatga aagtggacta    134640
     tttccaaggt tattatttta gccgtccgct cccaatggaa gaaattaaac aaaagtattc    134700
     cattgtatga gccggataaa tagaaaaaat tggttggtgt gagaatggta atttaccaaa    134760
     ttcacaccaa ccaattttat tttatttgat taaattgttc gaagcatctt tcacaacaac    134820
     gtcatgtgcg ccgccttcta cgatagaagt ggatgaaacg agtgtaattt ttgctttttg    134880
     ttgtaattca gggatattga gcgcgccgca gttacacatt gtagagcgga ctttgctaag    134940
     gctgattgca acattgtctt tcaaagatcc agcgtaagga acataagaat ctacgccttc    135000
     ttcaaaagat aatttcttgt cgcctccaag gtcataacgt tgccagttgc gcgcgcggtt    135060
     agctccttcg ccccaatatt ctttcatata cgtaccattt aaattcactt tgttagtagg    135120
     gctttcgtca aaacgggaga agtaacggcc aagcatgatg aagtccgcac ccattgctag    135180
     agctagcgtc atatggtagt cgtacacaat tccaccatca gaacaaatcg gaatatacac    135240
     accagtttct tcaaaatatt catcgcgggc tttagcaacg tcaattaagg cagttgcttg    135300
     gccgcggccg atgccttttt gttcacgcgt gatacagatt gaaccaccac caacaccgac    135360
     tttaacgaaa tcagcaccag cttcggcaag ataacggaaa ccatcgcggt caacaacatt    135420
     tcctgcgcca actttgacag tatcgccgta tttgccgcga acgtaatcaa gtgtgcgttt    135480
     ttgccattcg gagtagcctt ccgaggaatc aatacacaga atatctgcgc cagcttctac    135540
     aagagcggga acacgttctt catagtcgcg cgtgttaata ccagctccaa caacgtaacg    135600
     tttcgaggaa tcaagtagtt ctaatttgtt ttctttatta gagtcatagt ctttgcggaa    135660
     caccatatga accaagtgct cgttatcgtc tacaagtggt agggcattta atttgttgtc    135720
     ccaaataatg ttgttagctt cttttaaagt ggtcgatttg ttagcagtaa ctaatttttc    135780
     gaaaggagtc atgaaatctg ctactttttc atcagggctc atgcgcgtta cgcggtagtc    135840
     gcgacttgtc acgattccta gtaatttacc gtgcgctgtg ccgtcttctg taactgccac    135900
     tgtagaatga cccgtttttt cttttaaatc aaggatgtct tgaagtgttt tgtcagggct    135960
     gatgttggaa tcactaataa cgaaaccagc tttatgattt ttcacgcgag aaaccattgc    136020
     tgcttcactt tcgatggact gggagccgaa aatgaaagat acgccacctt ctgtagcaag    136080
     agcgatcccc atattatcat cggaaacagc ttgcataatt gcggaaacaa gcggaatgtt    136140
     cattgtgatt gcagattctt cacccttttt aaattttacg attggtgttt ttaagctaac    136200
     atttgttgga acacattcag cggatgagta gcctggaaca agtaaaaatt cactaaatgt    136260
     gcgggacggt tcttcaaaat aaaatgccat tatttccact ccttcttcta tttttaaatg    136320
     aatttataaa atatctttat tatttcaata actggcagga aagtcaatga ttgggggagc    136380
     ttttttagga atgtttctgg acgttttctt ttggttgatg agtggaatag atggaaggta    136440
     gagaaacttt ggcgaaggag gtaatcagat ggacgaggaa acgctgcttg agcgaggcta    136500
     ccgtaagtat cgcggggcgg atgtagatat ttattttaat acaaatgttt gcgagcattc    136560
     gggtaattgt gtaaaaggta acgtagaact gtttaatttg gaccgaaaac cgtggattat    136620
     gccggataat gtatcgaaag aagaggcgaa gcgggtgatt catacttgcc caagtggagc    136680
     acttcaatat atcgagaaat aggaggagat taaatggaat ataaaaatgg tgaaaataga    136740
     atttatgctg taaatgatga aggagtagag gttggcgaag tgacttttgt gccaactggg    136800
     gaagatatgt ttattattga ccatactggc gtggatgatg cggctcgtgg tcaaggaata    136860
     gcccaagaac tcgtgaaacg tgcggttgaa aaagcaaaat cagaagggaa gaaaattgtt    136920
     ccgctttgtc catttgcaaa agctgagttt tctaagaagc cggaatatca agaagtagaa    136980
     gcatctaaat aacaagcgta gactgggttt tctgcccggt ctattttttt ataaaataat    137040
     ttttgggatt tcagttttct cttcttgaca tctgctttgt ttcagtgtat ctttaattca    137100
     cagtaaactt ataggaataa tagtattacg ttttcttatc aagagtggtg gagggaatcg    137160
     gcccagtgaa acccagcagc ggagcgcaag ttctatgcta attccgatca gaagtaatat    137220
     tctggcagat aagtagtagc tttcaatgag gtgcttcgat tctgaccaaa aaacagagga    137280
     agcgttattt ttttagcgct taaagagggg agtttttgtt agatgaagaa atttttatta    137340
     gtagcggtta tctcggtttt tgccttggtg ttaacggctt gcggaggttc tggcgctagt    137400
     tcagacaaag caaacggttc aggcaaagcg aaagacggcg gctctcttat tatcggagtt    137460
     acaggagatc cagaagttat caatccgaac tacgcttctg accgtgtaac attaacgatt    137520
     caacaagctg tatacgcacc gctattttgg gaagttgacg ggaaaccggc acttgcaaaa    137580
     agcttagata tttcagatga caacttaact tacactgtga aactaaaaga tggtttaact    137640
     tggcacgacg gcaaaccttt aactgcagac gatgtagtat ttactgtaaa ttctatttta    137700
     gatacaaaac aaaacagtcc gaaccgcggc aactttgttt ttgacgataa acctgtaaaa    137760
     gtagaagcag tagacgacac aacggtgaaa ttcactttac caactgttgc tccagccttt    137820
     gaaaatacaa ttaaaacttt cttcccaatt ccaaaacaca tttttgaagg ggtagaaaac    137880
     atcgagaaaa gtgataaaaa caaaaatcca atcggctcag gtccgtacaa atttgttgaa    137940
     tacaaaacag gcgaatacgt ttccttagaa agattcaacg actactttga cggcaaacca    138000
     aaattggata aagttacttt ccgaatcaca aaagaccaaa acgcagctaa tttagccctg    138060
     caaaatggtg aaatcaactt aaaatccatt caaccttctg atagaaacaa agtagagaaa    138120
     gcgagcgcgg taaacattat cacttaccca gaaaatcgct taagctatgc gacattcaac    138180
     gaaaaccaac cagcacttaa atcaaaagaa cttcgccaag ccctttctta tgcgcttgac    138240
     cgtgaagaaa tcattgatgc ggcttacggt tcagatgaat acgcaaaacc agcttcctcg    138300
     ttcctgacag aaaacacaaa atacttcacg gataaagtag aaacatacga tcaagacatt    138360
     gccaaagcga aaaaattagt aaaagaaagt ggttttgata caagtcaaaa actaactgtt    138420
     tactatttaa acaacagtaa atcacaagaa agtatcgcgc tttacttgca acaacaatac    138480
     aaagaaatcg gcgtgacact tgacttgaaa ccaacagatc caaatgcact aagcaacatc    138540
     acacttgacc gtaaaaacgc agactactct atcgcactaa atggttatat catggggaac    138600
     gatcctgatg cgtataaatc cctataccta agcgatgcgc catacaacta ctcgaactac    138660
     cacaacaaag atctagatgc actttgggaa aaaggtgctg taacagctga cgacaaagaa    138720
     cgtcaagaaa tctatgaaaa aatccaaaac acaattgctg atgacgctgt aatttatcca    138780
     atttcttatg ataatgcagt gctagctctt gatagccgtt acggtggaca aaaagctgca    138840
     acaccacaac cagtaacaat gttccgtgat ctttctaaat tatatttaac ggaataataa    138900
     ttaaaaatca ttcgtgaaaa atctggcctg ccatgcttgt ttttggcagg ttcagatttt    138960
     tacttgtcat ttttagtgtt ttagatagga gataaattat gctaaaaaca atcataaaac    139020
     gcgtattgca aattattccg atgctattta ttatctcgat tatttcgttt gcccttatca    139080
     aattagcacc cggggatccc gtgaattcct ttgttacgcc tgatatgaat cctgacgatg    139140
     tagagcggat tagacaaagc ttagggctgg atcaaccaat ttatgtacaa tattttattt    139200
     ggcttggaaa cttgttgcaa gggaatcttg gttattcgat tgtgaatagc cagccagttt    139260
     tgcaacaaat tttagagaga attccggcga cacttggttt ggtgggaact tcgcttgttc    139320
     tgacgctatt attatcgatt ccacttggtt tagttgcggc gaattatgaa aatacgtgga    139380
     ttgataaagt gttaaacggg atttcttata tagggatttc gattccgatt ttttggtttg    139440
     ggatgatttt aatagatgta ttttcaattc agctaggttg gcttccgagt ttaggaatgc    139500
     gaacgattgg ggtcgactct ttttgggata tggcggagca tgcaattttg ccggttataa    139560
     ctctgacttt ccaagggtgc gcggcatact atcgctacgt ccgctcgaat accatcaacc    139620
     aattaaaaga agaatatgtt ttgtttggtt atgcgaaagg tctatccaaa gtgcaaatta    139680
     tggggcatca tgtcttgaaa aattccttgc taccagttat aacactactt gggatgtcac    139740
     ttccgcaagt cattacaggc gcttttatta ccgaaagtat tttttcatgg ccgggcatgg    139800
     gctcgcttgg aattaatgcg atttttcaac tagattatcc ggttattatg gcgattacgc    139860
     tattttcagc gctgttatta attatcggaa acttgctggc cgatttagct tatatgattg    139920
     tcgatccgcg gattagggaa atggggtgag gaattcatga tgcgattaga tttttcgaaa    139980
     aaaacaatgc aagatttcga gcgggatgca gaagtcgttc acgcaacacg agagcggagt    140040
     ttttggcgct ttatgcttgc tgaccgccgc gctgtttttg cgacgagtgt gctgatactt    140100
     attacggtgg cttgtatttt tgcgttcctt tcgccttatg accctaatgc tctttccgtt    140160
     caggacaaac tgatgccgcc aaattcgtcg cactggtttg ggacggatga ccatggtcgg    140220
     gattacttga cgcgtgtctt gtacggtggc cgggtttcgc tacttgtcgg tgtgtttgcg    140280
     atgatgattg ccgttgtcgt tggaacgctc gctgggacag ttagtggcta ctttggtggc    140340
     ttcattgaca atatagtgat gcgttttctt gacattttca tgtcgattcc gtcatttttc    140400
     ctactaatga ttttaaatgc atacttaaaa ccgggaattt cgaacattat tatcattatc    140460
     ggattgcttt cttggatgga agtggcgcgg atagttcgag cggagacgtt aacattaaaa    140520
     gaacgtgaat tcattttata ctccaagtca tcaggtggcg gatttttcca catcatgttc    140580
     aagcacatta ttccaaacgc gatgccatcg attgttgttg cagcttcatt aaacgtcgct    140640
     acagccattt taaccgagtc agcactaagt ttccttggcc tcggcgttca acagcctaac    140700
     gcttcgtggg gcagcatgct gaacaatgcg caaggttacg tcggcgaagc aacttacttg    140760
     gcgcttttcc ccggattatt aattttaatg acgattcttt catttaacgt acttggcgac    140820
     gtgctgagaa aaggtttgtc acgtagatat taaatttgaa agcactttga tttttagtca    140880
     aagtgttttt ttgtttttta aagaaaatgt acttaaaata gaagcgtaaa aaacgtgttt    140940
     cagccaattt tcaaaggata aattcacaaa acgctcacaa aataagaatg cgtgcgatgc    141000
     tataattaag ggataaggtt tcattattat agacagagat gaggcgcaga aatgagtgaa    141060
     ataaaagtta aagaagcaac attagcaaag tacgcaacaa agttagagtc taaagggaaa    141120
     tcaaccgaat atttaccgat gaaaggtggc aatatgtcct atagccaagc caattccatc    141180
     aaccattttc gaacagcact gtttgatttg gtagacgcgg tggacaattt tcaaggtgtg    141240
     gtaggaacgg atgccaaaag attgaaagaa ttaggcgcat catttactcg caaagaccaa    141300
     gagcttgaac ggagcatggg attggggggt aaataaatgg atgcaaagag ccagcaagcg    141360
     gaggcgcaat tgcaactgct gaaaaaagaa caatccgcgg ccaaagattt tttgcaagat    141420
     ttgcaacgac aacaaaatga acaagagtgg ttagcggaag atgttgcacg tgttcaccaa    141480
     gaagagcggg agtcgctgga gcttttgcgc gaagtttggc aaggcgcaga atcaagaagt    141540
     ttcggctact atttggcaga tctacaggaa gaagaaaaac agaagtggca taaaaaaatc    141600
     caagcaaatg aagaggaatg ccaacaaaaa atcaccgctt gccgaaaaaa catctaccaa    141660
     ttagaaaatc aacaacaaga tttacaaaag gagttgttac agtgagccga attgacatcg    141720
     gagaaataca aacctttgcg tatcaactac atacagccaa tgaagcagcg agaaaaagca    141780
     ttaaagacat caaaaatgcc gtgaaaaact ataccgaaga tggcagttta aagggaaaag    141840
     cgattgacgc gtcaaaaaat tattaccaaa tgacctattt tcctttgtgt gatgcgataa    141900
     tcgaagccat gaacgaaagc gaagaaagat tagcgcaata tatagctgat tttcacgccc    141960
     aagtggatag ttcggctgat gcgagaattg atgcggacgg cttatacgaa ctcgggaaaa    142020
     tgattgatcg catcgaagct aaaaaagaag cgctggccca gcggatgaat actggaacgg    142080
     aaggacagat gcagagctac cgttcccagc taagtatcgc ctacaaacaa gaaaatattt    142140
     tagaaaaata cttggctttt gaacaaagtc atggcggctt ttttgataat ttaacggatc    142200
     tagtccgagg aattcagcaa accattcgcg aactccagtc gaacattcaa tttaacagta    142260
     aaacgggcac ctatgatatg agcaagctga atttcaccac cgtgacccgg atgcaaaacg    142320
     cctcaggaaa agcattaaac gacaacgcaa aaacattcaa ttttgacgaa tatcaaaaaa    142380
     cgtatcgtgg tcaaatgtgg gtgttaatga aaaatggtat agtagacgta gaagcaacga    142440
     acgcgtacaa tgccgccgtg ctcggtgggg aaatgccgca tgaaagcaat gaagcgcaag    142500
     aagaagctga gttgttacag gcagttgttc aatcggtaaa agaaggaact gacccggtta    142560
     ctggacaaga gataagtaaa gcgcaaggat ttggtattat aagtggtctt attttccgct    142620
     atactgctgg aggttataaa gggaagaagt tcaagattcc tagggattgg ttacacagaa    142680
     ggaagaaaaa taatggcgta gaagttggaa cggactttgg gaagataggt aaattagtta    142740
     atcatcctaa tattaaaata aattggtctg aatacgccga acatggaatg tctagattga    142800
     aacaacgtgg tctttccaag agtcaagttg acgattttgt ggagcatgga aaagttttat    142860
     cccaaaatga aggagaaaaa tttgctttta taacagaaga cggtgttgca attgtcagca    142920
     aagatggcaa attagttact gcttggggta aaaaagattt tgatgaagga atgaaaaaaa    142980
     taataggaaa attgtatgga aagtagggtg tcattatgta tgaaaaagta gaaaaaataa    143040
     taaatgattg ggatccaata gagctgtttc ccttagctcc aaaagatgaa tatagtcaag    143100
     aaatcaacaa aataattagt attgttcaag aaaatcctaa cattgatatg aatgtattag    143160
     gtaaaggtat aagaaaaatt ttcatagatt cgtttggaga aaatttaata tttaaaaata    143220
     acgaagatga aatagctgaa aaaattttag cgctataatt tttgataata attaggattt    143280
     tgctataact ggttagaact tactatctgt tttaaactat gaaaaataaa tttaacacta    143340
     gaacaagata aaaggaatga attaaatgat taatagtagg ttttatgaag gttttgaagg    143400
     agaagcagag ctttccttcg ttgctggtga taataaactt ttaatttgga acggttattt    143460
     tgagactatt ttagataact tattagattg taatgtagaa agagagggag ttctgaaaga    143520
     atattttaat catgagggat ggtatgatga ttcaccgtgg atgattgaag ataactctct    143580
     taccattatt caattaaaat gttttgatat taacaaaatc aatcagactt ccatgaaaga    143640
     tgatttagag gaagtagtta aaacaattat ttcatttttg gaaaataatc gatttagtaa    143700
     aatctatatt gaatacgaat aataataaaa gatattctac cactaaattg ggcaatagaa    143760
     ttgaatggga aaaagcaata tctgctaaga aaaggtgaag tatgctagaa caagataaaa    143820
     tgttaacaga tggacattgt gaaggatagg aaaggttgga agataaaata tggataattg    143880
     ttataaaggt ttcgaaggat atccagaaat tgattcttat acttacatag gtgataaaaa    143940
     ataggtatat aaaggcggga aaatacaata gacttaaaag aaaacatgaa tattgtgctg    144000
     tctgaaagaa aaaaattaca tatgaatgat gattatggta ttgaaaaatg tttgagtaaa    144060
     atgacagcac ttttgtctag ggatgaggat accacaatga aatatttaga aaattgcgat    144120
     gcggataatt tatattggat aagtgaaatc tttgaagata tttctgccaa tttgaaaagt    144180
     caaaagttta ttgattactt gagaaaactg gataagaaat ttccagagtt agaaatgacg    144240
     caagatattg atattgctga aagttatttt taaagataca tctgtaatta ttgatgataa    144300
     aataaattgt tcaaatcagt gataagtttg ataaaaattg ggctccctat gcaggaatag    144360
     ttgattctta taaacataaa tgagggaaat aataagatgg aagaacaaga gatcattgaa    144420
     aaagtagaaa tcttaccaaa taattttagt gaaaatgaca gtatttatat atcacaagaa    144480
     aacattaaaa atttggtttt attttcaaaa gaaaatcaaa cagttttaga attgttgatt    144540
     actccttttc taatttgtgt aaatagtggg ttaaaatatg agttacatta ttatgaaatt    144600
     tcaacagaaa ttagtaaaaa tgatacagaa atcataggtt ttccttttgg aaataagcta    144660
     ccaaaagaaa ttacagataa tatttctcct aaactttttg taagaagaga agattattca    144720
     gcttttgaga attttttaag tcagtatttt aatgcaatga agagcatggg atttgcagat    144780
     gataaacagg ctataggtat gattgaacat ggtgcaacct tattctacga agtattataa    144840
     ttttagattc taaagagcta gtattgtcat taaatggtca gagataatga attcattatc    144900
     tctgaccatt tttgaaatat atctttaaaa ctttttagca acagaaagga taataaattt    144960
     cgtacataaa aacgataaac tttcccgccc caagaaagcc agttgagctg atatagcggc    145020
     tgatgtagct aaaagtaaag gcggcgttac tttagaatca acaataggaa ataaaaatat    145080
     tgaaatgcca gactgggatt ttaataatcc tgagtcaatg aaagcatggg atttggcttc    145140
     tggttcttat gcagaacaag tttctgggtg aagttcgtgc agtagttggt tcagatttga    145200
     gaaaagtaaa tatttgggga aatgctgagt aacctagatt aaaaaataat cctaacgtaa    145260
     cgaaaataac aacgattgtt cctaaaacag gacttgaaaa aatttttttg aaaggaagta    145320
     agtgaaataa aaattacagg tagtagttca catgtgaaat ttgatttaga gaatggatat    145380
     gtagtgaaag cagatggaga aatgttagtt ggaggtaaat ttgttgtatt taaagattct    145440
     atgaagaatt gggaacctcc atatgaaaat aaaaagcttt ctgaatctga agtgcaagaa    145500
     attattcaac aggtaaaaca gagcacaaat gaaaatacag tacaaatttc atttgaataa    145560
     aagaaatgcg agaagtggag taggtttgaa agaacaaatt caaatatcaa tgcaaacggt    145620
     gggcatgtta tgctgaaaag gctcgaggga caagtcaagg tactagctat ttcgtgagtt    145680
     cctcgggcaa aggaaaagac gttcaaaaca agtcacaggg caacagaaaa tggtattcta    145740
     cgttgtattt tctagcaata caacaaattt atcatacgaa taagggagaa cctagaaatc    145800
     cagtgtttcg ggtttatttc gagcggaaag tttcagatgc tcatattcca tataaaagga    145860
     gtataatttt gaaaataaaa aaaatattac cacaaacaat aaaaagtgaa gtttatttta    145920
     tagatgaaat taaaaatttt gatattgtaa ctgaaaaaat gaatgacaat ttctacacct    145980
     acagattagg aagtaacgtt atgatgtggt tgaatgatga aggggtaatc ggggagatag    146040
     agtgcatttt ccccgcacaa atagataatt taatcacctt atgggaagaa aaaaatactg    146100
     tagtacaaaa tggatttccg atgattgata ctgatattgt tgagaacaaa acttttattc    146160
     caaaagtaag aatttttaac catggtgatt attttatact atatttcagt aatatgtata    146220
     aatacaataa agaaattatt tctgaaaacc ttacttttta tgcgaaggat acagaattaa    146280
     ttgcaattaa agcggaatta acctgatgtt gaaaaattat tatacaggtt tcgaaggata    146340
     tccagaaatt gacttttata cttatataaa tggtgaaaaa acaggtatag aaatgtggga    146400
     aggctacttt gacaatatta tgaatgaatt tagtccagtt gatggtagat gggtttcttt    146460
     agcatattat tatcatttat atgaaggttg gtatgatgaa agcccttggg tgattccaga    146520
     caacaaaaaa gccttggaac aatttggaac aatcgatata aaagtattgg ataatgttac    146580
     acaagagatt atgatgaaac taattaagtt attaaaagat aacttagata gcgaaatttt    146640
     tatagagtat tcttaataaa acaaagggca cctttagaat atataaaggt gccctttgtt    146700
     ttattcaata ttttttgaca tttaaagtta actcattcca atcattctcc ataccgtggt    146760
     caaatgtggg tgttaatgaa aaatggtata gtagatgtag aagcaacgaa cgcgtataat    146820
     gctgccgtgc tcggcgggaa aatgccgcat gaaagcaatg aagcgcagga agaagctgag    146880
     ttgttacagg cagttgttca atcggtgaaa gaaggaacag acccggttac tgggcaagag    146940
     ataagtaagg cgcaagggtt tagtattata agtggcgtta tcttttacta cgctggtggt    147000
     gggtataaag ggaagaagat taagattcct aagaagtggt tggatagaag aaggaatgtc    147060
     aatagaattg attttctgca gagtgttaat attaaagact ttgtagttaa agacaagcat    147120
     ttacgtaatt ctacggcaaa gcgtgcaaga aagtttgatg cagaaacctc agaagaggct    147180
     aatttgatag tacaagatgc attgaaaaat ggtaaagtca aaaaaattga agataatggc    147240
     ctaggaagtc aaaggcaaaa atcttattct gcaataatag atacggaaaa aaatgttgga    147300
     acaaaaggcg agtcgcatat taaaattgta tatgatgaat taaataatgt gtggactgta    147360
     tatccagttc cggcaccatg aagaaggtgg agattaatat gaataatata gatagtatta    147420
     tgtctaaata caacaaacaa caagttagta aaattaaaga ttttctatta tctgaaatag    147480
     attcagacaa tatagaagaa accattgatt ttgtaaaaag taacaatcaa gagaaaatgg    147540
     gtaaatttca agatattctg tatgatggtg gaatttattc aggtttattt atagaaggaa    147600
     atcaatattt gatttctagt tctaatcgta aagtcttaat aattgacgca gttagcgaag    147660
     aaaatggagt ggataaagag cttactcgaa tagaatgttc gcttgaagac tttacttttt    147720
     tactgaggaa tataaaagat gtcctgagat atgaggagtt ttagacttag aatcaatgaa    147780
     cacgtataat gcagccctct tagctcgaga ttatcgcaga agtgctagtg tctaatattt    147840
     tgagtggcat attctttact gatgattatg gaggtataca aaattggatc aaaaaataaa    147900
     ggatatctat catatagatg actctttttc tattgataat gaaaaataca ataagtggct    147960
     aaaatcattg ttgaataaaa ctagaggcga aattactgaa aatgatgtat atacgatgct    148020
     tttgcaacaa gaactagagg atttagctat agaaaaagcg attgaattca ttaaaataga    148080
     cccattagct ggagaaatgt gggatggaca atttttagaa cagctagcag gaatctcggt    148140
     cgataaattg gtagcttaca aagaggagtt gcaaaaatta ataccttata tggataatca    148200
     aattaacgaa atcttgtggg attttgaaac tgaaaaagag gaattcctat ttagatatgc    148260
     gaagtttaaa gataaagtag ctaatttatg aaaagaaata aaaacccagc aattacataa    148320
     ttgctgggtt tttccaaact gctaatcagt cctctatttc tccacccgaa taaacttata    148380
     actataaggc gaaccaaaag catgtttctg cacgcccgta atatccgtac gttgcaacac    148440
     tgctgtttga tgttgataaa gtggtaaaat cgccgcgtca tcatcaagca gaactttctc    148500
     ggaagctaca aaagcattcc aacgttcttc tggcttcgtc gcaagtgttg tatccgtcga    148560
     ttttacaagc ttatcataag cgggactgtt gtagctcata tggttattaa agtaatcaga    148620
     taagaataaa ctactatacg tccacggatc cttaaagtca ggcatccaag cagccagtga    148680
     caagtcataa ttaccatcag aagttagctg tgtcgcgctc ttcgaaggca tatttttcac    148740
     tttaatcgtc acacctggca aattatcttc aaactgcgct ttcaaataag cgaaaatggt    148800
     tttcgttgtt tcttggtcat cgccgagcag ttcgattgtt actttgtcag tgccaagttc    148860
     tttttgtgct tgtttccagt attttaaagc ttcttctttg ttataaacta aatggttgcc    148920
     gctatctgtg cggaaatcag cgcccgttgt tggattttgg acgaaatctt ttggcagaag    148980
     tccgttcgct gggaaggaac catcgccgag aattcggtct gttaattgct tcttatcgac    149040
     agctaaatta agcgcgtgac gcaaggaatt attcgctagc ggagttgctt taccgtcacg    149100
     tttttggttc atgcgcaaat aacttatcag cgcatctttt tccgtttgga aatctttctt    149160
     gtctttgtat tgtttcgcaa aatcgcctga aagtggcacg cggtcagctt cgtttgtatt    149220
     ataaaggttc acgccggcat taatatcttt cgcgacttgc acatcaattt catttacttt    149280
     gacattatct ttgtcccaat attggtcgtt tttcgcgtaa gtccatttat tcgtaatgtt    149340
     gccgccccaa tccttcatga caaaagggcc attgtataaa gtatgcgcac tatctgtccc    149400
     gtatttgtcg ccttgttttt tcacataact ttctttttgt gggaaaaatg tttcaaaaga    149460
     aagaagtgaa atgaagtatg gaactggttt ttttagtgtg atttcaagcg ttgttgggtc    149520
     cgttgcaacg acaccaaggt cagttacagg tagtttgcct tcattgattt cagtggcgtt    149580
     tttaatcgaa tctttgaaga gagcggagta cccaggtgcg gtttttggat caacggcacg    149640
     gcgccacgcg tagacgaaat catcggcagt tacttgggaa ccatcggacc atttcgcgtt    149700
     tttctttaat ttaatggtat atttcgtttg gtcagtgctg atttctggca ttccgtcagc    149760
     aaccccagga acaaagttat ctttttgatc aagtgtgtat aatccctcga agacttggtt    149820
     ttgcgcggtg aagctagcaa agtcttcctc agctgtcgta tttaaagtca gtaattcact    149880
     ggtttcaaga aatttaattt tgtccgggga agtttttgtc gtagattttt cattgtcatt    149940
     tccgcaagct gtgagtaaaa gtactgtcaa aatggcaaaa ataggcaatg ttttctttaa    150000
     aaaatgcatg gttttctccc cttctatctg tgtatttatc gttattataa gtattccgat    150060
     aagataagtc aagttaatga tttggcaaaa aaactgcttg acgcaaaaat aatcccgtga    150120
     taagatattt tgtgcaaata agaattatta cgttttgcga tgcgcgatca taatttacat    150180
     agtgtaactt taagttttaa atcgtaatca ttacgaaaaa ggagaggtaa tatgaaaaaa    150240
     tggtcatttt tagttgtaac agtgttggcg ttcgttttag ttttggccgg atgcggtgct    150300
     agcaacgata aagtaagtgg agataaggac aagctcaagg tagtgacaac tttttatcca    150360
     atgtacgatt ttaccaaaaa tgttgcgggg gataatgctt cgattgaaat gttgattgat    150420
     gctgggacag aaccgcatga ttacgaacca agcgcaaagg atattgccaa aatcgaagcg    150480
     gcggatgttt tcgtttataa cagtgaagac atggaaactt gggtgccgag cgtacttaaa    150540
     agcttagatt cgaaaaaatt aaccgtgatt gatgcgagta aaggaatcga gctagtagaa    150600
     ggaaccgaag aagaagacca tgatcatgag cacgaagaag ggcaccacca tgaacacgat    150660
     cctcacgtat ggctaagccc agtccttgcc gaacaagaag tgactaatat ccagaacggt    150720
     cttacaaaag cagataaaac aaatgcagat acatacaaaa agaacgcaga aacatataaa    150780
     gagaaattaa aaacactcga caacaaattt aaaacagctt ttgaaggagc aaaacaacgc    150840
     gatttcgtaa cccaacatgc agcattccaa tatttagcaa aagaatatga cttgcatcaa    150900
     gtggcaatcg ccggcctttc acctgaccaa gaaccaagtc cagcacgatt agcagaacta    150960
     caaaaatacg tgaaagaaaa caacattagc accatttatt ttgaagaagt agcttcaccg    151020
     aaagtcgcag aaacacttgc aaacgaaacc ggtgcaaaat tagaagtatt aagccctatc    151080
     gaaggaatta ccgataaaga acagaaaaaa ggcatggatt atatagctta tatggaacaa    151140
     aatcttcaag ccttgcaaaa aacaataaaa taaggaagcg atcaaatgaa atacatcgat    151200
     atagccaata ttggttttaa atacgaatca gagccagtgc ttgaaaacat ttcttttcaa    151260
     gtgagtgcgg gagaatttat tatactaaca ggagaaaacg gagcagctaa atcaacactg    151320
     ctccgtatta ttttgggcat tttacaaccc gataaaggtt ccgtgacttt cgccaaaaag    151380
     aacgcagatg gcgggcgact tttgacaggt tatgtaccgc aacaaatagc ttcatttaat    151440
     gctggttttc caagtacagt tctcgaatta gtaaggtcag gacgttttcc gaatggtaaa    151500
     tggttcaaac ggctgactac aaaagatcat gcgcatgttg aaaaagcatt aaagtctgta    151560
     gaaatgtggg attatcgtca taaacgtatc ggcgagttat ctggtggaca aaagcagcgg    151620
     atttgcttag cgcgaatgtt tgcaacagac ccagatatat taattttgga tgaaccacag    151680
     acggcgatgg ataaacaaag taaaatccgt ttttataatt tattaaagca tgaagcgcaa    151740
     gtacatggta aagcgatttt gatggtaaca catgatagtg aagaaatgga agactttgtg    151800
     gataagcata ttcgccttat tagaaaggag gatgtgtcat ggaaatgttt ctctatggat    151860
     ttatgcaaag agccttccaa gcgtccatga taatcgctat aattgctcct cttttaggag    151920
     ttttcttgat tatccgcaga cagtcactta tggcggatac actttcgcat gtgtcgcttg    151980
     cgggggtggc ttttgggttg gttttaaatg tgaatcccag tgtgacaacg cttattgtag    152040
     tagtcattgc ggcgctcggg attgaatatt tgcgcggggt ttatgtaact tattccgagt    152100
     tgtccattgc gatactaatg gctggtggac ttgctgtggc gttagttctg atgagtttag    152160
     atcagggtgg aattacaaca agcgtgcagc agtacttatt tggttcgatt gtaacaatca    152220
     gtaaggcgca agtgcagctg ttggtaattt taggagtagc tatcgtagta ttgttcttag    152280
     tatttaaaag gtttatgttt gtacttactt ttagtgaaga tgttgcagtt gcagaaggag    152340
     tccctgtaag attgatttcg cttttattca gtgtggttac tgggattgcg attgcggtta    152400
     ttatgccaat agccggagcg ttactcgttt cagcgctcat tatattacca gctgcaatcg    152460
     gtatgcgaat ttcaaaaggg ttcctgatgt gtgttattag tgcaattctg attggcttag    152520
     tcggaatgtt ttccggcctt gtgtcttcct accaactagg aaccccacct ggcgcaacaa    152580
     ttaccttaat gtttatcatt cttttcatta tttcgactgt tgttttaaaa ctaatacgaa    152640
     aatgatttta gaacgatgtt tgaccattct gtatcattgt ataaagcgct tggtcatgaa    152700
     taatccaaca cttttctttc ttttcaatct gatttgttgt tttaagatat tgcaaatctt    152760
     tgtaaaaaca gcttttcgaa aggttactat aagaaagtag atgacttgtt ttaattgctt    152820
     gaggaagaat tactgtacca tcatcactca gaactccatg taataaagcc atattcgaaa    152880
     atgtcgtttt aagtttttca gaagccggac tacttgccat taagctttta aagtaaacat    152940
     gagtagtctg gtttttcata atgaaaaatt gaaatccgaa attctcggga aacattgaaa    153000
     ggaaatactc catatctgct ttcgaatact tatataatga acatccagag agagtcttaa    153060
     aattaaaatg attattactt tggtcaagta atgtaaaata gttcaaaaat gttcctttac    153120
     cttgaataga atagattttg gaattttggc taccatcatt taaaatcaaa gcaatatatc    153180
     catcaactac aaggtaaata tggttatcta tatcaatttt ttctgttaat aggctggcgt    153240
     ttttcggtac atcaatttgt tcataagcta tttttccttc atgggataaa cgaataaatt    153300
     cttggtaatt atataaattt tttggcatga ttgttttctc caatcttctt ttgtaaacat    153360
     aattgtatca gaatgcaaaa gaacggtttt acgcagtcta gtagtgtttt acgtataaat    153420
     gtttctgaaa tgtgaaattt ttaactcatt ataagtcttt ttttagtgaa aaatactgat    153480
     aagcttttgt ggtgtgcgag tttagactgt tttgccacga aagtccgaaa ttagtctttt    153540
     tttatcgaat tgttgcgaac gtaggttctg tgttataatt caactggatt gtaaaggagg    153600
     actattgatg agaaaagtgc gtatttcagt taggcgttta gtagagtttg tgcggagaag    153660
     cggtagtatt gataaccgga tgactagttc agaccgcgcc ttagaaggaa caaaaattca    153720
     tcaattactc caaaaagaag ctggggaaga atatgctgca gaggtacggc taaacctaga    153780
     ccgaatagtg gacggaattg ctttttcgct tgatggacgc gcagatggca tcataaatgg    153840
     ccgaatgatt gatgaaatta aaacaactga gacgccaatg gatgaaatta ccgaaaattt    153900
     tcgacctctt cactgggcgc aacttatttg ttatggattt atgcttgcag aaaagtccga    153960
     tttggcagaa gttactctac aattaacgta ttatcaagta gttgacaaag aagtaaaaca    154020
     atttcaacgt gtaatgagtc gcgaggaact gagcgttttt gtggacgatt tactttccca    154080
     atacgctatt tgggcaaagg catctgccgc ttgggaaatg aaacgaaata aaacaattca    154140
     agaattaacg tttccatatg acagctatcg aagtgggcaa agagagcttg ccattgcagt    154200
     gtaccgaaca atatcttcag aagaaagttt gttttgtgaa gcacccacag gtatcggcaa    154260
     aacaatgtcg accttgtttc ccggtattaa agctatgggt gaagggaaaa cggataaatt    154320
     gttttacttt actgcaaaaa ctattacgcg gcaagttgcc gaagatgcgc tagatgagat    154380
     gcgtcgtaaa ggacttgctg caaggagtgt tacaataact gcgaaggata agatatgctt    154440
     tttagacgag aggaaatgtg aaccagatca ttgccaattt gcgcgaggtt attatgatcg    154500
     tttgaacgaa gcattgtttg atatgttgca atccgaagaa gcaattaccc gtcaagttgt    154560
     tgagagttat gcccggaaat acacactttg tccatttgaa ttatcgctgg atgtggctct    154620
     tttttgtgat gtaatagttt gtgattataa ttatttattc gacccggtag tctacttgaa    154680
     acgtttcttt gcagaagggc caggtaaata tacttttctg gtggatgaag tgcataattt    154740
     agtagaccgt gcgcgctcga tgtactcagc gacattaaaa aaatctgcag ttatgcaagt    154800
     caaacgggga ctggacgcaa aaaataacaa gcgattgcta aatgcaatca atgtgatgaa    154860
     taaagacatg atcgcactca ataaaaaact aaaggattta gatggaacta tatatgtgca    154920
     aaaaaatgaa ctcattgatt ggaatgaatc ggtcctaaaa ttcacctttg tagcgaagga    154980
     atggttgccg caaaatactc agtcagaaat acaagcggat gtgttggaac tttattttga    155040
     aagtttgaga tatgttgcaa ttgcggattt ttatgatgat cgttacgtca cacaagtaac    155100
     gaaaagccac ggagatttag aaataaaaca agtatgcttg gatccgtcgt tcttattatc    155160
     agaaagactg aaactcggaa gcagctcggt gctcttttca gcaacgcttc gaccaataga    155220
     ttactataca aatttacttg gtggtcaaga agacacgagt agaatgattt tttcttcacc    155280
     atttaaacaa aaaaacatgc atttactagt agcggattat attagtacga aataccaaat    155340
     gcgcgaaaat agtatggaag ctgtcgtaga tgctctctat gctctagtct ctggggaaaa    155400
     cggcaactat ttatttttct ttccatcatt tctatattta caaaaggtat acgatttatt    155460
     taaagaaaaa tatcctaaca tcaggttgca aaaacaagaa actgctatgg atgaagagcg    155520
     acgggagcat tttttagaaa gatttcaagc agagaatgta gaaactttga ttggcttttg    155580
     cgtcttagga ggcgtttttt cagaaggggt agatcttcgt ggcaaccgat tagtcggtgc    155640
     ggcagttgtt ggagtaggac ttgcgcaact gaatcacgaa tctgatttaa ttaaagatta    155700
     ttataatgaa acgattggtc ggggatttga ttatgcatat cagataccag gaatgaataa    155760
     ggtgcttcaa gcagttggcc gggttattcg aggagaatcg gaccgtggcg tagtgttgtt    155820
     aatagaagaa cgattttctg ccgatcgtta ccgagcatta ttccctacgc actggaacca    155880
     tgcgaaaaca gtgaagagca cagacgatat ctcccgagaa gtggccggat tttggcggaa    155940
     tagctaattt tctagtagaa tagaagtaat tagtcatttt tgggaggaaa ttatgtataa    156000
     aattattgcg atagatattg atggcacttt attaaacgac acacacgaaa tcacaccagc    156060
     tgtgcgtgat tctattaaag ctgcgaaagc aaaaggggta aaagtagtat tatgtacagg    156120
     tcgtccactt gcaggaatta aaaaaagctt aattgaacta gatcttttag atgaagggga    156180
     ttacgcaatt acgtttaatg gggcggttgt gttagaaaca gcttcagaaa aaacattagc    156240
     agatataacc ttaaataaaa ctgagctaga agaaatttat gcattttgtc acgcggaaaa    156300
     tgttaacgtc acttattttg atggaaaaaa catgtatgta ccaagccgca aaatcacaga    156360
     aatcacttgt caagattcgc tgctacttgg tacgccacta tatcatttac ctgtagaaga    156420
     agcgcctgaa tctattcatg tttccaaagt tatgctatta gactcacctg aaaaaattac    156480
     cgatgtgata aaaaaattac cagagaatat caaagaaaaa ttttacgttg tccggagtgt    156540
     tccatataac ttagagttct tgcaaaaagg ggttaataaa ggatcagcgc tcgctagttt    156600
     agcagataaa cttggggtgg accaaagtga agtcatgagt attggagatc aggaaaacga    156660
     tattaccatg atcgagtacg ctggtatggg agttgcgatg ggaaatgcga cagagcatat    156720
     taaagaaatc gccaactata caacaactac taataatgaa gatggtgtgg cacaggctat    156780
     tcaaatgctt attctggacc gataaaatag cgaatggtag taaaaataga gtattgcaat    156840
     aaagtataaa tggatactaa aaagcataca cattgctaca aaaagccgaa acttcctata    156900
     aaggagtttc ggcttttttg ttcaattaag tactttataa tatatagtcc tttaaaatag    156960
     tcactaaaag ttcataaaga tggcgtttta ggagcagtac ttccgaaaaa tgatatagct    157020
     tggagttact caattgtcat atgatatgtg ataataacaa aacttcatta gtaaaggatg    157080
     aatttgtaat gagtaaaaac ggaaactttt taaaaaaagt tgggttagct ttcttaagta    157140
     ttttaatcgt tgctagcaca atcttccaaa cgacagttgt gaaagcagca acgagttatg    157200
     gttctcagtt tttaaacaca gtagaacttt tagacaagga cggtgtgccg caaacggatt    157260
     ttggctacta tgacaacatg gatgtgcatt acacttggtc tatccctaat tcaacaaacg    157320
     taaaagcggg cgacacaatg gatttcacgc tgccaagtca attggcgctg gcaaccgatc    157380
     tcgcttttga cgtgaaagat agtaaaggtc aagtagttgg aacggccact gtaaaaaagg    157440
     caacaaatca agtaacacta gttttcagtg attatgtaga aaaacattcc gatgttaagg    157500
     gcgaactgga tttctggact gctttcaacc aaaaagtaat tactggaaat gaaacagttg    157560
     atttagtatt ccctcttgaa aatggaacaa ccgtaataga tgtagaagtt ggtgaaaaaa    157620
     caccagttag cccgacagaa acgcttttca aatatggttg ggtagatgct agtaatccaa    157680
     gtttgattca ttgggttgtt cgcgtgaatt acgctaaagt taatatccca aatgctgttt    157740
     tcaccgacat cattggcgca aaacaaacat taaattttga ttctattaaa gcctttcacg    157800
     gaacgtactc agcggaccga gtatttacag caggtgcgcc gatttccagc accaattttt    157860
     ctgcgacaag tgacgggttt agtgtagctt taggaaatct aactgattca gtgcaaattt    157920
     cttacacaac cactactaca gatggtggga agtccactca gtatgataat actgctaaat    157980
     tagccggaac tgattttgtg acaaagcaaa cgtctacttg gacaccagca tcaggcggtg    158040
     gcggtgaagg aggaggaaca actggttcag taacacttac gaaagaagat gcgaaaacaa    158100
     aagcaaccct cgaaggtgcg gaattcaagt tggtggattc aaaaggcact gtgctacaag    158160
     aaaacattac aacaaatgcg agcggacaac ttagcattgc tgacctgaaa tttgacacct    158220
     accaattaat agaaacaaaa gccccgacag gctataaact tgatacaaca ccagtagaat    158280
     tcactattgg tgaaaacaac caagcaatta cagtaacaaa agaaaacaca cttaatacag    158340
     gctccgtaga attaacaaaa ctagatgccg caaccaaagc gaccttagcc ggagcaacat    158400
     ttgaattaca agataaagaa ggaaatacgc tccaaacaga cttgaaaaca gatgaaaatg    158460
     gcgttctaaa agtaactgat ttagtaccag gcagttacca atttgtcgaa acaagtgctc    158520
     caacaggcta caagttagac aacagtccag taagttttga agttatcgct ggtgagacag    158580
     accaagtagt aaaagtaaca aaagaaaaca cactagaagt tggctccgtg gaactaacaa    158640
     agttagactc ggcaaccaaa gcaaccctag ccggagcaac atttgaatta caagataaag    158700
     aaggaaatac gctccaaaca gacttgaaaa cagatgaaaa tggcgttcta aaagtaactg    158760
     atttagtacc aggcagttac caatttgtcg aaacaagtgc tccaacaggc tacaagttag    158820
     acaacagtcc agtaagtttt gaagttgtcg ctggtgagac agaccaagta gtaaaagtaa    158880
     caaaagaaaa cacattagaa gttggctccg tggaactaac aaagttagac tcggcaacca    158940
     aagcaaccct agccggagca acatttgaat tacaagataa agaaggaaat acattacaaa    159000
     ctggtttaac tacggacgaa aatggcgttc taaaagtaac tgatttagta ccagggacat    159060
     accaatttgt ggaaacaaaa gccccgattg gatatgaact tgatacgacc ccagttagtt    159120
     ttgaaattgt cgctggtgag acagacccaa tagtaaaagt aacaaaagaa aacacattag    159180
     taccaccaac accagtacca ccaacaccag taccaccaac accagtacca ccaacaccag    159240
     taccgcctac tccgttacca ccagtaccat atgaaccaac tgtgccacca acaaaaccag    159300
     aagtaccagt tacgcctaag aaaacagaaa acagcgagga tagtccaaaa acaaccccga    159360
     taagaataac tcaaagtctt cctaaaacag gagatacaaa tagttttgct ggcttaggag    159420
     taatcctgat agccttgtca ttaagcggtc ttctgctgaa gcgcaaatag aaaaaacagg    159480
     cttagataat tatctaagcc tgttttaatt aggtcatttt agaatcctaa tcgtcacaaa    159540
     acgttcacga ttaggaggtt ttttgataga taagaaccga tttttaggaa aaataatgta    159600
     taatcactat gaattagtaa taaatttatg attgaaatta actaaaaaag gatggttttt    159660
     ttatgaagga acgcacgaca atgatgtcta atctaaagaa attcggatta gcatttctta    159720
     gcgttatctt gcttgtaaac gttatatttc agactaactt tgttaaagca gcaactaatt    159780
     atgggtccga ttttttgaaa actgttgaat tattagatgc agatggaaat ccccaaacgg    159840
     acttcgggta ttatgatagc atcaaggttc actatacttg ggaaatcccc aattcaacta    159900
     atgttaagga aggcgacaca atggaatttg tgttacctcc agagctgaag atagttacag    159960
     atttagactt ttctttaaaa gatcacgatg gcaacacggt aggtcatgtg attgctaaaa    160020
     aatcgactgg ccaagtagtt attacattta cagactttgt cgaaaaaaac tccaatatta    160080
     gtggatatct cgatttttgg actaattggg ataaatcatt agtagaaggt aatgaaaatg    160140
     ttccagttga atttccagta aatggtacca cagaaacaat tgatgtgggt gttggaggca    160200
     aaaatcaaat cgacccggat gaaagcttat ataaatacgg ctgggctgat gctgaaaatc    160260
     ctgagcttat ccagtgggtt gtgcgagtta actattccaa acaaaacatt caaaatgccg    160320
     tttatgaaga ctttattgga ccaaaacaag tcgttgattt taattcaata aaagcattcc    160380
     acggcgagtt tgacccggat gataacttca caccaggagc tgaggtgcct tcatctgcaa    160440
     ttactcaaac aacggatggt tttaaagttg atctaggaaa tttaacagat tctgtcaaaa    160500
     tttcatacta cacaacttct accgacaacg gagcatcgcc taactacact aataaagggc    160560
     aattaacagg cgataacttc attaaacaag aaatcgaagt cgcaacacca acatcaggag    160620
     gcggcggtgg tggagaaggg acaactggtt ctgttgaatt aacgaaaaca gatgattcgt    160680
     cccaaaaaaa tccgctagaa ggtgccgaat ttaagttagt caacggagca ggagccactg    160740
     tgcaaacggg attaaaaacc aatgctgatg gaaaactggc aatttcaaac ctgaaatatg    160800
     acacatacca gctaatcgaa acgaaagctc cacaaggata cgtgttggat gcgtctccag    160860
     tgaaattcac gattgatgat acccaccaat cattattcgt atctaaagaa aatactgcca    160920
     tcaaaggatc cgtttcacta gaaaaagtcg accgtgacac aaaaagtctt ctagctgatg    160980
     ccgaattcga attacaagat aaagatggta acacactaaa aacaaatctt aaaacggacc    161040
     aaaaaggtaa actaacggtt gctgatttac ttccaggtga gtatcaattt gttgaaacaa    161100
     aagcaccaac aggttatatt ttagacacta caccattgaa atttaaaatc agcacagaag    161160
     cattaaacgt aactgtaaca aaagaaaata cgaaaaaacc agaaatacca aaagtgccag    161220
     taccaccaaa aaaaccagaa aaaccggata aaataataag tgaagacagc aaacagacag    161280
     ctttaccaaa aacaggagat tcgccacttg ttaatggatg gggactgtta ctcgtagcca    161340
     tttcagcgag cggcttaatt gcacttagaa gaaaataata aaaaaccgta agcgataata    161400
     caatcgctta cggtttttct tatatagttc tagtttgatc ttgcaaaacg gcctttaacg    161460
     aatgataggc tggaatagat aagtttaagt caacgcgatt aatttgttgc gccatttttg    161520
     gttggatacc agaaataaat gcctcgacgc caagaagttt gagcatcgtc actaagttgg    161580
     tgagcatctc tcctaacgca tcgtcaaaat acgtgattcc agataaatca atacacaatt    161640
     gttccacgcc taaatgaaca catttatttg cagtaatttc ggatagcttt tctgctcttt    161700
     cacgatctac acggcccatt aaaggaagta tcgccaattt gtcagtaatg gaaatgactg    161760
     gggtgctaat ttcttcaatt aagcgatgtt gttgttctag atgtttcacg atatcattgt    161820
     aatacattgc agaaaaggct tcgtttattc ggtcgaatcc gtgattaacc attgccatgc    161880
     ttgatgagaa ttcacattta gacacttcat cattatgaat acaaaagtca ccaacggctg    161940
     taacaaattc gcgacgtagt ttatctaagg tagtaataac ttcaggtaat ggcacttcat    162000
     tttccatgcg acgtgcgtac atgttatcta gccatttgtc gagtttctca aagaacgctt    162060
     ttttaccagc aaaataagaa atgattaagt ccgctgtttg ttcactgtca gcgcgcagtt    162120
     catctttata ttgtggagag taaacaaagc tagtatacgt attttcataa atttttgata    162180
     accaattatt aatgatttct tcggtatgtt ctcttaaata tagctccata cttccattcg    162240
     attcattcat accagacaac ccctttaagt ctaagtataa taactacttt tctttattct    162300
     atgctcaaaa cggtgtactg tccatttaaa ttttagaaaa ataactaatt tattgaaatt    162360
     gtaatattag ttaacaaatc caacgttatt tttttgttaa aattccgaag ctatttaagc    162420
     ttggtcatgg tataatatta caatatggat agaaaggaag ttttttgtgg gattacagga    162480
     tgaacttaca atgatgcaac cagtggtcat gaagattttt tcaaaaagtg tccgcgaaaa    162540
     tcgattatct cacggctatt tattcgaagg aacaaggggt acagggaaga agcgcacagc    162600
     actttggtta gctcagagcc ttttttgttt agaaagcact gaaaccgagc ttgcttgtgg    162660
     aaagtgtacc aattgcacga gaatagcgag tcataatcat ccggatgttc atttgctaga    162720
     gccagatggg gctagtatta aaattgatca ggttcgcgcg cttaagcaag aacttagtaa    162780
     acgtgggatg gaatcggatc aaaaagtagt tatcatttac gatgcagaaa aaatgactgt    162840
     tcaatcagcc aatagtctgc tgaaatttat agaagaacca gaaggcggtt tgttattatt    162900
     atttttaaca acaaatcccg ggcaaatttt gccaacaatc cagtcaagac tgcaaccggt    162960
     cacattcaaa tcactgactt ttgatagttt actcgcatca ctaacagcag caggcatttc    163020
     cgaacaaaaa gcgcggattt atgctagcat tactgggagt gtggaagaag cgaaggcttt    163080
     tgaagagagc gagtggttta gtgaggcaag aaatgttgtc atcaagttat acgaaggaat    163140
     tcaccatcaa ggaaccagcc cattaattat cattcaagaa tcatggatgc cactttttaa    163200
     agagaaagat aagatggcgc ttgggctcga attgttgtta ctgctgtacc gcgaccggct    163260
     acaccttaca cttgacgaga actacgaacc aatttgtaca gcgcaaaaag aaatgctcgg    163320
     acaagatgcg ctgcgcaagt cactgtccga aaccacaggg gaaatcgaga agattctcgc    163380
     tgcgaaatca aaactggatt ccaatatgaa cacgcaactt ctaatggagc agttagttct    163440
     ggaaatccaa gggaggtaat cgctatgctt aaaattgtag gcgtccgttt taaagacgtt    163500
     ggtaaaatat attatttctc acctggcgaa ctggaaatca cagaaaacca aggtgttatc    163560
     gttgaaaatg cacaaggaat tgaatttggt aaaacggtca ttgaaccacg ctacgtggac    163620
     gaagaagacg tcgttttacc acttaagaaa gtactgcgta tcgcaacaga agcggattat    163680
     aaatgcgttg ctgagaatgg cgactcttgt cagaaagcct ttttactctg tgatgaaaag    163740
     atccgcgagc gcgaacttga aatgagtttg gttgatgtgg attatacatt tgaccgtaat    163800
     aaaatcattt tttactttac tgcagaaggt cgcgttgatt tccgggagct cgtgaaagat    163860
     ttagcatctg ttttccggac tcgcatcgaa cttcgccaaa ttggtgttcg tgatgaagcg    163920
     aaattgctcg gtgggattgg tccatgtggt cgtatgctct gctgttccac tttcttaggc    163980
     gatttcgaac ccgtttccat caaaatggcg aaagaccaaa acctgtccct taacccgacg    164040
     aaaatttctg gcttatgtgg acgcttaatg tgttgcctga aatatgagaa cgatgaatat    164100
     gagcaagcta aacgtgaaat gccagatgtt ggtgtaaaag taaaaactcc agaaggcgca    164160
     gaagcacgtg tttcgggaat caacttgctt tctagaatct tacaagtgag tttgcccgaa    164220
     gaagagacgg ttatagaata cgaattggac gaattacgcc catacaacga atttctaaaa    164280
     caaccggcaa agtcttgagg tgaaaaaatt ggataaaaaa gctatttttg actcagtcag    164340
     taatatggag gagcaaattg gcgaattgta tcagcaactt ggagatctaa agacaaactt    164400
     aggcgaaatg ttggaagaaa ataaccgatt aaaccttgaa aacgaacatt tgcgacgcag    164460
     actttctttg accgatgaag cgacaccgga acctaaagcc gaaacagagg cggaacacgg    164520
     tgtaatggcg cctaatcgta aggaagcaat gcagcaaatg attgaacttg gggaaggtta    164580
     tgacaatctt gtccaacttt acaaggaagg atttcatgtt tgcaatgtac atttcggcag    164640
     cccgcgtggt aatgatgaag attgtttatt ttgcttatcc ttgctcaata aaaaataaca    164700
     tgacgggcct ttctcgattc aggagaaggg ctttttgcta gaaaaggtga atcatttgga    164760
     aaaactcaaa ttaataggtg atgaaagact ggattattta ttagcagaaa atttgcggat    164820
     tattcaaagc ccatcggtat tttctttctc gatagatgca gttctcctag cgaaattcag    164880
     ttatttgcct gtgcgtaagg ggaaaataat tgatttatgt agcgggaatg ggattatccc    164940
     tttattactt agcacgcgaa ctgaagcgca aatagttggt gttgaaattc aggagcgcct    165000
     ggcagatatg gcgaaaagaa gcatttcgta taatcaatta gaagagcaaa ttgaaatgat    165060
     cgaatatgat ttgaaaaata ttacagatct tattccaaaa gagcgcgcgg atattgtcac    165120
     ctgtaatcca ccttatttcg caaccccgga tacaagtttg aaaaatacca atgaacattt    165180
     tcggattgct cgccatgaag taatgtgcac gttagaagat actattcgtg tagcagcaag    165240
     ccttttaaaa caagggggaa aagcgaattt tgttcatcgt ccggaacgat tactagatat    165300
     cattgatata atgagaaaat atcgcttaga gccgaaacgc attcaattcg ttcatccgcg    165360
     catagataaa gaagcgaata cggtgcttgt ggaaggaatt aaagatggaa aacctggtgt    165420
     aaaatatgta ccacctgtta tcgtatatga tgaacttgga gaatatactc cagtaattaa    165480
     ggagatttta tatggcgaaa gcgagtgaac atttctttta tgtgctaaaa tgtagtgata    165540
     attcatatta tggtggctat acaactgatg ttcttcgccg agaagcagaa cacaatgcgg    165600
     gaattagatg taaatataca aaaacgcgtc gtccggtaaa agtcatccat tttgaaaaat    165660
     tcgaaacaag aagtgaagct acaaaagcag aagctgcgtt caaaaaatta tcacgtaaaa    165720
     ataaagacgc ttatttaata caacgggagg aggagtccga gtgataaaaa gtcaaaagag    165780
     tttcagcgga accagccaag gggcattata tttagtgccg acgccgattg gtaatttaga    165840
     agatatgact tttcgtgcaa ttcgcatgct taaagaagcg gatattattg cagcggaaga    165900
     tacgcgaaac accgtgaaac ttttaaatca ttttgaaatt acaacccgaa tgacgagtta    165960
     tcatcagttt acgaaggaaa ataaagaaga taatattatt cagcgaatgc tgggcggaga    166020
     agtggtggcg ctagtgagtg atgctgggat gccatctatt tctgacccgg gatacgaact    166080
     tgttcaaagt gcgttagatg ctaatattcc tgtcatccca ttaccgggag ccaatgctgc    166140
     attaactgca ctgattgcat ctggtcttgc cccgcagccg ttttactttt acggatttct    166200
     tccacgccaa aacaaagagc gtactcaagc gattgaaaag ttggcggctc gtgaagaaac    166260
     gtggatttta tatgaatcac cacatcgttt aaaagaaaca ctaaaagcaa tcattaaaat    166320
     cactggaaat gatcggaaaa tcgtcctgtg tcgagagctc acaaaaagat ttgaagaatt    166380
     tttgcgtgga acggttgaag atgcgctgaa ctgggcaatg gacgaagaaa tccgcgggga    166440
     attttgcttg attatcgaag gcaattccaa cccacaactt gcagaagagc agctctggtg    166500
     gcaagaactc gatattaaaa cgcacgtaag caccgtaatg gaacaggaaa atgttagttc    166560
     taaagatgca atcaaaaccg ttatgaaagc gagaaattta ccaaaacgag aagtttactc    166620
     tgcttatcat gaaataaaat aaaaatcatg tgcgaatcct tgaatgggaa ctcgcacatg    166680
     atttttttat aatgtatcgc caaagcggcg tttaatttct tccattaatg ccgcagcacc    166740
     ttctttacta agcgtcagtt tgccgtccac aaatttctta ttatcaacag aaaattctcc    166800
     ggtaacatca caaaccaagc cagcagaata cttcttcaat ataatcgcat cttcatctgt    166860
     aaaaatttct aagggatctt ttacatttag gttcattgtc cttcttattt caatcgggat    166920
     aaccacacga ccaagttcgt cgatttttct taccattcca gttgatttca ttttctcacc    166980
     ttcttgataa ttttaattca ttttaacaga taattacggg aataggaatg atttcatgag    167040
     gaaaagggta tagaccataa gcagaagaat tagggggaat aaaaaatgaa catagttata    167100
     gcattaattc cggcagtgat gtgggggatt atgccattag ttgtttcgaa aattggtggt    167160
     aagccgaggc aacaaattat tggtacaacg ttcggggcat tagcattcgc aatcggagtt    167220
     tttattttta caaatccaga gtatacggca accataatta ttgctagttt tgtctctggg    167280
     gcattttgga gcttaggcca aatgaatcag ttccgggcat ttacacaagt aggcgtatca    167340
     aaaacaatgc cgctttcaac cggaatgcag ttagtaggta catcactttt tggtgtattc    167400
     gcctttcatg agtggggtac aacttccaaa ttagtattag gattttccgc attagcatta    167460
     attattatcg ggatattttt aacaagttat caacaacata aagacgaaaa ttccggtcaa    167520
     aatatgaaaa aaggaattat cactttactt atttcttcag taggttatgt aggttatgta    167580
     gttatcactc gttggtttga tattagtggg tgggacgcga ttttacctca agcaattggg    167640
     atggtagtcg caggattatt attttctatt aagtctgaag aaaaacgttt tacaaagcaa    167700
     acgtggttaa atatgattcc aggggtgatg tgggctactg gtaacttggc tctactattc    167760
     tcaaataaat tggttggaat cgccacaggt ttttcgctct cacaaatggg cgttgtcatt    167820
     tcaacaattg gaggaattct tttcttagga gagaaaaaaa ccaagaaaga acttattttg    167880
     gtcattatcg gagtagtctt agtaattatc ggtggcacga tgattggaat tgcaaaaagc    167940
     taagaacagc ttccggtttg atataatgct atacttaaaa taatctaaac taaaggtggt    168000
     tatattgata atgaatgcga atttagaagt aaatgctgag cttgtaaaag aatcctatgt    168060
     ttatttattg tcgcgatatc tcgttttacg ccaagaaaat tttgatacaa aagaagataa    168120
     aattccatat aacacactaa agcataattc ggtttctcca gcagatgcga attttgtaaa    168180
     tccaaacttt gatgtggttt attctgaagc ttggatagcc gtagacgacg aacatgctgt    168240
     tgttttagaa gtaccagaaa taaaaaatcg ctactacacg gttcaacttt tagatggttg    168300
     gggtgaagta gtaactaata tcaacgaacg taattttcca gagcatccac atggaaaatt    168360
     tgctttcgtt aaaaaaggaa caaacccttc cattccaagt gatgctataa aaattgaatt    168420
     accatctgaa aaagtgaaag tgctacttcg cgtagaacaa aaagacgacc cagaaggcgc    168480
     agtaaaactt caaaaagcat tcaaattcga cgcaccagat aatataaaaa tcaaagaacc    168540
     gttagaaata ccgcatttca ctaatgcaga gttcctctta gaagaaattt attccaattt    168600
     agaagaactg ctggcaactt atccagataa aatgccaaaa gcagctgagt ttcaagataa    168660
     agcaagaaaa gttgcagctt atatcgaact tggtgatgac caaaaagctg aggttagaaa    168720
     cttaattgtg aaagaagcgc ttccatattt tactaatggg gcaaaaggat ttggcacgca    168780
     aaaaggtgga tggtctgtta cttacgtagc tggtgctttc gaaaacgaca ttttagctcg    168840
     agcaattatt aattacggtg gtatttgggc aaactctatc caagaagctc tatatttcat    168900
     cggtcaaaaa ggtacggatg atgaattgct aactggagat aaaatttata aaatccattt    168960
     ctcagcagac gaacttccag cagaacttgc aaatgctttt tggtccgtta ccttatatag    169020
     tgttccggat tatcatgtta tcccgaacga attaaataag ttctgcatca ataattacac    169080
     aggtccaaaa ctaagtgaag atggcagctt gactctttac attgcgtctg aaaaaccggc    169140
     agatgtagat ccagggaatt ggctaccaag taaggctggg aaagaattct cactaaactt    169200
     ccgactatat gttccgaaaa aagaagtatt agaagggaaa gtattcttac caccacttga    169260
     agtcttttaa taaacaaatg aagctaagta tgaaactatc ggttttatac ttagcttttt    169320
     tgtgctttat actgttaaaa gactatttta ataggttttg atgagagtaa agcttgtttg    169380
     ttcacatgga agacataaac aaagcttatt tagcgtaaac taactactaa aattggtttt    169440
     tggaccaaat ctagtctgct ataataaata atattagatg atattaatta caacctggag    169500
     gaaacaaaaa tgagaaaaat accagttgtt gtttctcttg ctttgtgttt tagcctagta    169560
     agtcctagtt tgtatgctag tgcagatact ataactgcgg tccaaatcac taaggaagca    169620
     acaaccgaca ctacagaacc tacaactatt gaccagccta gcagaatgga caactcgcaa    169680
     accgcaccac agaaaatgac agcatcatcc agtgaagaag ctgcaactac taactcaact    169740
     gaagaggaaa atacacctaa aaataatttg aaatcaactt ctgaaaacag caaaacatat    169800
     gctgaactat ttccggatgt taatttagcc aaaataatag ctaaaaatat tagtggaaca    169860
     gaagatatta atgcagaagt atcagaagca gaattacaaa ctattactaa tttagtagca    169920
     acaaaccaga atattacgag cttaactggc atagagcatt taacagcgtt agaaaatatc    169980
     aatgtgaaca acaatgagct cacgacaata gattcgttat ttaatatacc aaccttaaaa    170040
     tcaattagcg cgaataataa taaaataacg gggaatttta gtttggtaaa aactttgccg    170100
     gaattacaca cgttagaagt gcttggtaat gcaattacag agttagatat tgaaaaccaa    170160
     cctaacctag taactttgtc ggcagatgaa ttagaattga aaaagctaac gttgaaaaat    170220
     ttatcccaat taaacggact aggaagaata gcttccagta tttctattga ctggggtgat    170280
     ctagagagcg tcactttaat gaatttacca gaaataataa gcgtagatat tagtgggaat    170340
     tatttagaca gtgatgatat acatttggag aaccttcctg cagttaagaa cctggatatc    170400
     agtagtaatg aactaactcg gctaccgaaa attaacgatt ttccgcttct gactacaatt    170460
     aatgtaagaa gtaataaaat agataggcta gaatcaagta aactagtcga tgtaccaaaa    170520
     cttgcgacac taaatgcgga taaacaagcc gttacgcttt caaaaacgat agcagcaggg    170580
     aactttacga taccgaataa cgttgagaac ttagcgggac aaatggttac accgaaaata    170640
     atttccaaca acggaactta ctctgatcaa agcatcgcat gggcaagcgg agaactatca    170700
     ggcttatcaa aagtttctta tacatttgat gaagtgatta atagtccggc aattgctggc    170760
     aagtacactg gaacagtaaa ccaaccaatt gaagtcaagg cagtacctgt aattgtagcg    170820
     gataagagtg tttcgtacgc gcccgtaaat gcaaaagatg aggcgacatt tttacaagat    170880
     attcgtgcgt ctgcttcgga aaacgcacag attactagcg attatagcga ggtagtcgac    170940
     tttgcaactc cgggagatta tacagtcacg ctacatgcta aaaatgagtt tgacttaaag    171000
     gcagatccgg ttaccgttgt cgtgcatatt aatgatattc aaaaaccaca agtcgcggtt    171060
     aactcgaacg atatttcatt tgaagtagga acagaattaa ctagtgaagt gcttcttgct    171120
     aaatctggcg cggtagttac ggatctatac gacgaagcaa ttaagatgga agttgacttg    171180
     tccgaagtgg attcaagcaa acttggaacg tatgaagcga cgataatagc aaaaagcaaa    171240
     agtggtgctt cctcggatcc aatcaaactt tctgttaaaa tagtcgatac cgaaaaacct    171300
     attattcaaa ttaacaatcc ggaaataatt attgaaaaag gcagcgaatt aacagagggt    171360
     caaatcattg accaagttgg aataactgca acagataatt atgatcaaga tttaaatatc    171420
     cacatggatt tatctaaagt agatacttcc aagccaggca gttatgaagt aaccatttat    171480
     acagaagatt catctggtaa tcgttcagaa acagtaacga tcaccgtgaa agtaccagaa    171540
     gctagaatag ggaaaattac tattcaatat atggatagtg aaaacaatga attagctgaa    171600
     agtaatacga ttactggcga agttggtgaa acgtatgaaa cacttgctaa agaaattgaa    171660
     ggctatacgc taaaagaaaa tccagctaat tcaagtgggg tttttgaaga aactagacaa    171720
     acgattcaat atatttacgt gaaagatata attaacccag aatttccagt atacagcgaa    171780
     aacaacgtaa caccagaact cccaagtaac aataataact cggtcaatgg gtccaggcaa    171840
     acaccaagta aatcagtaaa gaaacagtca aaggcatact cgaaaattaa tcaaatgcca    171900
     atgaatcttc cagaaacagg agatagcaca aatttactct ttatttttat gggtgttctg    171960
     ttattagctg gattaaccct ctctaaagct aaaagaaaaa atcaataaaa aaacacctcg    172020
     taaatcttgc actgacatgg aaaaatgaga atgaaataaa aaccctttaa attaggctgc    172080
     ttgtttcctg aaattaatag gagattggta gcctaatttt tgttgaattc gtttttcgtt    172140
     ataatattta atgtaatctt ttacgatttg gattacaata gatttagcgt atttatacgc    172200
     tgttttatgg tagaatgttt cgcactttag cgaggaatgg aaacattcta tgggagcgtt    172260
     gtctgcgggt gtcccttttc gggacatact gcggataacg tttttctttt tacagcactg    172320
     ataatattca taagatgtgt acaccgaacc ttgatcgcta tgaagtaaac ttccttctgg    172380
     aagggacaac tgatttaatg tatctagcac taattctgtg tctgtttttc gccaatggag    172440
     taggcaacga tttctccatt atacaaatcc ataatgcttg ataaatataa acggcagtct    172500
     ccgaaataaa ggtaggtgat atcggtagtt aatttttcca gcggctgact agcttgaaag    172560
     tttcgattta agtggttttc tgtttgatag taggcggagc ctggtcgatt tttctttttt    172620
     acttttacct gacattgcca ctgatatttt tgcataatac gctgtacttt attgatgcca    172680
     acttgttctt cttgtttcat taatgcggcg atttttcgat aaccataagt gaactgatat    172740
     gttttacata actgccctat tttttctcca atgagctctg tgcgaaatct ttctttttcc    172800
     agtgataata ggtagataaa ggtacttgta gtatctgaca gatatctttg acaagatact    172860
     ttgtttttag ctcttctact aacaaaacaa aatatgctgg attcacttcc tttccaatgc    172920
     cttgtacttt tttaaaattt ccagttctag ctctttttgc cgaagagcta tttttaattg    172980
     ttctatttct ggtaattcag gcaccccttt ttggtattta tattgtttac ctaccccttg    173040
     gtgaaacctg tgggtttctt catttcgata ccagcgccac caagttttca cttgtgttgg    173100
     atttttgatg tttaatgttc tcataatttc tttggtagat ttacctgcta atttcatttt    173160
     gatagctttt tcttttattt ctgctggata cattactctt gtactcatag aaacacctcc    173220
     gttagtttca ttttacatga atccaacgaa ggtgttttta tcttattctc attttttaat    173280
     ggcagtgcca tctttacgag gtgttttttt atttcttttt aaataatagt aacggggcac    173340
     tgattaaaag aagcaaggct ccgaagatag tggatgattt actttggtca gtatcaccag    173400
     ttgttggtaa agagctataa gttgtttttt ctacagaatt actagtacta ggattagtat    173460
     tatcattagc tggttttaca gttacaggct tattaactac tggattaact ggtttaaccg    173520
     gttcaactgg attaacagta attggtgtag gtgttacggt atctttttta taaatataat    173580
     caactgtttg tggagtatca gtgaaagtac cagttgcgtt tgtaggtgta gtttctaaag    173640
     tataaccggt aatttttttg ctttctgact gataattact gttgacaact ccagttaatg    173700
     tatctgattc tgcgatttta ttaccattgc tatcaagatg attcacagtg atgtttgccc    173760
     cagctacggg tgcaggagta gacacatgaa cggtgacatt tagtgtattt gagacgttac    173820
     ctgctttatc ggttgcttga acattgaccg agtaatcacc actaactgct aaattaactg    173880
     cggaagtaaa attgcttgta agactaatag tggagtcata attatcagta acgctagcat    173940
     gaatgtctgt taaaaattgt tcttccgtaa catcacttcc agggctgtat gtgatttctg    174000
     tttcttctgc tttaacaact ggtgcgctaa tatcttttgg ttttaaagag ccagtggagg    174060
     tggatttgtt accagctttg tcttcgcttg tagctgttgc ggtcgcaact aaagaatcaa    174120
     tcttggcttc tccaccttca cctgaataag aagttttcca gtcgaacttt acttttgctt    174180
     tggataaact atcccaactt gttactttgt cgaatttaaa agtaacagtg ttagtggaat    174240
     tgtcaaagct agttgtccca acttggtttg taatgtcttc cccaccaaca gaaacctgta    174300
     agtccgtata gttcatgcca cttggtagcg ctaattttat ttccagttta tagtcttcct    174360
     gggtttgatt cgttaaagtt ggaaatgtaa gagtggatgt gtatttatat gggacattct    174420
     cattggtatt ttgtagtaat gcaatattat ttgtatcgtg agtatcagca agtgcagaaa    174480
     taggtgtaag tgctatttga ctagctagag aacttaaaac tataaggcta gcgatagttt    174540
     ttttcttatt aaacattata taaataacct ctttccttga attggaattt aatgtaatta    174600
     aagtatagca ctcgattttg gggcgttagt ttaattctag tagcattaat atggtatatt    174660
     ttgtcgaaat aatgactaat gagaatcata aaaaggtaaa tcgttaattt aaactttaac    174720
     agttagcgct attaagtact tttactcaga aaacctctac catcttcttg ttatttcagc    174780
     tataatgaag taattgaaaa ctaaattaaa ggatatacaa ggaggaaaac gatttgaaca    174840
     ttatgattgc gctgattcct gcattacttt ggggaacagt cccgctaatt attacaaaat    174900
     ttggcggttc aacaagacaa caaacgatgg gaatgacact aggggcactc acttttgcgg    174960
     taatcgtttt cttctttact gatccagttt atacgcttaa aacagtaggg attagtttta    175020
     taacaggatg tttatggact gttggtcaga tgttccaact gcaagcattc aaaattatcg    175080
     gtgtttcaaa agcaatgccg atttctacag ggatgcaatt agttggaaca acactttgcg    175140
     gggtaatctt atttcatgaa tgggatacga cacttcgaat tattttaggt tttatagcat    175200
     tagctcttat cgtcggtgga attttcttaa catcttatgc tgaaaaagaa gaagatggta    175260
     ctaatgcatt aaaacaaggt ttgatcacat tattcatttc tgcttgtggt tatgttggct    175320
     tagttgttct aattcaaggt ttcaaaatcg atggaattaa tgcgattttg ccgcaagcga    175380
     ttgggatggt tataagtgcg ctaattatga cacacagtgg tggtacggaa aaacgcttca    175440
     ataaacgaac tctcttactt actattccag gagtgatttg ggcagctgga aacgttgcga    175500
     tggttcacgc taaccaactt gttggagtcg caactggttt ttcactttcg caattaggag    175560
     ttgttatctc aactattgga ggtatcatac ttttaaaaga aaagaaaacg caaaaagaaa    175620
     tgctttttgt tattgtgggc gtagttttag ttgttctcgg cgggatttta atcggcgttg    175680
     caaaaggcgc ttaattaatt atttcgttta gcgtgaaaaa tgatataatg atactaattg    175740
     ttttattttt aaggagggaa ttgtgttgcc tgaagagaaa aatacgtttt atattacaac    175800
     accaatctat tatccaagcg gaaaagcgca tatcggccat gcttatacga ctgtcgcggg    175860
     ggacgcgatg gctcgttata aacgcttaaa aggatatgat gtgttttact taactggaac    175920
     agatgagcac ggtcaaaaaa tccaagcgaa agcgaaagaa cgcggaattt ctgaacaaga    175980
     atacgtggat gaaatcgcag aaggcttcca agaactttgg aaaaaactag aaatttctaa    176040
     tacggatttt attcgtacaa cacaagaccg tcataaaaca tcggttgaaa aaatctttga    176100
     acaactttta gagcaaggcg acatttactt aggtgaatac gaaggttggt actctgtttc    176160
     tgatgaagaa tactttacag aaacacagtt agaagaagta tataaagatg aaaatggcaa    176220
     agtaatcggc ggaaaagctc caagtggcaa tgaagtcgaa cttgttaaag aagaatccta    176280
     cttcttccgt atgagcaaat atgcggaccg tttagtagaa tattataatt cccatccaga    176340
     atttatcctt cctgaatcca gaaaaaatga aatgattaat aatttcatta aacctggttt    176400
     ggaagattta gcagtatcta gaacaacttt tgattggggt attaaagttc ctggtaatcc    176460
     aaaacatgtt gtttatgtat ggattgatgc gctttctaac tatattactg cgcttggata    176520
     taatacggac aatgatacga aattccaaaa atactggcct gctgatgtac aaatcgttgg    176580
     gaaagaaatc gttcgtttcc acacaattta ttggccaatt atgctgatgg cactagactt    176640
     accacttccc aaaatggtat tcggccatgg ctggatttta atgaaagatg gtaaaatgtc    176700
     gaaatccaaa ggtaacgtag tagatcctta tatgctgatt gaccgctacg gcctagatgc    176760
     gcttcgttat tacttattac gcgaagttcc atttggctca gatggtttat ttacaccaga    176820
     agactttgtt gatcgtgtga actttgatct tgccaacgat ttaggaaact tgcttaatcg    176880
     tacagtagca atgattaaca aatactttga tggtgaaatt ccggcttatc aaggtaatgt    176940
     aacagaattt gatcaaattt tagtagattt taaaaacaat gtggtgaagg aatacgaagg    177000
     tagcatggat cacatgcaat tctctgtagc tttaaaccaa ctgtggtcac taatttctcg    177060
     tacaaataaa tatatcgatg aaactgctcc atgggcactt gccaaggacg aagataaacg    177120
     cacagaactt gcaagcgtaa tgactcattt agcggaaaac ctacgtatta tcgcagtgct    177180
     tttacaacca ttcttaacaa gaactccggg cgaaatcttc ttacaactag gtttacaaga    177240
     agaaaacttg aaaaaatggg atagcattta tggatatggt gaaattccag caggcaccac    177300
     tgtggtgaaa aaaggtacgc caattttccc gagacttgat gcagaagtgg aagttaccta    177360
     tattcaagat gaaatgaaag gctctgcacc agcgcctgcc gaagaagtgg cggaagttga    177420
     agcacttgaa acaccgcaaa tcggcattga agacttcgac aaaatcgatc ttcgtgttgc    177480
     agaagtaaaa caagtagata aagtgaaaaa agcagataaa cttctttgtt tccaattaga    177540
     tttaggagaa ggaaaactac gccaagtgct ttcaggcatt gccgaattct atcaaccaga    177600
     agaactaatc ggcaaaaaag ttatcgtcgt ttctaactta aaacctgtga aacttcgcgg    177660
     actaatgagc gaaggaatga ttctctcagg cgaaaaagat ggcaagctaa gcgtaattga    177720
     agcaagtagc gcacttccaa atggtgcgaa agtaaaatag taaaaacgag tcctaattca    177780
     cttgaattag ggctcatttt tttcgtttaa aaaaacttta aaaaaaagat tgcatattgc    177840
     aaacgattac aatataatgt aactatactt acttaattca ttgaacgaag taagttgtca    177900
     gccagaagta aaggagcttg aaaatggata tcttaagaaa agggaataaa gatttaatta    177960
     aagacataaa ccgctataca gtactgaatt taatccgtga aaaaggagaa atcacgcgga    178020
     ctgagatagc caaaaaatgc gattttggga tgtctacatt aacgtatatt ttagatgatt    178080
     tacagcaaga aggcattatt ttggaaggtg ccgaaacatc atctactgga ggcagacgtg    178140
     ccaagctagt cagatttaat aaagattatg gatttgttgt tagtgtcaaa gtagaagagg    178200
     aacaacttct ttttgcgttg actgatttaa atgcagaaat cattgaaaat acttctatac    178260
     cattttcttc agagaaaaaa ccagaagaag caattgagtt gattgctaaa aatgtgaaaa    178320
     agatgtgtgg aaacagagat atgaaccatt tgctaggagt tggaattgcg atttccggtc    178380
     tagttaatcg taaaaaagga acagttatcc gctctactat gttagggtgg gaaaatgtcg    178440
     ctttagaagc aatgctacat gctcactttc cagatattcc agtgtatgta gataaaaata    178500
     taaactgcta cacacttgca gaactgtggt taggtgaagg gaaacaatca aataattttg    178560
     ccacagtttc cgttggagct ggacttggtt tatctgttgt tattaatcgc caaatttatt    178620
     acggtgcaca aggtggagct ggtgaattcg gacatacaac gattcagcca ggtggataca    178680
     aatgtcactg tggtcaaaaa ggatgcttag aaatgtacgc atccgaattt tatttccgaa    178740
     atcgtggcga agaattaaaa gaagcatatc ccacatcaga attaaatgat tttcattttg    178800
     ataaagtggc gaaaagtgct cgagctggag acgaaatggc gacggaactt atgggtaaaa    178860
     tgggtgaata tttaggatac gggattcgaa atatcatcaa tactttcaac ccagaaaaag    178920
     ttatcattgt cggtgaaggt ttgcatcata gagacttatt cttaactaaa attgatgaaa    178980
     ttgcttcaca aaactttttt tcaggggctg gctttgaaac ggaaattact acaacttctt    179040
     tagaggatcc tgcatggtta caaggtgcgg ctttactagt cattcaccaa ttattccaag    179100
     tgccaatcta tgaagaagaa caaactttac tacgttaaaa agtacataaa ctatttcagg    179160
     aggttatttt tacatggttg gtatgactag aaagaaaaca ctcttttggc tatgcatatt    179220
     cttgctaccc aatttactag gttttctcat ttttattgca atcccaatcc ttggctcgct    179280
     tggtattagt tttaccgatt gggacttagt gagtacgatt cactttactg gatttgaaaa    179340
     ttacaaaagg ctatttaatg acccagaatt ttggaaatcg tttagaaata caatcacgtt    179400
     catcatcggt tatttaccaa gtgtaatgat tcttggtctt gcgtgtgcct tgatgttaaa    179460
     ccaaaaaatt aaactaagac catttttccg agcagtgtac ttcttacccg tgatcacttc    179520
     atgggtagct gtttcactcg tttggaaatg gcttttcaac ccttcgtacg gtctgatcaa    179580
     ttacttctta tctttaattg gtattgcagg accaaactgg ttaactgatc cacaaacggc    179640
     gatgatcgct gtgattatta ccagtgcgtg gaaagatatt ggtttcgtta tggtattatt    179700
     ccttggtggt ttgcaaaata tttcaccatc ttactacgaa gctgccaata tggacggagc    179760
     gtcaaaactt cgccaattat tctctattac catcccactt cttactccaa ccacattctt    179820
     tgtgacgata atatctctta tcaactcgtt ccaggtgttt gaccaagtga tgattatgac    179880
     tgaaggtggt ccaagtggag cgacgatgac cttagtccaa aatatttaca accatgcatt    179940
     tagatacttc gaaatgggct atgcttccgc gatgagttgg atattgttta ttgttatttt    180000
     catcattaca attattcaaa ataaacttca aaaaaggtgg tccaattact aatgaaaaca    180060
     gaaaaaagtg gttcaccaaa atggcaacta ttcaaaaata ttcttaccta tacaatcatc    180120
     tgtcttggtg ggattatcat gcttatgcca tttgtctgga tggtatcaac tgcattcaaa    180180
     acaggcgcag cgaatatggt attaccacca caatttattc ctaaagaacc gacaactgcg    180240
     aacttcactc aagtatttga aatgttccca atgttgcgat ttttagttaa ctccgtgata    180300
     gttgcagttg taacaacact cggtcaaatg ctgttttgtt caatggcagc gtatgcattt    180360
     gccagaattc ctttctgggg tcgcgataaa ctatttttac tttacttggc aacaatgatg    180420
     gtaccggctc aggttacgat gattccacaa tttatcttga tgaaacaatt tggctggtta    180480
     gattcttatg caggtttgat tgtaccagca ttattcagcg tttttggtac atttttatta    180540
     cgtcaagcat tcatgggaat tccgaaagaa ttagaagaag ctgcatttat ggatggagca    180600
     aatcatttta ctattttccg aaaagttatc ttgccgcttg caaaacctac atttgcgaca    180660
     cttggaattt taacttttat gcaatcttgg aacagttatt tatggccatt aatcgtgaca    180720
     agttcacaag aaatggcaac tttaccttta ggattatctc ttttacaagg tagatatggc    180780
     acgaattacg gcttaatgat ggcgggagtt cttattagtg ttatcccgat tttagcagtg    180840
     tacctttttg ctcaaaaata tttcatccaa ggaatggcaa tgagcggaat gaaagaataa    180900
     aaaaccaaca aaaaaggagt gttacaaatg aaaaaaggtt tattattgtt aatggtagtt    180960
     gtactgtctg tatttggtct ttcggcttgc ggcggtggca gtagtagtgg cgataaaaca    181020
     gaaattacgt attatcaatt ctctgcacca gctgatggaa aagcacttga tgaaatggta    181080
     aaagaatttg aaaagcaaaa cccagatatt aaagtaaacg ttcaaacaat cgcatttaat    181140
     gattacttca cgaagctgca aacgcaaatc gcaggtggag atgctcctga tgcttttgaa    181200
     cttaactatg aaacattcat gcaatatgct gaaaaaggtg tacttgcaga tttaacaagc    181260
     tatatcgaaa aagataaaga ttttgatcca tctacgctta acaaacaagc ctacgatgct    181320
     ttcaaatatg acggtaaaca atacggcatg gtagaaagtt tctccaacgt tgtaacaatt    181380
     tacaataaag acctttttga taaagccggc gttgaatacc cgacagctga ctggacttgg    181440
     aaagacgaag aagcggcagc gaaaaaatta acagatgcta aaaataaagt ttggggaact    181500
     tcccaaccag taacaatgaa cgaattctac aaagtagcag cgcaaaatgg tggttcgatt    181560
     ttcaatgaag atttaacgga aacaactatt aacagccctg aaaatgtgga agcactgact    181620
     cacttaacaa atgaagtaac tgattcaaaa gttgcgcctt caccagctga tttatctgga    181680
     caattaccag aagatttatt catgaatggt caaattgcaa tgcttcacac aggtatttgg    181740
     ttgttcgata tgttccaaga tgctccgttc aaatgggatg tacaagtaga agcaggtaac    181800
     acacaaaaag caacccactt cttcgcgaac ggaattggtg tttctaaaga ctccgataaa    181860
     aaagaagctg cattcaaatt tgcttccttc atgagtgcga acgaagaagc agcaaaaatc    181920
     agaattgata ataactggga acttccagca acagaaaaca aagaaattct acaaccatat    181980
     ttagatgcaa ctcctccaga taatagagaa gcggtattcg aatctctaca atatatggta    182040
     ttacctccag ttgtgaaaga ttggaacaaa atcagtgatt atacaaactc tgaattcgaa    182100
     aaagtattaa atggcgattc taccccagaa aaagcactga aaaacagtga agacaacatc    182160
     aacaaaacaa tgggatttaa ataagtaaaa cgagtggcag ggacgtttgt aagtatcttt    182220
     acaaattaga ctgccacttt agtatatcca agaaaggaaa tagaacatgt ctaaattcac    182280
     aaaattaatg cagggttact tgcatttaat agaaggaaaa aacgaaaaaa tcaaaccaat    182340
     cctcctggaa acaaaaccta actttacaac tgattcagtc cttgaaaccg cttcttggct    182400
     atggcttagc agtaaaatca accattatga tagagaagaa gtagagccag taattgcatt    182460
     tttagttgaa aactggaatc gtcctgaaaa gtctatttgg ggttcagctg aaaatgatat    182520
     ttatttagca actatttcaa gtgtatactc tgcattatta gatgtgaaaa acacttttcc    182580
     aaaaccggag ttacaacaaa cgattacaat tatccgcgac tattgttttg ataatttatt    182640
     aaaaggcgat agcattctta ctggttttaa cacgcggaaa gtgtcaaccg accagctttt    182700
     atccgtgctt ccgtttggtc tattttcgcc tgaagatctt gtaatggtgg cggctgttgg    182760
     caaaatggaa caacaattag tgcaagatga tggggtattg ccttattcag gagcaccaag    182820
     agttaattcc tttgcaacgg ctctaatggc gctatatttc ttagaaaaaa gtgaccaaga    182880
     taaagcttta cactatttga atatggcaat gaagatggaa gataatgacg aacttggcgc    182940
     gatttttatt gaaattaacc aagcattccg ggcgatggaa agtgaagtga cagcgcatat    183000
     ttcacacgat ccttttgggc atgaaaatcg ctatgagcaa cagttaactg aacgcacgcc    183060
     acattatccc gaaacagaaa tgcatttttc ggctgcgtgt gaagttattt ctgaagtcga    183120
     accaatccaa gtcgaacttg tattaaaaga aaaagactgg accattttat gtgagaaaaa    183180
     agagaaaaat gatgtccaaa tctgggaagc gctcgttcca ccgttagaag aagttggcga    183240
     gtatacgtat tatttccagg cgacaatgaa agaccaaacc actttgacat cagatgatta    183300
     taaagtcgaa ccaatttgga aacactggtc agaagaagca gcaatttgcg aaacagagca    183360
     aggtttaatg gttttattta aagaaaatcc atcaagtatc atcccggtcg agttcaccgt    183420
     gaaatcagat gaacttgtaa tcgggttaaa accttcgttt gaagcgagca atgttaaaac    183480
     aaaatcatcc ggccaattaa aaaaagatga tttagagatt atcgtttcaa acaatccagt    183540
     gcgtctcgaa gtacacttta aaggcaaatt aattctagaa tcccataaaa tttacccagc    183600
     gttacaatgg tataccgata aaactggcac aatcaacaaa gttaaactgc atttagatgc    183660
     gccaaaagaa gaagagtatt acggcttcgg tgaacgctac aatgcattag gtcagcgcgg    183720
     gaatgtgctt gattgctttg tttataatca gtaccgcgat caaggaacaa gaacctacat    183780
     cccgatgccg ttttatcaca cgaatcgtga ttatagtgtg ttcgttgata ccgctcgtta    183840
     cacaagtttt gatttaggta accaattagc ggacaagcat acaattacag tagaaataaa    183900
     tggctgcgat acagatatct gtcttttaat gggagatatt cgtagtgcag tagctaatta    183960
     tatgaaaaaa actgggaagc ctgcgatggt tccagtttgg gcgcttggac cgtggatgtc    184020
     tagtaataac tgggaccgcg aatctgtcgt tcgaaatgaa gtagaaacaa cgcaagaatt    184080
     gcaaatccca tcaaccgttg tcgtgctaga acaatggagc gatgaagcga cctattatat    184140
     gttcaatgac gccgaatatg acgaaaaagc accatccgaa gcatattcct acgatgaaat    184200
     tagattccct tcatggggca gatggccaga tccaaaagga atggttgact acattcatga    184260
     caataaaatg aaattaattc tttggcaaat tccgattcaa aaatacttaa accgtcaaca    184320
     acacccacta aaagaccgcg aagaagccta tatgattgaa aaaggctacg tcgttaaaaa    184380
     tccagatggc tcgccgtacc gtattccaga aaactggttc acagaaagct tgataatgga    184440
     tttctccaat gaagaaggca aaaaatggtg gtttgataaa cgacaatatt tgattgatat    184500
     tggcgttgat ggctttaaaa cagacggcgg cgaattcgtt tttggagaag gattgcagtt    184560
     tgctgatggt agacgtggcg atgaaatgcg taatctttat ccaaatgact atgtggaagc    184620
     ttattatcaa tttgcgcaac aaaatgaggg catgacattt agtcgcgctg gctatactgg    184680
     tgcacaaaac ttcccggctc actgggctgg agacgaacgt tccacttttg atgcgtttag    184740
     aagatcgctc attgctggac tttcagctgg attttctgga attccgtttt ggagctttga    184800
     ttttgcaggc tttaacggtg acatcccaac ggccgagcta ttcattcgtt ctgctgaaat    184860
     ggctactttc tgcccaatta tgcagtatca tgctgaaagt aaagcggaat ttaatcaaga    184920
     ccggacaccg tggaacattg cttcacggac tggtgacgac tcggttatcc ctatttatcg    184980
     ccatttcgcg aatgttagaa tgaatatttt accttatatt tataacgaat cattaaaatg    185040
     tgttgaaact ggcttgccga tgatgcgtgc gcttttgttg gattataaag aagatccacg    185100
     tgtttctgat atgtatgacc aatacttatt cggggaagcg atgctgattg caccagtaat    185160
     tgaagacggc gtgcgctcga gagaagttta tctgccagaa ggaacttggt atgatttctg    185220
     gaatggaaca aaagtgagcg gaccaacttt acgcaaatgt aaagcggata aagaagaaat    185280
     tccagttttc gtccgtggtg gaaaagcagt actatgtaat gtagacgcta cgttgaaact    185340
     tggctcatgg gttggaaata ccgttgaaga gtacgatact ccactactaa aagtctattt    185400
     agacggagat ttcacagaag aaattaccga tcatttattc ggaaaatggc tagtgaaagt    185460
     aaccgagaat gcggatgaag taatcgtttc tgttcaaaca aatacggctt cctatgaagt    185520
     tgaagtaatc ggcacaacca aaaaagtaca aataaagaaa ggaagataac gatggatgct    185580
     tccacaagtt ttgcgattct accatctaat gtaaaacaaa aaacagcttt cgaaagaaaa    185640
     gtaaatcaag tgaaagcggc tagttggacg aataattgcc tgactggtac gcttgatatc    185700
     ggtcagttca gctgctattt tgttaatgaa aaaattgccc gcgtgacggt gaacccgttt    185760
     ggagaagtgg atttaacgcc ttcgattgcg gcaattcatg ataacgaaaa acaagctgca    185820
     aaattcacgg aaactaatga ctgctatgag cttcatttcg cggataaaga ggttatcgtt    185880
     tgtaaaaatc ctttccaaat tattatgaag caagcaggga agcgtatctt ccaaacagaa    185940
     ggcctggcaa ttaatcgcga caaagaacac caaatttcta ttcaaagcga accaggaacc    186000
     gcgatttttg gcttaggtga aaaaacggga gctttaaaca aagctggctc cattattagt    186060
     atgtggaaca cggatgtata cagtccacat aataaagata cagtggaatt atatcagtct    186120
     attcctttta tgattgcgga cactgcaaaa acaacatatg gcttatttta tgataattcg    186180
     caccgtacag aatttgattt tcaaagtttt gaagaaatgt ataccgtctt agcagaaggc    186240
     gggcaagcga atctttatat tatttttggc gaagatgtaa aagaagttgt cgcgaattat    186300
     accgatttaa ctgggaaaac gccacttccg cctaaatggt cgttaggtta tcatcagtcg    186360
     cgatacagct acacctcgga agaagaagtg gaacggattg cgaatacgtt taaagaaaag    186420
     gagattccgc tcgactgcgt attcatggac atacattata tggatgattt ccgcgtgttc    186480
     acttttaatc cggatacttt tccgaatggt ccagaattaa ttgcgcgtct tcgcgaacaa    186540
     aatattgacg ttgtgccgat tgttgatccg ggaattaaaa aagatgtcga ttattccgtt    186600
     taccaagagg gcatcaaaaa caattatttc tgcactaaac tagaagggtc gatttattat    186660
     ggtgatgttt ggccgggtgt cagtgctttt cctgatttcc taagtacgac cgttcagcat    186720
     tggtggggca gtttgcacaa gttttacaca gatttaggta tacgagggat ttggaatgat    186780
     atgaatgagc cgtctgtatt taatgaaagt aaaacgatgg atttagatgt tgtgcataat    186840
     ctagacggga aaaatgtgac ccataaagaa gcacataatt tatacggatt atatatgagt    186900
     aaagctactt ttgaaggttt aaaacgactt gtgccaaatg aacgtccatt ttcgcttact    186960
     cgtgctggtt atgcgggtgt tcagcgttat tcggcggttt ggacaggaga taatcgtagt    187020
     cactgggagc atttagaaat gtcgctaccg atgattatga atttaggatt gtcgggcgtt    187080
     gcgtttaccg gtgccgatgt tggcggattt tcttcggatt gtacgaaaga aatgttgatt    187140
     cgctggacgc aagccggtgc ctttttacca tatttcagaa atcactgtgt ccaagatagc    187200
     atttaccaag agccatgggc ttttggtgcg gacgcagaga aaattgtgaa gcaatatatt    187260
     gaattgcgct atgccttttt accgtatatt tatacagaat tccaaaaaac ggcagagagt    187320
     ggtttgccgc tcgttcggcc actttatatg gaatttaaag atgaacgcga tttaattcaa    187380
     gtaaacgatc aatttatgct tggtgaaaat atcctcgttg cgccaatcgt tcgcgaaggc    187440
     caagcgaagc gcctagttcg tttaccaaaa gggctttggt ttaattattg gacaaaagag    187500
     cagttcgtgg gcggcgacta tattatcgca gacgcgccga ttgataccat gccaatttac    187560
     attaaagcag gaacaattct gccagttggt agcagcgttc aaaatacaaa agagacgcaa    187620
     gaattgacat tagaagttta cttagacagt gagacagcaa ctggttacgt gtataatgat    187680
     gatgggaaaa gttaccaata tgaaagtggc gcagtatcca aaacaacact cacagctact    187740
     ttcaaaaatg gcgaagtact aataaatgct acccatcaag gtgaagcaaa cttgcagcaa    187800
     aaagtaacta ctatacaagt gtttggagaa aaaatagaca aaattacaag ggcgggaatt    187860
     taatcgatga aagaaaaaga ttggtggaaa aaaagcgtag tgtaccaaat ctatccaaag    187920
     agttttaatg attcgaatgg tgatggagtt ggtgatattc aaggaattat cgagaaatta    187980
     gattatttaa aagagcttgg tgtagacgtt atctggttgt ccccggtgta cgattcgccg    188040
     caagatgaca atggttacga tattcgcgat tatcaaaaaa tttacgaaga atatggtgac    188100
     atggcgactt ttgatcaatt gcttcaaggt ttacacgacc gcgatatgaa actcgtgatg    188160
     gacttagttg ttaaccatac ttctgatgaa cataagtggt ttgaagaatc tcggaaatcc    188220
     aaagataacc catatcgcga ttactatttc tggcgcgagg aaaacgaaat caacaactgg    188280
     ggttccattt tcagcggtcc agcatgggaa ttagacgaaa aaacaggcga gtactattta    188340
     cacctgttct ccaaaaaaca acctgattta aactgggaaa accctaaatt acgccaagat    188400
     gtatataata tgatgaaatt ctggctagat aaaggcattg atggtttccg catggacgta    188460
     attaatttta tttccaaaaa caccgatttc ccagatggtc cagtgccaga tggtcaaatt    188520
     tacggcgatg ctggcaatga tttctgcaat ggaccgcgga ttcatgagtt cttgcaagaa    188580
     atgaaccaag aagttacttc caaatacgat gtgatgactg ttggtgaaat gcctggtgct    188640
     agtacaactg acgcgcagat ttatacgaat ccagcaaata acgaagtcga tatgattttt    188700
     acatttgaac atatgaactt agattccgat agcgacaata aatgggattt gaaaccaatt    188760
     tacttaccag atttaaaaga aaacatgtcc gaatggcaag tggcgcttca agaaaatggc    188820
     tggaacagct tatactggaa caatcatgac caaccacgaa tcgtttctcg cttcggaaat    188880
     gacaatcgtt tccgcgttcg ttcagcgaaa atgctcgcaa cttgtctgca tatgatgaaa    188940
     ggaacgccgt acatttatca aggtgaagaa atcgggatga cgaatgttca ttttgaaacg    189000
     ctagatgatt atcgtgatat cgaaacgcta aacatgtaca aagaacgcaa agagcaaggc    189060
     cacagtcacg aaagtatcat gcagtcgatt tacacaaaag gtcgcgacaa tgcgagaacc    189120
     ccttatcagt gggataatag cgagaatgct ggcttcacaa ccggaacgcc ttggcttaaa    189180
     gtcaacccgc gctatacaga aatcaacaac gaagaagcgc tgaaaaaccc agattccatt    189240
     ttctactact accaaaatct tattaagtta cgaaaaacga ctgaaatcat cacaacaggt    189300
     aattatcgcc tgttattacc taaagatgaa gcgattttcg catatgaacg ctacacagaa    189360
     aatgaaaaat tagttgtttt atgtaatttc acagaagaag aacaagttat ttctgatgaa    189420
     accattttga acgaaatcca aaaaggttcc gttcttgtaa acaatgttcc taatattata    189480
     gaaggaactt tacgacctta cgaagcaatc gtttatcaaa tcaagtaaat ctcaggaaag    189540
     ccaccatttg ctaggtggct ttttttgtat gcatcaaaaa ttatagtata atagaaggaa    189600
     atgattttat taggaggaat tctcttgcta tttgatacgc atgtacacct taatgacgag    189660
     gcttttgatg atgatataga agaagtaata aaacgcgcgc aggaaaacga tgtgactcgt    189720
     atggccgtgg tgggctttaa taaagaaaca attgaccggg cgcttgaatt agcggagaaa    189780
     tatgatttta tctcattaat cgtcggctgg catcccacag acgctattac ctttacagac    189840
     gaagatttag aatggcttcg tgatttagca ctgacacacc caaaagtagt tgctttaggc    189900
     gaaatgggct tagattatca ctgggatact tcgccaaaag aaacgcaatt cgaggttttt    189960
     agaaaacaaa tccgtttagc gaaagaagtg aatttaccga tagttattca caaccgcgaa    190020
     gcaacggaag atgttgttcg tattttgcaa gaagaacacg ccgaagaagt aggcggaatt    190080
     atgcattgtt ttggtgaaac tgtcgaagta atggaagcat gcttagcgat gaatttttac    190140
     atttcgttcg gtggaacagt cacttttaaa aacgcaaaat taccgaaaat tgcagcccaa    190200
     gctataccaa ttgaccgttt attaattgaa actgacgcac cttatctcgc tccgacccca    190260
     aatcgtggaa aaagaaatga acctggatac gtcaagttag ttgccgaaaa aattgcagaa    190320
     ctgaaagaaa tgaaatatag cgaaatcgct acgcactcaa cggaaaacgc gaaaagacta    190380
     tttagaatca aagactaatt gtaacatgat tgtaatataa ggcccagtct gtaacccaat    190440
     cttaagcttc gcggagataa aaatcgtgac tgggacaaaa acccttattt tatgcctacg    190500
     accagagacg tagaaaaatg acacatttct gttacatttg acactttaaa agaatgttac    190560
     atttaaaaac ggctttatat caacgtttat ccaataagtt tgcgaaaata tgaacaatct    190620
     atataaaaaa ttgacagttc ttccctcccc tgtatataat cactagcgaa gtagaaaggg    190680
     gagaaataca tgaccatgga aaacagcagt aacgtagccc aatcatcaaa atggaaatta    190740
     ccaatcatga ttgcaggatt tgttattgta gtagcattgg ttttttattt cgttttcgaa    190800
     ggaactaaaa acgatatcac tatagtaaac gctggtgaaa aaattgaatc aagaacacat    190860
     gcgaaaactg tttcagaagc attagacgaa gcaggcatta aagtaagtga acgcgatgaa    190920
     attgcaccag gcaaaaatgc agaaatcaaa gacggcatgg aaattaaata tttgccagct    190980
     cgtcaaatta caataaatga taatggtact aaaaaagacg tttggagtac aaaagcaaac    191040
     gtagcagact tgcttaaaga tgaaaacatt acaactcgtc cgcaagatgt attaaacgta    191100
     gcattagata ctaaattgaa aaatggtctt gaagtgaaca ttaatcgtgc cattcaactt    191160
     tccttacaaa acggagcaaa aaaagataca gtatggacaa caaaaacaaa agttagtgat    191220
     ttactagctg agaaaaatat taaacttgat caagatgacc gtgtgtcacc tgcgaaagac    191280
     agtaacttaa aggaaaaaat gactgtagaa gttacatatg tcaattcaaa agcagaaaag    191340
     aaaaatgaac aagttaaatt cgaaacagta tacaaagaag acgatagcct aaacaaaggc    191400
     gttgaaaaag tcgttcaaga aggtaaaaac ggcaaaaaag ttgttgagta taaagtaaca    191460
     tttgaaaatg gcaaagagaa aaaacgcgat gtcattaaag aaaatgttac ttctaataaa    191520
     actgataaag tagttgtacg cggcacgaaa gaaaaagtgg ttgcaacacc agtttctaac    191580
     gtatccactt caagtgcaac gtcttcatca tcgtcatcag catcatcaac tccatcaggt    191640
     ggtaaaacat acaaaatgga atctactgca tattcaggtg gcggtactac agcttatggt    191700
     atcaacctaa gtgctaaccc tggactaaaa gtaattgcgg ttgatccacg aattattcca    191760
     cttggctcta aagtttgggt tgaaggatac ggagaagcaa tcgctggaga tactggcggc    191820
     gctatcaaag gaaatatcgt tgatgtgtat ttcccaaatg aaagtcagtg ctattcatgg    191880
     ggtagaagaa tggtgactgt caaagtatta aactaaattc gtataaaaac gaggctgact    191940
     catagggcct cgttttttct ttgtccaaaa tgtggtatga tgtatttact tattttataa    192000
     aaaaggatgt agtaattatg agcgggaagc ctgtaataca tgaatttata gtcgtagaag    192060
     gacgggacga tacaacggca attaatcgtt cagttattgc cgataccatt gagactaatg    192120
     gatctgccct ttcacaagaa acaatagaaa aaattagaca tgcgcaagaa cttcgcggcg    192180
     ttattatttt tacagatcca gattttccag gtgaaaaaat ccgaaaacaa attgactcag    192240
     cggtaccagg ctgtaaacac gcttttatca atcgccaaga tgctttacca aaagctggtc    192300
     gcggccttgg agtggaacat gccagtagcg ctaatattcg tgaagcatta gaaaacttcc    192360
     atacgagtgg ggcgcccact gaaaaacaat ttatttccaa agatattctt gttcatctcg    192420
     gtcttcttgg aggagtggga gcgaaagaac gccgagaaaa aatcggaaat atactaaaaa    192480
     ttggttatac aaacggaaaa caactacaaa ccagactaga atcatttgca atcagtgaag    192540
     aacagttagt agccgcgtgc caaaagatta tgcaggagga agaaaatgag taaagatatt    192600
     gcaactcccg gaagaacgac agaaatccta aagaagtatg gtttcttatt taaaaaaagt    192660
     cttggtcaaa actttttaat cgacagtaat attttgacgc ggattacaga tacagccgaa    192720
     ataacaaaag aaacaaacgt catcgaaatc ggaccgggta tcggcgcgct aacagaacaa    192780
     ttagccaaaa cagcgaatga agtcgttgct tttgaaattg atcaacgttt actgccaatt    192840
     cttgatgata cactgagtgc ttacaataat gtcaaagtag tccacggaga cgtgctaaaa    192900
     gcagatgtag aagaagtcat cgcagagcaa ttcgcgaagc cagaactacc actaaaaatc    192960
     gtagcaaacc ttccgtatta cgtaaccaca ccaattattt taaaacttct acacgataat    193020
     atcccggcag attcgatgac atttatgctt caaaaagaag ttgcggaccg gataagtgca    193080
     gttccaagta cgaaaagcta cggaagccta acaatcgcta tccaatttta catggaagca    193140
     gaactagcct ttatcgtgcc aaaaaccgtc tttatgccac aaccaaatgt tgattccgca    193200
     gtaattcatc tgaagcgtcg caaagaacca ttagctgaag tgaacgacga agaatttttc    193260
     tttgaagtaa caagagcttc gtttgctcaa agaagaaaaa cgctttggaa taacttagct    193320
     tcaaaatttc cagctttaaa accgcgcaaa gacgagttgg tagaaggttt aaatgccatt    193380
     ggtatagact taatccgtcg tggagaaacg ttggatattc cggaatttgc taaattaagc    193440
     aactttttag gtgatttttt aaaggaaaaa taattttttt caaaaaaagc gctttcttag    193500
     ttgacagtta gcccttccaa ctgttaaaat atttggttat tgatttcgga gccgaactat    193560
     gctataatgg atattagtga ggtggaaaat aaatgccaaa aaccattgca agcattaaga    193620
     cgaatttaga ttctagatta ggtaaagcat tgacattgaa agcaaacggt ggtcgtaaga    193680
     aaacgattga acgttgcggt atcctagctg aaacatatcc atccgttttc attgtggagc    193740
     ttgatcaaga tgaaaacaac tttgaaagag tatcctatag ttacacggat atcttaacag    193800
     acgcagtaga acttgtattt acagatgata ataaagaatt agctttataa tgaagctgaa    193860
     gtagccggac catatagcgt ggttcggttt ttgctataca tagaagttgt tttgggccgc    193920
     tagctacata ttttttcttt catatgatag aatagaaaaa gagattttga acgcggaggc    193980
     caagaaaaat gaaaataagc attacagcac cagctaaaat taatctttca cttgatgcgc    194040
     tgtacaaacg tgaggatggc tatcatgaag tggaaatggt gatgacaaca atcgaccttg    194100
     ctgatagatt atacttagaa cgcttagacg aagacaaaat tgtgctggat gtaaaagcgc    194160
     actttattcc agaagatcgt cgcaatttaa tttatcaagc ggccctcctt ttaaagaagc    194220
     gttttgacgt aaagatgggt gtgcgcatta caattgataa gcatattcct gtttctgcgg    194280
     gacttgctgg tggtagttca gatgcagctg cagcgctcaa aggattaaat gtcatttggg    194340
     aacttggtct ttcaatagaa gaattagccg aaattagttc agaaattggt tctgatatcg    194400
     ctttttgcgt atacggcgga acagcgctag caactggacg cggggagaaa atttctgcgt    194460
     tacctaatat tcctggttgt tggattgtac ttgctaagcc gagcattagc gtgtcaacac    194520
     ccactatcta taaagaactt caagtagaca atgtagaaca cccagacaca caaaaaatga    194580
     ttgaatccat caaaaatggt gatctagacg ggatttttgc ggctacaggg aatgtgctag    194640
     agtctgtgac attagaaaaa aatccgcaag ttaaacgaat aaaagatcgg atgttagcgt    194700
     ttggtgctga ggcggctcta atgagtggta gcggtccgac agtgtttgcg cttatcaaac    194760
     agtactccag agcaaaacgt gtctataacg gcttgcgtgg cttttgtgag gaagtttata    194820
     tggttagacc atggagtgaa ggcgagaacg atacaaatat aaattattaa tgaatgagag    194880
     gggtcaaaga aatgaaaatt atttttaatg cagatgattt tgggattagc ccgggagcag    194940
     tttatggtat tttagagtcg tataagcgag gcgttgtgaa atctaccacg cttcttgcta    195000
     atagcccggc atttgatttg gcagtagaag tagcgaaaga aaacccaggt ctcgatattg    195060
     gtgcacattt gactctgaca tttggctctc ctgttcttca agggttagaa acgttaacgg    195120
     atgatgatgg gcgtttccgc agaaattata cctcacttga aaacggctta gctgatgtag    195180
     atatgaatga ggtggagcgc gagttaactg cgcaaatcga gaaaattcta gatgcaggaa    195240
     ttactatttc tcattttgat acacatcatt cgattgagcc gctaatttat cccgtgcaac    195300
     ataaactagc agaaaaatac ggtgtgagca ttcgacgtca ttctgatgtt tcggatttcg    195360
     gtgctataaa aactcctgat ttgttcgcta cggagtttta tgcagacggt gtatcttttg    195420
     aaacgattaa aaaattagtg caaaagcata ttgggacgaa tgacgtagtc gaagtgatga    195480
     ctcatccagc atttattgat gaaacattgc gcgaaatatc tagttacgta gagccacgca    195540
     tcaaagaagt ttcaattcta acttcaagag aactacaagc atatttaggc caacaggaag    195600
     tagagattat tagtttccgt gatttataag agcatgaacc tgtcaaagga tgtttatttg    195660
     gcaggttttt tattacgtta aaataataaa tgttgtcaat tttatagaaa acgttttata    195720
     atagagaaaa tacggacaaa atacgtgaaa tagcttttta atatacggaa ttttatcaaa    195780
     gggagagaga ttatgaagat tcgtcgcagt gaacgattaa ttgatatgac gcagtttcta    195840
     ttatcgcatc cgcgaaagtt agtgccgctt acgatgtttg ctgaacgtta tggctcagct    195900
     aagtcttcta ttagtgaaga tttggtcatc ataaagaaaa catttgaaga tagagggatt    195960
     ggtacgctcg agactgttcc aggtgctgct ggtggtgtgc aatacatttc gatagcggga    196020
     aatgacgatg tgctggattt tgtgcatacg ctatgtaata gaattgcgga accaaaccgt    196080
     ttgcttccag ggggctattt gtacttatct gacctacttg gagaaccagt aacgctcaaa    196140
     gcaattggta aaattttagc aacgaaattc aataaccaaa aaatagatgc gattatgact    196200
     gttgcgacta agggtattcc gattgcgcaa gcggttgctg aacatttaag cgtcccattt    196260
     gttatcgtac gtcgtgatag caaagtgaca gaaggctcaa ccgtaagcat taactatgtt    196320
     tcaggctcat ccaaacgaat cgaaaaaatg gaattatcca aacgaagctt agctgaaggc    196380
     tctaacgtag taatcgtgga tgattttatg aaagctggag gaacaatcaa tggcatgaaa    196440
     aatctgctag aagaattcaa cgcgcattta gttggaattg gtgtgttagt tgaatccgaa    196500
     tatgcggaag agcgcttagt ggatgattac gtatctcttg taaaaataaa aaatgtgaac    196560
     atgaaagaaa aacaaatcga agttgttgat gggaattact ttaatagttg attctaaacc    196620
     ctggaaaaat attctggggt ttttcttttt tgaaacgaat tgctactaaa aacaaatcag    196680
     ccctccgatg tacttcactc agttaacttt tgtggtagaa tgaattctat cgttgctaca    196740
     taaaattcaa ggcttctaga cattaggagc agaaggagaa cattcatgaa aaaatgggtt    196800
     aaatggttaa ttgttatcgt tattatcgca gtagtagccg ttggtgcggt tttcttgctg    196860
     tcgaaaaata gtggctccgt aacacaagaa aaattagtta cagccaaagt aaaacaagga    196920
     gatatgaaaa tcaatgctac aggaacaggc gcgatttctc cggtaaacac acaagttcca    196980
     gattacgatg aacttcaatt agtagcgcaa atggacgaac ttgatattcc taacatcaag    197040
     aaagaccaag aagtaaaagt cacagtaaca gcattacctg acaaaactta tacaggaaaa    197100
     gtgaaagaaa tcgcagaaca aggtcaagtc caaaatggtg tgtctagctt ctccgtaatc    197160
     atttctcttg ataaaacaga cgacttaaaa gcgggtatga ctgctgatgc ttccatttta    197220
     gtaaatgaga aaaaagatgc gctatacgtt ccaattgaag ctgttcaaaa agacagtgac    197280
     gacaaatatt acgtattagt cccagaagaa aaagacaatg ggaaaacgaa aaaagtgaag    197340
     aaatttgtag aaactggtct tcataatgaa gataatatcg aaatcactaa aggtgttaaa    197400
     aaaggcgaaa aagtaatcct tcctacacaa gaaacttcta cggttcctgg tgctccaagc    197460
     taagtttttt gtaagtacaa attagacaaa ttgtatgaag gagggataaa catgccaaaa    197520
     ccgctaattg acatgaaaaa tttaacgaaa acatatacgc taggcggaga aacttttaaa    197580
     gcattagacg atgttacttt taccgttgag caaggcgagt ttttatccat cgttggtccg    197640
     tccggttccg gtaaatctac tttaatgaat atgattggct gtttggacgt tccggatgaa    197700
     ggcagctatc accttgatga tgtagatgtt tttaaactga gcgataataa actatccgaa    197760
     atcagaaata aaaaaatcgg ctttattttt cagcagttta atttgcttcc aaaattatct    197820
     gcctttgaaa acgtggaact accactaatt tatgcaggac taagtgtttc tgcacgagaa    197880
     aaagccgcaa tcgaatgttt ggaaaaagta ggcttacttg aaaagcgtag aaacttacca    197940
     acgcaacttt ctggtggaca gcagcaacgt gttgctatcg ctagagcact tgctggtaaa    198000
     ccgcaaattt tgctagcaga tgagccaact ggtgcgcttg attcgaaaac tggtaaagaa    198060
     gtaatgggga tcctgcaaga attgaatcgc gctggaaaca ccattgttat gattacacat    198120
     gatccaacta tcgcctctta cggtacaaga agtatccgta ttcaagatgg taaattattc    198180
     catgaggagg cgacccaagc atgaacgttc tccaaagtat gaaaatggca tggaaacaat    198240
     taaaggcaag taaattaagg tcttttctaa ccatgctagg tattattatt ggtgtcgcat    198300
     ctgttattct tttagtatct cttggaaatg gtgtgacgca agaagttgat gatcaaatgg    198360
     gcgatttggg ttcgaattta attacagtag ttaatagctc tgttaatcca aacgacaaat    198420
     atacgtatga tgaagtaatg aaatatcaaa acattgatgg agtcaaaagc gtttctccag    198480
     aattatctgg acaagtcaat gcaacttttg attataagaa ttcaagtaat aaggtgatag    198540
     gcacgaatga ccaatataag gccgcgcgta gcctagaaat gaaagaaggg cgtttcctac    198600
     taccgattga taccgaatat ggccagaaag tagctgtaat aggctctacg gtagcaagtg    198660
     atctatttgg ttttggggat ccgattggcg aaaccattag attaaacgga atgccttaca    198720
     aagttgttgg tgtcttgaaa gaaaaaggcg cgtctatgat gggatcgagc gatgatcaaa    198780
     tctttattcc gatttcttcc gctcaaaggc tcttaaaaga tacgaacgtt cgtacaattt    198840
     atgtagaaac aaaatctgct gaagatgttg attttgtagt aaacacatta gaatcacgtc    198900
     ttgcaattaa atttggcgac gaaaaagaac aagaaaaaaa tgcttcatct gcacaaatgg    198960
     gaccatctta tcaagtcatc aatcaacaag agattctcaa tgctttcaac acgattagta    199020
     caaccctaac tactgcgctt ggtgcgattg ctgccatttc gcttgttgtt ggtggtattg    199080
     gaattatgaa tattatgcta gtttctgtta gtgagcgaac gagagagatt ggtataagaa    199140
     aagcgctcgg agctaaaaaa cgggccattc tgttacaatt cctaattgaa tccattgtta    199200
     ttagtgtctg tggtggggtt atcggtatta ttatcggtgt ctcaggagcg ctcatatttg    199260
     gctccgtcgc aggtatatcg tcaggaataa ctgcaggaac cattatattc tccttcgtat    199320
     tctcactatg tattggagtg atatttggta tcgcacctgc taataaagct tcgaaattaa    199380
     gaccaattga cgcattaaga tccgagtaaa taaaaagaag cccgaaatga gctgtttcgg    199440
     gcttcttttt ttactaaaat tagcggctaa gttgtcttgt catctatatt taatcttttt    199500
     gtcacaatta aacgctttca atagccagtt ttggtaaaaa atttagaata aaaataaaat    199560
     taattctcgc aacgtgcatt agaatggggt tttgggggaa tatagtctct gttggttaat    199620
     tagcttaaat ggtttagaga agtataaaaa tgtaaatata tgagctctgt aaactcataa    199680
     atcctataga tattgtatac aattatcttc gaaaaatgat aaatcaaata ccgttttact    199740
     ggtgttattg tctgcaaaat agtatgatga ttacagattg atactgtgat ggcaatggtt    199800
     ttgaagtttt tatacgtata atgataatta ttgtatacaa aacaaaaact agaaggaaca    199860
     atctgtaaaa gtcaacgatt ttcaaaaaaa aaaacttttt tttagattac aattcacaaa    199920
     gttgtcaaat ttagtttttt ttattattat gttcataggg aagaatttta cgtgaatatt    199980
     gcttgcttta taaaagtaat tttttctatg ggggaatttt tctcgagtgt gtacttaagt    200040
     tgcatgtgag                                                           200050
//

If you have problems or comments...

PBIL Back to PBIL home page